Fehérjeszerkezet, és tekeredés

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "Fehérjeszerkezet, és tekeredés"


1 Fehérjeszerkezet, és tekeredés Futó Kinga Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan Titin: 3,435*10 4 aminosav C H N O S 693 Humán kromoszóma 1: 2,25*10 8 nukleotid Biopolimer Alegység Kötés Nukleinsav (RNS, DNS) Nukleotid (CTUGA) Kovalens (foszfodiészter) Poliszacharid (pl. glikogén) Cukor (pl. glukóz) Kovalens (pl. -glikozid) Fehérje Aminosav Kovalens (peptidkötés) Fehérjepolimer (pl. mikrotubulus) Fehérje (pl. tubulin) Másodlagos (Hidrogén kötés, ionos kötés,stb) 1

2 Fehérje (protein) Elnevezés: 1838 Jöns Jakob Berzelius (Svéd kémikus) Elsődleges fontosságú 1926 James B. Sumner (biokémikus,usa): ureáz egy fehérje Frederick Sanger Frederich Sanger : Kémiai Nobel-díj: Inzulin aminósav szekvenciájának meghatározása Max F. Perutz-t és John C. Kendrew : Kémiai Nobel-díj : hemoglobin és mioglobin kémiai szerkezetének feltérképezése (Röntgen krisztallográfia) Fehérje (protein) Fehérjék: Peptidkötésekkel összekapcsolt aminosavakból álló lineáris polimerek Feladataik: szerkezeti vagy vázfehérjék (kollagének) szállító funkció (miozin) biokémiai folyamatok szereplői (enzimek) immunológiai folyamatok szereplői (antitestek) jelátvitel,információtovábbítás (hormonok) 2

3 Fehérjék szerkezete: Elsődleges szerkezet: aminosav sorrend Peptid kötés kialakulása Fehérjék másodlagos szerkezete Másodlagos szerkezeti elemek hidrogén kötéseken keresztül stabilizálódnak. β-redő α-hélix 3

4 Béta-kanyar: olyan, nemhelikális tetrapeptid, amelynél az első és az utolsó alfa-szénatom távolsága 7 angströmnél kisebb. Gamma-kanyar: olyan tripeptid, melyben az első és az utolsó peptidcsoport között hidrogénkötés van. Számos kanyartípust definiáltak a szögek alapján: 7-féle béta kanyar (+ háromnak a tükörképe is), 2-féle gamma-kanyar 4

5 Fehérjék harmadlagos és negyedleges szerkezete Másodlagos strukturális elemek 3-dimenziós elrendeződése. Több alegység összekapcsolódásából létrejött szerveződési szint. Hemoglobin α-alegysége Hemoglobin A (2α és 2β alegység) Fehérjeszerkezetet összetartó erők: Diszulfid híd : cisztein as.-ak között Hidrogén híd : megosztott proton Sókötés : ellentétesen töltött részecskék között Hidrofób kh. : hidrofób molekularészek között (molekula belsejében) 5

6 Fehérjék feltekeredésének hajtóereje Hidrofób mag Hidrofil aminosavak Fehérjék feltekeredése (folding) 6

7 Energia Anfisen kísérlet Anfinsen - féle dogma: A fehérjék 3D szerkezetét az aminosav sorrendjük határozza meg. A felgombolyodás termodinamikai kontroll alatt áll: a natív szerkezet a termodinamikailag legstabilisabb állapot. Levinthal paradoxon Cyrius Levinthal-elméleti biokémikus 100 aminosavból álló peptid 2 konformációs lehetőség aminosavanként variáció 1 konformációs állapot 1ps év szükséges a natív állapot eléréséhez. A valóságban 1 másodpercen belül felgombolyodik! Cyrius Levinthal munka közben Szerkezet A folyamat nem véletlenszerű, a kialalkuló kötések és szerkezeti elemek meghatározzák a köv. lépést. 7

8 A feltekeredés tölcsér elmélete Kétállapotú rendszer Általános eset Függőleges tengely: a molekula ún. szabad energiája. Vízszintes: fehérjéhez tartozó konfromációs szabadségi fok. A felület minden egyes pontja a fehérje 1 konformációjának felel meg. Az egyes molekulák a globális energiaminimumot, azaz a natív állapotot keresik (legmélyebb pont). Molten globule ( olvadt gombóc ) 8

9 Energia tölcsér elmélet Nem megfelelően feltekeredett (misfolded) proteinek Prion: hibás térszerkezetű fehérjék, melyek fertőző ágensként viselkednek -Kuru ( nevető halál ) Daniel Carleton Gajdusek 1976 Nobel díj -Creutzfeldt-Jakob szindróma -Kergemarha kór β-amiloid felhalmozódása Alzheimer s kór Amiloid plakkok kialakulása az agyban Kuru-ban szenvedő őslakosok 9

10 Molekuláris chaperonok Segítik a fehérje folding-ot meggátolva a nem megfelelő kölcsönhatásokat, szétszedve a tiltott összekapcsolódásokat. Minden sejtkompartmentben jelen vannak. Olyan fehérjék, amelyek kötik és stabilizálják más fehérjék egyébként nem stabil alakjait, azok kontrollált kötésével és elengedésével elősegítik az előírt in vivo sorsuk beteljesedését, legyen az folding, oligomerizáció, komplexek kialakítása, transzport egy sejtkompartmentbe vagy éppen eliminálás. Legtöbbjük ATP-t igényel funkciója végzéséhez.elrontott fehérje megjavítása: 100 ATP. Összefoglaló 10


Fehérjeszerkezet, és tekeredés. Futó Kinga

Fehérjeszerkezet, és tekeredés. Futó Kinga Fehérjeszerkezet, és tekeredés Futó Kinga Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983 H 211861 N


Makromolekulák. Fehérjetekeredé. rjetekeredés. Biopolimer. Polimerek

Makromolekulák. Fehérjetekeredé. rjetekeredés. Biopolimer. Polimerek Biopolimerek Makromolekulá Makromolekulák. Fehé Fehérjetekeredé rjetekeredés. Osztódó sejt magorsófonala 2011. November 16. Huber Tamá Tamás Dohány levél epidermális sejtjének aktin hálózata Bakteriofágból


Biopolimer 12/7/09. Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. DNS. Polimerek. Kardos Roland DNS elsődleges szerkezete

Biopolimer 12/7/09. Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. DNS. Polimerek. Kardos Roland DNS elsődleges szerkezete Biopolimerek Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. Osztódó sejt magorsófonala Kardos Roland 2009.10.29. Dohány levél epidermális sejtjének aktin hálózat Bakteriofágból kiszabaduló


DNS, RNS, Fehérjék. makromolekulák biofizikája. Biológiai makromolekulák. A makromolekulák TÖMEG szerinti mennyisége a sejtben NAGY

DNS, RNS, Fehérjék. makromolekulák biofizikája. Biológiai makromolekulák. A makromolekulák TÖMEG szerinti mennyisége a sejtben NAGY makromolekulák biofizikája DNS, RNS, Fehérjék Kellermayer Miklós Tér Méret, alak, lokális és globális szerkezet Idő Fluktuációk, szerkezetváltozások, gombolyodás Kölcsönhatások Belső és külső kölcsöhatások,


A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin.

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin. Myoglobin Fehérje-szerkezetek! MGLSDGEWQLVLNVWGKVEADIPGGQEVLIRLFK GPETLEKFDKFKLKSEDEMKASE DLKKGATVLTALGGILKKKGEAEIKPLAQSA TKKIPVKYLEFISECIIQVLQSK PGDFGADAQGAMNKALELFRKDMASNYKELGFQG Fuxreiter Mónika! Debreceni


Fehérjeszerkezet, fehérjetekeredés

Fehérjeszerkezet, fehérjetekeredés Fehérjeszerkezet, fehérjetekeredés A fehérjeszerkezet szintjei A fehérjetekeredés elmélete: Anfinsen kísérlet Levinthal paradoxon A feltekeredés tölcsér elmélet 2014.11.05. Aminosavak és fehérjeszerkezet


A fehérjék hierarchikus szerkezete

A fehérjék hierarchikus szerkezete Fehérjék felosztása A fehérjék hierarchikus szerkezete Smeller László Semmelweis Egyetem Biofizikai és Sugárbiológiai Intézet Biológiai funkció alapján Enzimek (pl.: tripszin, citokróm-c ) Transzportfehérjék


A fehérjéket felépítő húsz standard aminosav Fehérjék szerkezetének kialakulása

A fehérjéket felépítő húsz standard aminosav Fehérjék szerkezetének kialakulása A fehérjéket felépítő húsz standard aminosav Fehérjék szerkezetének kialakulása Osváth Szabolcs Semmelweis Egyetem szabolcs.osvath@eok.sote.hu reakció t 1/2 25 ºC-on t 1/2 100 ºC-on DNS hidrolízis Biopolimerek


Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek

Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek Hidroxikarbonsavak α-hidroxi karbonsavak -Glikolsav (kézkrémek) - Tejsav (tejtermékek, izomláz, fogszuvasodás) - Citromsav (citrusfélékben,


Víz. A víz biofizikája. A vízmolekula szerkezete. A vízmolekula dinamikája. Forgó-rezgő mozgás

Víz. A víz biofizikája. A vízmolekula szerkezete. A vízmolekula dinamikája. Forgó-rezgő mozgás Víz A víz biofizikája Inspiráció forrása (zene, festészet). Thales (Kr. e. 580):...a víz minden dolgok forrása... Henry Cavendish (1783): a víz H2O. Egyedüli vegyület, amely a természetben mindhárom halmazállapotban


A fehérjék hierarchikus szerkezete

A fehérjék hierarchikus szerkezete Fehérjék felosztása A fehérjék hierarchikus szerkezete Smeller László Semmelweis Egyetem Biofizikai és Sugárbiológiai Intézet Biológiai funkció alapján Enzimek (pl.: tripszin, citokróm-c ) Transzportfehérjék


Az élő anyag szerkezeti egységei: víz, nukleinsavak, fehérjék. elrendeződés, rend, rendszer, periodikus ismétlődés

Az élő anyag szerkezeti egységei: víz, nukleinsavak, fehérjék. elrendeződés, rend, rendszer, periodikus ismétlődés Az élő anyag szerkezeti egységei: víz, nukleinsavak, fehérjék Agócs Gergely 2013. december 3. kedd 10:00 11:40 1. Mit értünk élő anyag alatt? Az élő szervezetet felépítő anyagok. Az anyag azonban nem csupán


FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest,

FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest, FEHÉRJÉK A MÁGNESEKBEN Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium Alkímia Ma, Budapest, 2013.02.28. I. FEHÉRJÉK: L-α aminosavakból felépülő lineáris polimerek α H 2 N CH COOH amino


Szerkesztette: Vizkievicz András

Szerkesztette: Vizkievicz András Fehérjék A fehérjék - proteinek - az élő szervezetek számára a legfontosabb vegyületek. Az élet bármilyen megnyilvánulási formája fehérjékkel kapcsolatos. A sejtek szárazanyagának minimum 50 %-át adják.



A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA 2013.10.09. CITOSZKELETON - DEFINÍCIÓ Fehérjékből felépülő, a sejt vázát alkotó intracelluláris rendszer. Eukarióta és prokarióta sejtekben egyaránt megtalálható.


A fehérjék szerkezete és az azt meghatározó kölcsönhatások

A fehérjék szerkezete és az azt meghatározó kölcsönhatások A fehérjék szerkezete és az azt meghatározó kölcsönhatások 1. A fehérjék szerepe az élõlényekben 2. A fehérjék szerkezetének szintjei 3. A fehérjék konformációs stabilitásáért felelõs kölcsönhatások 4.


Röntgen sugárzás. Wilhelm Röntgen. Röntgen feleségének keze

Röntgen sugárzás. Wilhelm Röntgen. Röntgen feleségének keze Röntgendiffrakció Kardos Roland 2010.03.08. Előadás vázlata Röntgen sugárzás Interferencia Huygens teória Diffrakció Diffrakciós eljárások Alkalmazás Röntgen sugárzás 1895 röntgen sugárzás felfedezés (1901



AZ ÉLET KÉMIÁJA... ÉLŐ ANYAG SZERVEZETI ALAPEGYSÉGE AZ ÉLET KÉMIÁJA... ÉLŐ ANYAG SZERVEZETI ALAPEGYSÉGE A biológia az élet tanulmányozásával foglalkozik, az élő szervezetekre viszont vonatkoznak a fizika és kémia törvényei MI ÉPÍTI FEL AZ ÉLŐ ANYAGOT? HOGYAN


Az élő szervezetek felépítése I. Biogén elemek biomolekulák alkotóelemei a természetben előforduló elemek közül 22 fordul elő az élővilágban O; N; C; H; P; és S; - élő anyag 99%-a Biogén elemek sajátosságai:



A METABOLIZMUS ENERGETIKÁJA A METABOLIZMUS ENERGETIKÁJA Futó Kinga 2014.10.01. Metabolizmus Metabolizmus = reakciók együttese, melyek a sejtekben lejátszódnak. Energia nyerés szempontjából vannak fototrófok ill. kemotrófok. szervesanyag


Fehérjék szerkezetének kialakulása II

Fehérjék szerkezetének kialakulása II Egy kis fehérje gombolyodása több párhuzamos úton Fehérjék szerkezetének kialakulása II Osváth Szabolcs Semmelweis Egyetem hélix kialakulás és kollapszus több párhuzamos úton további kollapszus és hélix


Orvosi Biofizika. Tematika. Biomolekuláris rendszerek mérettartománya. A tudományos igazság alapja Termodinamika. Komplexitás. Kellermayer Miklós

Orvosi Biofizika. Tematika. Biomolekuláris rendszerek mérettartománya. A tudományos igazság alapja Termodinamika. Komplexitás. Kellermayer Miklós Tematika Orvosi Biofizika Kellermayer Miklós Bevezetés. Az élő anyag szerkezete. Sugárzások. Lumineszcencia Röntgensugárzás Radioaktivitás, dozimetria. Hang, ultrahang. Biomolekuláris rendszerek vizsgálata.


Lehninger et al.: Principles of Biochemistry 3 rd ed (2000); Worth Publ. Voet et al.: Fundamentals of Biochemistry 1 st ed (1999); John Wiley

Lehninger et al.: Principles of Biochemistry 3 rd ed (2000); Worth Publ. Voet et al.: Fundamentals of Biochemistry 1 st ed (1999); John Wiley 1 TANKÖNYVEK Stryer et al.: Biochemistry 5 th ed. (2002); W.H Freeman ISBN: 0716746840 Lehninger et al.: Principles of Biochemistry 3 rd ed (2000); Worth Publ. Garrett & Grisham: Biochemistry 2 nd ed (1998);


1. jelentésük. Nevüket az alkotó szén, hidrogén, oxigén 1 : 2 : 1 arányából hajdan elképzelt képletről [C n (H 2 O) m ] kapták.

1. jelentésük. Nevüket az alkotó szén, hidrogén, oxigén 1 : 2 : 1 arányából hajdan elképzelt képletről [C n (H 2 O) m ] kapták. Összefoglalás II. Szénhidrátok 1. jelentésük Nevüket az alkotó szén, hidrogén, oxigén 1 : 2 : 1 arányából hajdan elképzelt képletről [C n (H 2 O) m ] kapták. Ha ezeket az anyagokat hevítjük vizet vesztenek


Fehérjék szerkezetének kialakulása II. Semmelweis Egyetem. Osváth Szabolcs

Fehérjék szerkezetének kialakulása II. Semmelweis Egyetem. Osváth Szabolcs Fehérjék szerkezetének kialakulása II Osváth Szabolcs Semmelweis Egyetem szabolcs.osvath@eok.sote.hu Egy kis fehérje gombolyodása több párhuzamos úton hélix kialakulás és kollapszus több párhuzamos úton


Nukleinsavak építőkövei

Nukleinsavak építőkövei ukleinsavak Szerkezeti hierarchia ukleinsavak építőkövei Pirimidin Purin Pirimidin Purin Timin (T) Adenin (A) Adenin (A) Citozin (C) Guanin (G) DS bázisai bázis Citozin (C) Guanin (G) RS bázisai bázis


Prológus helyett polimorfizmus kapcsolodó-mutációk

Prológus helyett polimorfizmus kapcsolodó-mutációk Prológus helyett polimorfizmus kapcsolodó-mutációk egy vesebetegség öröklésének vizsgálata során rámutattak, hogy hogyan okozhatnak gyakori genetikai variánsok ritka betegséget. Jó hír ez, mivel segíthet


A sejtek élete. 5. Robotoló törpék és óriások Az aminosavak és fehérjék R C NH 2. C COOH 5.1. A fehérjeépítőaminosavak általános

A sejtek élete. 5. Robotoló törpék és óriások Az aminosavak és fehérjék R C NH 2. C COOH 5.1. A fehérjeépítőaminosavak általános A sejtek élete 5. Robotoló törpék és óriások Az aminosavak és fehérjék e csak nézd! Milyen protonátmenetes reakcióra képes egy aminosav? R 2 5.1. A fehérjeépítőaminosavak általános képlete 5.2. A legegyszerűbb


Bár az elő szervezetek 70 95%-a víz, a többi elsősorban szénalapú vegyületekből áll

Bár az elő szervezetek 70 95%-a víz, a többi elsősorban szénalapú vegyületekből áll Szén a szerves molekulák alapja Bár az elő szervezetek 70 95%-a víz, a többi elsősorban szénalapú vegyületekből áll A szén példátlan képessége, hogy nagyméretű, komplex, különböző molekulákat képes kialakítani


A víz biofizikája O H H. Water. A vízmolekula szerkezete I.

A víz biofizikája O H H. Water. A vízmolekula szerkezete I. Újsághír Az Eagle Rock középiskola diákja nyerte el az első díjat az április 26-án megrendezett Idaho Falls középiskolai Tudományos Konferencián. Dolgozatával azt akarta bemutatni, mennyire ráhangolódtak


Biomolekulák nanomechanikája A biomolekuláris rugalmasság alapjai

Biomolekulák nanomechanikája A biomolekuláris rugalmasság alapjai Fogorvosi Anyagtan Fizikai Alapjai Biomolekulák nanomechanikája A biomolekuláris rugalmasság alapjai Mártonfalvi Zsolt Biofizikai és Sugárbiológiai Intézet Semmelweis Egyetem Budapest Biomolekulák mint


A kovalens kötés elmélete. Kovalens kötésű molekulák geometriája. Molekula geometria. Vegyértékelektronpár taszítási elmélet (VSEPR)

A kovalens kötés elmélete. Kovalens kötésű molekulák geometriája. Molekula geometria. Vegyértékelektronpár taszítási elmélet (VSEPR) 4. előadás A kovalens kötés elmélete Vegyértékelektronpár taszítási elmélet (VSEPR) az atomok kötő és nemkötő elektronpárjai úgy helyezkednek el a térben, hogy egymástól minél távolabb legyenek A központi


Természetes polimer szerkezeti anyagok: Makromolekulák

Természetes polimer szerkezeti anyagok: Makromolekulák POLIMERTECHNIKA TANSZÉK Dr. Morlin Bálint Dr. Tábi Tamás Természetes polimer szerkezeti anyagok: Makromolekulák 2016. Szeptember 9. Természetes polimer szerkezeti anyagok - Természetes polimer szerkezeti


Biokémiai kutatások ma

Biokémiai kutatások ma Nyitray László Biokémiai Tanszék Hb Biokémiai kutatások ma Makromolekulák szerkezet-funkció kutatása Molekuláris biológia minden szinten Redukcionista molekuláris biológia vs. holisztikus rendszerbiológia





Szerves kémiai és biokémiai alapok:

Szerves kémiai és biokémiai alapok: Szerves kémiai és biokémiai alapok: Másodlagos kémiai kötések: A másodlagos kötések energiája nagyságrenddel kisebb, mint az elsődlegeseké. Energiaközlés hatására a másodlagos kötések bomlanak fel először,


Bio-nanorendszerek. Vonderviszt Ferenc. Pannon Egyetem Nanotechnológia Tanszék

Bio-nanorendszerek. Vonderviszt Ferenc. Pannon Egyetem Nanotechnológia Tanszék Bio-nanorendszerek Vonderviszt Ferenc Pannon Egyetem Nanotechnológia Tanszék Technológia: képesség az anyag szerkezetének, az anyagot felépítő részecskék elrendeződésének befolyásolására. A technológiai


Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete

Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete Polipeptidek térszerkezete Tipikus (rendezett) konformerek em tipikus (rendezetlen) konformerek Periodikus vagy homokonformerek Aperiodikus


9. Előadás Fehérjék Előzmények Peptidkémia Analitikai kémia Protein kémia 1901 E.Fischer : Gly-Gly 1923 F. Pregl : Mikroanalitika 1952 Stein and Moore : Aminosav analizis 1932 Bergman és Zervas : Benziloxikarbonil


Szerkesztette: Vizkievicz András

Szerkesztette: Vizkievicz András Fehérjék A fehérjék - proteinek - az élő szervezetek számára a legfontosabb vegyületek. Az élet bármilyen megnyilvánulási formája fehérjékkel kapcsolatos. A sejtek szárazanyagának minimum 50 %-át adják.


3. Sejtalkotó molekulák III.

3. Sejtalkotó molekulák III. 3. Sejtalkotó molekulák III. Fehérjék, fehérjeszintézis (transzkripció, transzláció, posztszintetikus módosítások). Enzimműködés 3.1 Fehérjék A genetikai információ egyik fő manifesztálódása Számos funkció


1. Az élő szervezetek felépítése és az életfolyamatok 17

1. Az élő szervezetek felépítése és az életfolyamatok 17 Élődi Pál BIOKÉMIA vomo; Akadémiai Kiadó, Budapest 1980 Tartalom Bevezetés 1. Az élő szervezetek felépítése és az életfolyamatok 17 Mi jellemző az élőre? 17. Biogén elemek 20. Biomolekulák 23. A víz 26.


TestLine - Biogén elemek, molekulák Minta feladatsor

TestLine - Biogén elemek, molekulák Minta feladatsor TestLine - iogén elemek, molekulák iogén elemek, szervetlen és szerves molekulák az élő szervezetben. gészítsd ki a mondatot! aminocsoportja kondenzáció víz ún. peptidkötés 1. 1:48 Normál fehérjék biológiai


A felgombolyodás problémája

A felgombolyodás problémája 1. A probléma 2. A fehérjék stabil konformációs állapotai 3. A felgombolyodás általános tulajdonságai 4. A felgombolyodás modelljei 5. A felgombolyodás nyomon követésének technikái 6. A felgombolyodás


A nukleinsavak polimer vegyületek. Mint polimerek, monomerekből épülnek fel, melyeket nukleotidoknak nevezünk.

A nukleinsavak polimer vegyületek. Mint polimerek, monomerekből épülnek fel, melyeket nukleotidoknak nevezünk. Nukleinsavak Szerkesztette: Vizkievicz András A nukleinsavakat először a sejtek magjából sikerült tiszta állapotban kivonni. Innen a név: nucleus = mag (lat.), a sav a kémhatásukra utal. Azonban nukleinsavak


BIOLÓGIA VERSENY 10. osztály 2016. február 20.

BIOLÓGIA VERSENY 10. osztály 2016. február 20. BIOLÓGIA VERSENY 10. osztály 2016. február 20. Kód Elérhető pontszám: 100 Elért pontszám: I. Definíció (2x1 = 2 pont): a) Mikroszkopikus méretű szilárd részecskék aktív bekebelezése b) Molekula, a sejt





Nanotechnológia. Vonderviszt Ferenc. Veszprémi Egyetem Nanotechnológia Tanszék

Nanotechnológia. Vonderviszt Ferenc. Veszprémi Egyetem Nanotechnológia Tanszék Nanotechnológia Vonderviszt Ferenc Veszprémi Egyetem Nanotechnológia Tanszék Ősi technológiák Mikroelektronika Technológia: képesség az anyag szerkezetének, az anyagot felépítő részecskék elrendeződésének


Szimulációk egyszerősített fehérjemodellekkel. Szilágyi András

Szimulációk egyszerősített fehérjemodellekkel. Szilágyi András Szimulációk egyszerősített fehérjemodellekkel Szilágyi András Szimulációs módszerek alkalmazhatósági tartományai Egyszerősített modellek Három típusát mutatjuk be: Játék rácsmodellek Realisztikusabb rácsmodellek


A kovalens kötés polaritása

A kovalens kötés polaritása Általános és szervetlen kémia 4. hét Kovalens kötés A kovalens kötés kialakulásakor szabad atomokból molekulák jönnek létre. A molekulák létrejötte mindig energia csökkenéssel jár. A kovalens kötés polaritása



BIOMOLEKULÁK KÉMIÁJA. Novák-Nyitrai-Hazai BIOMOLEKULÁK KÉMIÁJA Novák-Nyitrai-Hazai A tankönyv elsısorban szerves kémiai szempontok alapján tárgyalja az élı szervezetek felépítésében és mőködésében kulcsfontosságú szerves vegyületeket. A tárgyalás-


A tananyag felépítése: A BIOLÓGIA ALAPJAI. I. Prokarióták és eukarióták. Az eukarióta sejt. Pécs Miklós: A biológia alapjai

A tananyag felépítése: A BIOLÓGIA ALAPJAI. I. Prokarióták és eukarióták. Az eukarióta sejt. Pécs Miklós: A biológia alapjai A BIOLÓGIA ALAPJAI A tananyag felépítése: Környezetmérnök és műszaki menedzser hallgatók számára Előadó: 2 + 0 + 0 óra, félévközi számonkérés 3 ZH: október 3, november 5, december 5 dr. Pécs Miklós egyetemi



AMINOSAVAK, FEHÉRJÉK AMINOSAVAK, FEHÉRJÉK Az aminosavak olyan szerves vegyületek, amelyek molekulájában aminocsoport (-NH2) és karboxilcsoport (-COOH) egyaránt előfordul. Felosztás A fehérjéket feloszthatjuk aszerint, hogy


6. Zárványtestek feldolgozása

6. Zárványtestek feldolgozása 6. Zárványtestek feldolgozása... 1 6.1. A zárványtestek... 1 6.1.1. A zárványtestek kialakulása... 2 6.1.2. A feldolgozási technológia... 3 Sejtfeltárás... 3 Centrifugálás, tisztítás...


A negyedleges szerkezet szerepe a kis hő-sokk fehérjék

A negyedleges szerkezet szerepe a kis hő-sokk fehérjék A negyedleges szerkezet szerepe a kis hő-sokk fehérjék chaperon működésében Készítette: Böde Csaba Témavezető: Dr. Fidy Judit egyetemi tanár Semmelweis Egyetem Elméleti Orvostudományok Doktori Iskola Szigorlati


A biológiai mozgás molekuláris mechanizmusai

A biológiai mozgás molekuláris mechanizmusai BIOLÓGIAI MOZGÁSOK A biológiai mozgás molekuláris mechanizmusai Kollektív mozgás Szervezet mozgása ( Az évszázad ugrása ) Szerv mozgás BIOLÓGIAI MOZGÁSOK BIOLÓGIAI MOZGÁSOK Ritmusosan összehúzódó szívizomsejt


12/4/2014. Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció. 1952 Hershey & Chase 1953!!!

12/4/2014. Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció. 1952 Hershey & Chase 1953!!! Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció 1859 1865 1869 1952 Hershey & Chase 1953!!! 1879 1903 1951 1950 1944 1928 1911 1 1. DNS szerkezete Mi az örökítő anyag? Friedrich Miescher


Nukleinsavak. Szerkezet, szintézis, funkció

Nukleinsavak. Szerkezet, szintézis, funkció Nukleinsavak Szerkezet, szintézis, funkció Nukleinsavak, nukleotidok, nukleozidok 1869-ben Miescher a sejtmagból egy savas természetű, lúgban oldódó foszfortartalmú anyagot izolált, amit később, eredetére


Eszközszükséglet: Szükséges anyagok: tojás, NaCl, ammónium-szulfát, réz-szulfát, ólom-acetát, ecetsav, sósav, nátrium-hidroxid, desztillált víz

Eszközszükséglet: Szükséges anyagok: tojás, NaCl, ammónium-szulfát, réz-szulfát, ólom-acetát, ecetsav, sósav, nátrium-hidroxid, desztillált víz A kísérlet, megnevezés, célkitűzései: Fehérjék tulajdonságainak, szerkezetének vizsgálata. Környezeti változások hatásának megfigyelése a fehérjék felépítésében. Eszközszükséglet: Szükséges anyagok: tojás,


A fehérjék harmadlagos vagy térszerkezete. Még a globuláris fehérjék térszerkezete is sokféle lehet.

A fehérjék harmadlagos vagy térszerkezete. Még a globuláris fehérjék térszerkezete is sokféle lehet. A fehérjék harmadlagos vagy térszerkezete Még a globuláris fehérjék térszerkezete is sokféle lehet. A ribonukleáz redukciója és denaturálódása Chrisian B. Anfinsen A ribonukleáz renaturálódása 1972 obel-díj


A glükóz reszintézise.

A glükóz reszintézise. A glükóz reszintézise. A glükóz reszintézise. A reszintézis nem egyszerű megfordítása a glikolízisnek. A glikolízis 3 irrevezibilis lépése más úton játszódik le. Ennek oka egyrészt energetikai, másrészt


Fehérjebiotechnológia Emri, Tamás Csősz, Éva Tőzsér, József Szerkesztette Tőzsér, József, Debreceni Egyetem

Fehérjebiotechnológia Emri, Tamás Csősz, Éva Tőzsér, József Szerkesztette Tőzsér, József, Debreceni Egyetem Fehérjebiotechnológia Emri, Tamás Csősz, Éva Tőzsér, József Szerkesztette Tőzsér, József, Debreceni Egyetem Fehérjebiotechnológia írta Emri, Tamás, Csősz, Éva, Tőzsér, József, Tőzsér, József, és Szerzői


Citoszkeleton. Sejtek rugalmassága. Polimer mechanika: Hooke-rugalmasság. A citoszkeleton filamentumai. Fogászati anyagtan fizikai alapjai 12.

Citoszkeleton. Sejtek rugalmassága. Polimer mechanika: Hooke-rugalmasság. A citoszkeleton filamentumai. Fogászati anyagtan fizikai alapjai 12. Fogászati anyagtan fizikai alapjai 12. Sejtek rugalmassága Citoszkeleton Eukariota sejtek dinamikus vázrendszere Három fő filamentum-osztály: A. Vékony (aktin) B. Intermedier C. Mikrotubulus Polimerizáció:


Szerves kémia III. TERMÉSZETES VEGYÜLETEK KÉMIÁJA. Dr. Juhászné Dr. Tóth Éva Szerves Kémiai Tanszék

Szerves kémia III. TERMÉSZETES VEGYÜLETEK KÉMIÁJA. Dr. Juhászné Dr. Tóth Éva Szerves Kémiai Tanszék Szerves kémia III. TERMÉSZETES VEGYÜLETEK KÉMIÁJA Dr. Juhászné Dr. Tóth Éva Szerves Kémiai Tanszék Fontos információk Előadó: Dr. Juhászné Dr. Tóth Éva Elérhetőség: Iroda: Kémia épület, E-423 vagy E-422


A rácsmodell. Szabadenergia felületek.

A rácsmodell. Szabadenergia felületek. 1. A spinüveg modell 2. A rácsmodellek típusai 3. A rácsmodellek elõnyei és hátrányai 4. A rácsmodellek elemzése 5. Egyszerû rácsmodellek 6. Rácsmodellek natív állapotai 7. Oldalláncok 8. Rácsmodellek


Poligénes v. kantitatív öröklődés

Poligénes v. kantitatív öröklődés 1. Öröklődés komplexebb sajátosságai 2. Öröklődés molekuláris alapja Poligénes v. kantitatív öröklődés Azok a tulajdonságokat amelyek mértékegységgel nem, vagy csak nehezen mérhetők, kialakulásuk kevéssé


Farmakológus szakasszisztens Farmakológus szakasszisztens 2/34

Farmakológus szakasszisztens Farmakológus szakasszisztens 2/34 -06 Farmakológus szakasszisztens feladatok A 0/007 (II. 7.) SzMM rendelettel módosított /006 (II. 7.) OM rendelet Országos Képzési Jegyzékről és az Országos Képzési Jegyzékbe történő felvétel és törlés


TDK lehetőségek az MTA TTK Enzimológiai Intézetben

TDK lehetőségek az MTA TTK Enzimológiai Intézetben TDK lehetőségek az MTA TTK Enzimológiai Intézetben Vértessy G. Beáta egyetemi tanár TDK mind 1-3 helyezettek OTDK Pro Scientia különdíj 1 második díj Diákjaink Eredményei Zsűri különdíj 2 első díj OTDK



CHO H H H OH H OH OH H CH2OH HC OH HC OH HC OH CH 2 4. Előadás ukleozidok, nukleotidok, nukleinsavak Történeti háttér Savas karakterű anyagok a sejtmagból 1869-71 DS a sejtmag fő komponense F. Miescher (Svájc) 1882 Flemming: Chromatin elnevezés Waldeyer:


Atomszerkezet. Atommag protonok, neutronok + elektronok. atompályák, alhéjak, héjak, atomtörzs ---- vegyérték elektronok

Atomszerkezet. Atommag protonok, neutronok + elektronok. atompályák, alhéjak, héjak, atomtörzs ---- vegyérték elektronok Atomszerkezet Atommag protonok, neutronok + elektronok izotópok atompályák, alhéjak, héjak, atomtörzs ---- vegyérték elektronok periódusos rendszer csoportjai Periódusos rendszer A kémiai kötés Kémiai


Élettan. előadás tárgykód: bf1c1b10 ELTE TTK, fizika BSc félév: 2015/2016., I. időpont: csütörtök, 8:15 9:45

Élettan. előadás tárgykód: bf1c1b10 ELTE TTK, fizika BSc félév: 2015/2016., I. időpont: csütörtök, 8:15 9:45 Élettan előadás tárgykód: bf1c1b10 ELTE TTK, fizika BSc félév: 2015/2016., I. időpont: csütörtök, 8:15 9:45 oktató: Dr. Tóth Attila, adjunktus ELTE TTK Biológiai Intézet, Élettani és Neurobiológiai tanszék


A replikáció mechanizmusa

A replikáció mechanizmusa Az öröklődés molekuláris alapjai A DNS megkettőződése, a replikáció Szerk.: Vizkievicz András A DNS-molekula az élőlények örökítő anyaga, kódolt formában tartalmazza mindazon információkat, amelyek a sejt,


A citoszkeletális rendszer, a harántcsíkolt izom biofizikája.

A citoszkeletális rendszer, a harántcsíkolt izom biofizikája. A citoszkeletális rendszer, a harántcsíkolt izom biofizikája. SCIENCE PHOTO LIBRARY Kupi Tünde 2010. 10. 19. Citoszkeleton: eukarióta sejtek dinamikus fehérjevázrendszere Három fı filamentum-osztály: A.


Gáspári Zoltán. Élő molekulák az élet molekulái

Gáspári Zoltán. Élő molekulák az élet molekulái Gáspári Zoltán Élő molekulák az élet molekulái Invokáció Kajtár Márton 1929-1991 www.eotvoskiado.hu Élő és élettelen? Élő és élettelen: a kemoton Élő kémiai rendszer, de nem élőlény (Gánti, 1975) Autokatalitikus


Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete

Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete Polipeptidek térszerkezete Tipikus (rendezett) konformerek em tipikus (rendezetlen) konformerek Periodikus vagy homokonformerek Aperiodikus



Fehérjebiotechnológia Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Fehérjebiotechnológia Emri Tamás Csősz Éva Tőzsér József


Szénhidrátok. Szénhidrátok. Szénhidrátok. Csoportosítás

Szénhidrátok. Szénhidrátok. Szénhidrátok. Csoportosítás Szénhidrátok Definíció: Szénhidrátok Polihidroxi aldehidek vagy ketonok, vagy olyan vegyületek, melyek hidrolízisével polihidroxi aldehidek vagy ketonok keletkeznek. Elemi összetétel: - Mindegyik tartalmaz


Az anyagi rendszer fogalma, csoportosítása

Az anyagi rendszer fogalma, csoportosítása Az anyagi rendszer fogalma, csoportosítása A bemutatót összeállította: Fogarasi József, Petrik Lajos SZKI, 2011 1 1 A rendszer fogalma A körülöttünk levő anyagi világot atomok, ionok, molekulák építik


Immunológia alapjai előadás. Az immunológiai felismerés molekuláris összetevői.

Immunológia alapjai előadás. Az immunológiai felismerés molekuláris összetevői. Immunológia alapjai 3 4. előadás Az immunológiai felismerés molekuláris összetevői. Az antigén fogalma. Antitestek, T- és B- sejt receptorok: molekuláris szerkezet, funkciók, alcsoportok Az antigén meghatározása


1. Bevezetés. Mi az élet, evolúció, információ és energiaáramlás, a szerveződés szintjei

1. Bevezetés. Mi az élet, evolúció, információ és energiaáramlás, a szerveződés szintjei 1. Bevezetés Mi az élet, evolúció, információ és energiaáramlás, a szerveződés szintjei 1.1 Mi az élet? Definíció Alkalmas legyen különbségtételre élő/élettelen közt Ne legyen túl korlátozó (más területen


HŐ (q) és MUNKA (w): energia átmenet közben a rendszer és környezete között. A különböző energiafajták átalakulásukkor végső soron termikus energiává

HŐ (q) és MUNKA (w): energia átmenet közben a rendszer és környezete között. A különböző energiafajták átalakulásukkor végső soron termikus energiává TERMODINAMIKA 1 HŐ (q) és MUNKA (w): energia átmenet közben a rendszer és környezete között. A különböző energiafajták átalakulásukkor végső soron termikus energiává degradálódnak (disszipáció). BELSŐ


Gyógyszer-élelmiszer kölcsönhatások

Gyógyszer-élelmiszer kölcsönhatások Gyógyszer-élelmiszer kölcsönhatások Dietetikus MSc. képzés Dr. Horváth Péter Semmelweis Egyetem Gyógyszerészi Kémiai Intézet TEMATIKA Bevezetés Alapfogalmak Gyógyszerhatás kialakulása Gyógyszerek tulajdonságait


Sugárterápia. Ionizáló sugárzások elnyelődésének következményei. Konzultáció: minden hétfőn 15 órakor. 1. Fizikai történések

Sugárterápia. Ionizáló sugárzások elnyelődésének következményei. Konzultáció: minden hétfőn 15 órakor. 1. Fizikai történések Sugárterápia 40% 35% 30% 25% 20% 15% % 5% 0% 2014/2015. tanév FOK biofizika kollokvium jegyspektruma 5 4,5 4 3,5 3 2,5 2 1,5 1 Konzultáció: minden hétfőn 15 órakor Ionizáló sugárzások elnyelődésének következményei


Aminosavak, peptidek, fehérjék. Béres Csilla

Aminosavak, peptidek, fehérjék. Béres Csilla Aminosavak, peptidek, fehérjék Béres Csilla Aminosavak Az aminosavak (más néven aminokarbonsavak) olyan szerves vegyületek, amelyek molekulájában aminocsoport (- NH 2 ) és karboxilcsoport (-COOH) egyaránt


1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói

1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói 1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói Plazmamembrán Membrán funkciói: sejt integritásának fenntartása állandó hő, energia, és információcsere biztosítása homeosztázis


A szénhidrátok az élet szempontjából rendkívül fontos, nélkülözhetetlen vegyületek. A bioszféra szerves anyagainak fő tömegét adó vegyületek.

A szénhidrátok az élet szempontjából rendkívül fontos, nélkülözhetetlen vegyületek. A bioszféra szerves anyagainak fő tömegét adó vegyületek. Szénhidrátok Szerkesztette: Vizkievicz András A szénhidrátok az élet szempontjából rendkívül fontos, nélkülözhetetlen vegyületek. A bioszféra szerves anyagainak fő tömegét adó vegyületek. A szénhidrátok


Szénhidrátok monoszacharidok formájában szívódnak fel a vékonybélből.

Szénhidrátok monoszacharidok formájában szívódnak fel a vékonybélből. Vércukorszint szabályozása: Szénhidrátok monoszacharidok formájában szívódnak fel a vékonybélből. Szövetekben monoszacharid átalakítás enzimjei: Szénhidrát anyagcserében máj központi szerepű. Szénhidrát


Szentjánosbogár, trópusi halak, sarki fény Mi a közös a természet fénytüneményeiben?

Szentjánosbogár, trópusi halak, sarki fény Mi a közös a természet fénytüneményeiben? Szentjánosbogár, trópusi halak, sarki fény Mi a közös a természet fénytüneményeiben? Szalay Péter egyetemi tanár ELTE, Kémiai Intézet Elméleti Kémiai Laboratórium Van közös bennük? Egy kis történelem


Kötések kialakítása - oktett elmélet

Kötések kialakítása - oktett elmélet Kémiai kötések Az elemek és vegyületek halmazai az atomok kapcsolódásával - kémiai kötések kialakításával - jönnek létre szabad atomként csak a nemesgázatomok léteznek elsődleges kémiai kötések Kötések


Kollokviumi vizsgakérdések biokémiából humánkineziológia levelező (BSc) 2015

Kollokviumi vizsgakérdések biokémiából humánkineziológia levelező (BSc) 2015 Kollokviumi vizsgakérdések biokémiából humánkineziológia levelező (BSc) 2015 A kérdés 1. A sejtről általában, a szervetlen alkotórészeiről, a vízről részletesen. 2. A sejtről általában, a szervetlen alkotórészeiről,


Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis

Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis Szerkezet Protein Data Bank (PDB) http://www.rcsb.org/pdb ~ 35 701 szerkezet közepes felbontás 1552 szerkezet d 1.5 Å 160 szerkezet d 1.0 Å 10 szerkezet d 0.8 Å (atomi felbontás) E globális minimum? funkció


4. FEHÉRJÉK. 2. Vázanyagok. Az izmok alkotórésze (pl.: a miozin). Inak, izületek, csontok szerves komponensei, az ún. vázfehérjék (szkleroproteinek).

4. FEHÉRJÉK. 2. Vázanyagok. Az izmok alkotórésze (pl.: a miozin). Inak, izületek, csontok szerves komponensei, az ún. vázfehérjék (szkleroproteinek). 4. FEÉRJÉK 4.0. Bevezetés A fehérjék elsısorban α-l-aminosavakból felépülı biopolimerek. A csak α-laminosavakat tartalmazó fehérjék a proteinek. evüket a görög proteios szóból kapták, ami elsırangút jelent.



GYOMOR. EGYES SZERVEK ÉS SZERVREND- SZEREK BIOKÉMIAI MŰKÖDÉSEI 1. Az emésztés és felszívódás PEPSZIN GYOMOR 2. PATKÓBÉL, DUODENUM EGYES SZERVEK ÉS SZERVREND- SZEREK BIOKÉMIAI MŰKÖDÉSEI 1. Az emésztés és felszívódás biokémiája Az emésztőcsatorna szakaszai: Szájüreg: - mechanikai aprítás - megfelelő konzisztencia kialakítása (nyál).


Több szubsztrátos enzim-reakciókról beszélve két teljesen különbözõ rekció típust kell megismernünk.

Több szubsztrátos enzim-reakciókról beszélve két teljesen különbözõ rekció típust kell megismernünk. .5.Több szubsztrátos reakciók Több szubsztrátos enzim-reakciókról beszélve két teljesen különbözõ rekció típust kell megismernünk. A.) Egy enzim, ahhoz, hogy terméket képezzen, egyszerre több különbözõ


Modern Fizika Labor. Fizika BSc. Értékelés: A mérés dátuma: A mérés száma és címe: 13. mérés: Molekulamodellezés PC-n. 2008. április 29.

Modern Fizika Labor. Fizika BSc. Értékelés: A mérés dátuma: A mérés száma és címe: 13. mérés: Molekulamodellezés PC-n. 2008. április 29. Modern Fizika Labor Fizika BSc A mérés dátuma: A mérés száma és címe: 13. mérés: Molekulamodellezés PC-n Értékelés: A beadás dátuma: 2008. május 6. A mérést végezte: 1/5 A mérés célja A mérés célja az


Tantárgyi követelmény gimnázium 10. évfolyam

Tantárgyi követelmény gimnázium 10. évfolyam Tantárgyi követelmény gimnázium 10. évfolyam 2015/2016 TARTALOMJEGYZÉK 1. Irodalom és művészetek... 3 2. Anyanyelv és kommunikáció... 4 3. földrajz... 5 4. Történelem és állampolgári ismeretek... 6 5.


A citoszkeleton. A citoszkeleton, a motorfehérjék, az izom és működésének szabályozása. A citoszkeleton. A citoszkeleton.

A citoszkeleton. A citoszkeleton, a motorfehérjék, az izom és működésének szabályozása. A citoszkeleton. A citoszkeleton. , a motorfehérjék, az izom és működésének szabályozása PTE ÁOK Biofizikai Intézet Ujfalusi Zoltán 2012. január-február Eukarióta sejtek dinamikus vázrendszere Három fő filamentum-osztály: 1. Intermedier


A biokémia alapjai. Typotex Kiadó. Wunderlich Lívius Szarka András

A biokémia alapjai. Typotex Kiadó. Wunderlich Lívius Szarka András A biokémia alapjai Wunderlich Lívius Szarka András Összefoglaló: A jegyzet elsősorban egészségügyi mérnök MSc. hallgatók részére íródott, de hasznos segítség lehet biomérnök és vegyészmérnök hallgatók


1. ábra: A hasnyálmirigy Langerhans-szigete

1. ábra: A hasnyálmirigy Langerhans-szigete génmanipulált mikroorganizmusokkal Az elsődleges és másodlagos anyagcseretermékek előállítása után a rekombináns fehérjék gyártásáról lesz szó. Ezek olyan fehérjék, melyeket a sejt eredeti genomja nem


Biofizika I 2013-2014 2014.12.02.

