Röntgen sugárzás. Wilhelm Röntgen. Röntgen feleségének keze

Save this PDF as:
 WORD  PNG  TXT  JPG

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "Röntgen sugárzás. Wilhelm Röntgen. Röntgen feleségének keze"

Átírás

1 Röntgendiffrakció Kardos Roland

2 Előadás vázlata Röntgen sugárzás Interferencia Huygens teória Diffrakció Diffrakciós eljárások Alkalmazás

3 Röntgen sugárzás 1895 röntgen sugárzás felfedezés (1901 Nobel díj) -Sugárzás hullámhossza: 0,01-10 nanométer -Sugárzás energiája: 0,1-100 kev -Erős ionizációs hatás Wilhelm Röntgen Röntgen feleségének keze

4 Röntgen sugárzás spektruma Folytonos spektrumú sugárzás (Bremsstahlung) Karakterisztikus sugárzás Röntgen cső Tipikus röntgen spektrum Karakterisztikus sugárzás keletkezése

5 Interferencia Különböző forrású, koherens hullámok találkozásakor lejátszódó fizikai jelenség! Konstruktív Destruktív

6 Huygens teória Hullámfront minden egyes pontja felfogható, mint pontszerű hullámforrás! Christiaan Huygens ( ) Egy rés interferencia kép

7 Diffrakció (fényelhajás) Thomas Young ( ) 1803 kettős rés kísérlet fény hullám természetű!

8 Hogyan alakul ki a diffrakciós mintázat Konstruktív interferencia feltétele: a diffraktált fénysugarak azonos fázisban találkoznak d sin Θ = n λ Ha növeljük a rések közti távolságot az intenzitás pontok közelebb esnek egymáshoz! d ~ 1 sin Θ

9 Optikai rács 0,1 mm magasság 3000 rés/mm 3 és 5 réses optikai rács. Több rés élesebb pontok Négyzet alakú rés diffrakciós képe. Kereszt alakú rés diffrakciós képe.

10

11 Röntgen diffrakció elméleti felismerése 1912 a röntgen sugárzás hullámhossza összemérhető az atomok közti távolsággal a kristályon belül. Kristály mint 3 dimenziós optikai rács! Max von Laue ( ) 1914 fizikai Nobel díj! Réz-szulfát kristály diffrakciós mintázata.. Az első röntgen diffrakciós kísérlet sematikus elrendezése.

12 Miért képes a kristály diffraktálni a fényt? Az atomok, ionok, molekulák szabályosan ismétlődő elrendeződése az anyag szerkezetében. c b a Elemi cella: ismétlődő geometriai mintázat Rács pont: atom, ion, molekula

13

14

15 Atomok közti távolság s s Laue egyenletek Beeső röntgen sugárzás Diffraktált röntgen sugárzás Három dimenzióra: sa = a (cosαn cosα0) = b (cos βn cos β0 = l λ = c (cosγ n cosγ 0 = m λ b ) c ) AB Úthossz különbség: s = AB α CD = a cos CD = a cosα n 0 Konstruktív interferencia feltétele: sa = a (cosαn cosα0) = k λ k=0,1,2,3.. = Ez csak egy dimenzió! k λ Mindhárom egyenletnek egyszerre kell teljesülni!

16 Bragg egyenlet William.H Bragg ( ) W. L.Bragg ( ) 1915 Fizikai Nobel díj Bragg egyenlet Kristály síkok tükörként viselkednek! 2 d sinθ = n λ Konstruktív interferencia feltétele! A röntgen sugár elhajlási szögéből(θ) kalkulálható a kristály síkjai közti távolság(d)!

17 Az első röntgen spektrofotométer. NaCl kristály szerkezetének meghatározás. Ionos kötés felfedezése!

18 A diffrakciós mintázat hátterében szóródási jelenség áll. Röntgen sugarak elasztikusan szóródnak az atomok elektronfelhőin (Thomson szórás). A szórás mértékét az atomok körüli elektronfelhő határozza meg!

19 Röntgen diffrakciós eljárások Egy kristály módszer (Röntgen krisztallográfia) - Egy jó minőségű kristály (100 µm) - Monokromatikus (általában) röntgen sugárzás alkalmazása - Inorganikus anyagok és makromolekulák (pl. fehérjék, nukleinsavak) atomi struktúrájának meghatározása - Goniométer (minta forgatása) Pordiffrakciós módszer - Monokromatikus sugárzás alkalmazása - Polikristályos minta por alakban (különböző orientáció) - Ismeretlen kristályos minta azonosítása International Centre for Diffraction Data (ICDD) Rost diffrakciós módszer DNS struktúrájának meghatározás Cink-szulfát diffraktogramja.

20 Diffraktométer részei Sugárforrás: - Röntgen cső - Szinkroton tároló gyűrű Goniométer Detektor: - fényérzékeny film - CCD (couple-charged device) Diffraktométer Röntgen cső Goniométer

21 Röntgen diffrakció kísérleti elrendezése

22

23

24

25

26

27 Szervetlen anyagok vizsgálat röntgen diffrakcióval 1920-as évekig szervetlen anyagok szerkezetének meghatározás. Kristály szerkezetek feltárása Kémiai kötések mélyebb megismerése. Atom sugarának meghatározás. Gyémánt-tetraéder elrendeződés kovalens kötésekkel Grafit: hexagonal elrendeződés delokalizált elektronokkal Gyémánt és grafit kristály szerkezete

28 Fehérjék vizsgálata röntgen diffrakciós eljárással 1958 első fehérje atomi struktúrájának meghatározása Max Perutz és Sir John Cowdery Kendrew 1962 kémiai Nobel díj Bálna mioglobin Dorothy Crowfoot Hodgkin inzulin atomi struktúrájának meghatározása (30 év)! Több tízezer fehérje szerkezetének meghatározása Fehérjék atomi koordinátái szabadon hozzáférhetők: Hatékonyabb gyógyszerek tervezése Inzulin

29 DNS röntgen diffrakciós képe 1953 James D. Watson és Francis Crick DNS modell DNS röntgen diffrakciós képe

30 Köszönöm a figyelmet!

31 DNA 1953 Rosalind Franklin DNA double helix X-ray diffraction pattern of DNA 1953 James D. Watson és Francis Crick DNA model T-A (2 hydrogen bonds) C-G (3 hydrogen bonds)

32 NATURE Nobel prize Robert Obly s-the path to the double helix JamesD. Watson-Double helix

33 Methods to study protein structure (X-ray diffraction) Sperm Whale myoglobin Observing the scaterred intensity of an X-ray beam hitting a crystalline materials as a function of incident and scattered angle.. Bragg-equation: 2d cosα = n λ Max Perutz és Sir John Cowdery Kendrew 1962 Nobel Prize in chemistry

Röntgensugárzás a tudományban

Röntgensugárzás a tudományban Röntgensugárzás a tudományban Faigel Gyula, MTA Wigner FK SZFI, 2015 Bevezetés Röntgensugárzás a - biológiában -kémiában - szilárdtestfizikában, anyagtudományban - archeológiában és művészetekben Zárszó

Részletesebben

Fizikai kémia Diffrakciós módszerek. Bevezetés. Történeti áttekintés

Fizikai kémia Diffrakciós módszerek. Bevezetés. Történeti áttekintés 06.08.. Fizikai kémia. 6. Diffrakciós módszerek Dr. Berkesi Ottó SZTE Fizikai Kémiai és Anyagtudományi Tanszéke 05 Bevezetés A kémiai szerkezet vizsgálatához használatos módszerek közül eddig a különöző

Részletesebben

Az elektromágneses hullámok

Az elektromágneses hullámok 203. október Az elektromágneses hullámok PTE ÁOK Biofizikai Intézet Kutatók fizikusok, kémikusok, asztronómusok Sir Isaac Newton Sir William Herschel Johann Wilhelm Ritter Joseph von Fraunhofer Robert

Részletesebben

Röntgensugárzás, röntgendiffrakció Biofizika szeminárium

Röntgensugárzás, röntgendiffrakció Biofizika szeminárium Történet Röntgensugárzás, röntgendiffrakció Biofizika szeminárium Ivan Puljuj (1845-1918): Nagyfeszültségű kisülési cső (Crookes cső) sugárzásába helyezett becsomagolt fotolemezek megfeketednek, 1886 Nicola

Részletesebben

Biopolimer 12/7/09. Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. DNS. Polimerek. Kardos Roland DNS elsődleges szerkezete

Biopolimer 12/7/09. Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. DNS. Polimerek. Kardos Roland DNS elsődleges szerkezete Biopolimerek Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. Osztódó sejt magorsófonala Kardos Roland 2009.10.29. Dohány levél epidermális sejtjének aktin hálózat Bakteriofágból kiszabaduló

Részletesebben

Fehérjeszerkezet, és tekeredés

Fehérjeszerkezet, és tekeredés Fehérjeszerkezet, és tekeredés Futó Kinga 2013.10.08. Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983

Részletesebben

Röntgendiffrakció, tömegspektrometria, infravörös spektrometria.

Röntgendiffrakció, tömegspektrometria, infravörös spektrometria. A biomolekuláris szerkezet és dinamika vizsgálómódszerei: Röntgendiffrakció, tömegspektrometria, infravörös spektrometria. Smeller László A molekuláris szerkezet és dinamika vizsgáló módszereinek áttekintése

Részletesebben

Makromolekulák. Fehérjetekeredé. rjetekeredés. Biopolimer. Polimerek

Makromolekulák. Fehérjetekeredé. rjetekeredés. Biopolimer. Polimerek Biopolimerek Makromolekulá Makromolekulák. Fehé Fehérjetekeredé rjetekeredés. Osztódó sejt magorsófonala 2011. November 16. Huber Tamá Tamás Dohány levél epidermális sejtjének aktin hálózata Bakteriofágból

Részletesebben

P vízhullámok) interferenciáját. A két hullám hullámfüggvénye:

P vízhullámok) interferenciáját. A két hullám hullámfüggvénye: Hullámok találkozása, interferencia Ha a tér egy pontjában két hullám van jelen, akkor hatásuk ott valamilyen módon összegződik. A hullámok összeadódását interferenciának nevezzük. Mi az interferencia

Részletesebben

Nukleinsavak építőkövei

Nukleinsavak építőkövei ukleinsavak Szerkezeti hierarchia ukleinsavak építőkövei Pirimidin Purin Pirimidin Purin Timin (T) Adenin (A) Adenin (A) Citozin (C) Guanin (G) DS bázisai bázis Citozin (C) Guanin (G) RS bázisai bázis

Részletesebben

A fény mint elektromágneses hullám és mint fényrészecske

A fény mint elektromágneses hullám és mint fényrészecske A fény mint elektromágneses hullám és mint fényrészecske Segítség az 5. tétel (Hogyan alkalmazható a hullám-részecske kettősség gondolata a fénysugárzás esetében?) megértéséhez és megtanulásához, továbbá

Részletesebben

XVIII. A FÉNY INTERFERENCIÁJA

XVIII. A FÉNY INTERFERENCIÁJA XVIII. A FÉNY INTERFERENCIÁJA Bevezetés A fény terjedését egyenes vonal mentén képzelve fény- sugarakról szoktunk beszélni. A fénysugár egy hasznos és szemléletes fogalom. A fény terjedését sugárként elképzelve,

Részletesebben

Biofizika. Csik Gabriella. Mi a biofizika tárgya? Mi a biofizika tárgya? A biológiában és orvostudományban alkalmazott fizikai módszerek tárgyalása

Biofizika. Csik Gabriella. Mi a biofizika tárgya? Mi a biofizika tárgya? A biológiában és orvostudományban alkalmazott fizikai módszerek tárgyalása Biofizika Csik Gabriella Eötvös Loránd kora diákjait tréfásan jellemzi : határozott céllal jön az egyetemre, ügyvéd, politikus vagy orvos akar lenni. Amint az egyetembe lép, kritizálja tanárait, s az egész

Részletesebben

OPTIKA. Hullámoptika Diszperzió, interferencia. Dr. Seres István

OPTIKA. Hullámoptika Diszperzió, interferencia. Dr. Seres István OPTIKA Diszperzió, interferencia Dr. Seres István : A fény elektromágneses hullám A fehér fény összetevői: Seres István 2 http://fft.szie.hu : A fény elektromágneses hullám: Diszperzió: Különböző hullámhosszúságú

Részletesebben

Röntgendiffrakciós fázisanalízis gyakorlat vegyész és környezettudomány Lovas A. György

Röntgendiffrakciós fázisanalízis gyakorlat vegyész és környezettudomány Lovas A. György Röntgendiffrakciós fázisanalízis (a mérést vezeti: Dr. egyetemi docens) Az anyagvizsgálatok során a klasszikus analitika két alapvető kérdésre keres választ; a. milyen elemekből áll a minta és b. ezen

Részletesebben

Műszeres analitika. Abrankó László. Molekulaspektroszkópia. Kémiai élelmiszervizsgálati módszerek csoportosítása

Műszeres analitika. Abrankó László. Molekulaspektroszkópia. Kémiai élelmiszervizsgálati módszerek csoportosítása Abrankó László Műszeres analitika Molekulaspektroszkópia Minőségi elemzés Kvalitatív Cél: Meghatározni, hogy egy adott mintában jelen vannak-e bizonyos ismert komponensek. Vagy ismeretlen komponensek azonosítása

Részletesebben

Elektrokémiai fémleválasztás. Kristálytani alapok A kristályos állapot szerepe a fémleválásban

Elektrokémiai fémleválasztás. Kristálytani alapok A kristályos állapot szerepe a fémleválásban Elektrokémiai fémleválasztás Kristálytani alapok A kristályos állapot szerepe a fémleválásban Péter László Elektrokémiai fémleválasztás Kristálytani alapok - 1 Kristályok Kristály: olyan szilárd test,

Részletesebben

A periódusos rendszer, periodikus tulajdonságok

A periódusos rendszer, periodikus tulajdonságok A periódusos rendszer, periodikus tulajdonságok Szalai István ELTE Kémiai Intézet 1/45 Az előadás vázlata ˆ Ismétlés ˆ Történeti áttekintés ˆ Mengyelejev periódusos rendszere ˆ Atomsugár, ionsugár ˆ Ionizációs

Részletesebben

Bevezetés a modern fizika fejezeteibe. 4. (a) Kvantummechanika. Utolsó módosítás: november 15. Dr. Márkus Ferenc BME Fizika Tanszék

Bevezetés a modern fizika fejezeteibe. 4. (a) Kvantummechanika. Utolsó módosítás: november 15. Dr. Márkus Ferenc BME Fizika Tanszék Bevezetés a modern fizika fejezeteibe 4. (a) Kvantummechanika Utolsó módosítás: 2015. november 15. 1 Előzmények Az atomok színképe (1) A fehér fény komponensekre bontható: http://en.wikipedia.org/wiki/spectrum

Részletesebben

Optika fejezet felosztása

Optika fejezet felosztása Optika Optika fejezet felosztása Optika Geometriai optika vagy sugároptika Fizikai optika vagy hullámoptika Geometriai optika A közeg abszolút törésmutatója: c: a fény terjedési sebessége vákuumban, v:

Részletesebben

Új utak a röntgensugárzással való atomi szintű anyagszerkezet meghatározásban Faigel Gyula MTA SZFKI 2006

Új utak a röntgensugárzással való atomi szintű anyagszerkezet meghatározásban Faigel Gyula MTA SZFKI 2006 Új utak a röntgensugárzással való atomi szintű anyagszerkezet meghatározásban Faigel Gyula MTA SZFKI 2006 Bevezető Röntgensugárzással való szerkezet-meghatározás: Hagyományos diffrakciós módszerek Új röntgen

Részletesebben

FIZIKA. Sugárzunk az elégedettségtől! (Atomfizika) Dr. Seres István

FIZIKA. Sugárzunk az elégedettségtől! (Atomfizika) Dr. Seres István Sugárzunk az elégedettségtől! () Dr. Seres István atommagfizika Atommodellek 440 IE Democritus, Leucippus, Epicurus 1803 1897 John Dalton J.J. Thomson 1911 Ernest Rutherford 19 Niels Bohr 3 Atommodellek

Részletesebben

SZAKÁLL SÁNDOR, ÁsVÁNY- És kőzettan ALAPJAI

SZAKÁLL SÁNDOR, ÁsVÁNY- És kőzettan ALAPJAI SZAKÁLL SÁNDOR, ÁsVÁNY- És kőzettan ALAPJAI 30 Műszeres ÁSVÁNYHATÁROZÁS XXX. Műszeres ÁsVÁNYHATÁROZÁs 1. BEVEZETÉs Az ásványok természetes úton, a kémiai elemek kombinálódásával keletkezett (és ma is keletkező),

Részletesebben

Fény kölcsönhatása az anyaggal:

Fény kölcsönhatása az anyaggal: Fény kölcsönhatása az Fény kölcsönhatása az : szórás, abszorpció, emisszió Kellermayer Miklós Fényszórás A fényszórás mérése, orvosi alkalmazásai Lord Rayleigh (1842-1919) J 0 Light Fényforrás source Rayleigh

Részletesebben

Szerkezetvizsgáló módszerek

Szerkezetvizsgáló módszerek Szerkezetvizsgáló módszerek Galbács Gábor SZERKEZETVIZSGÁLÓ MÓDSZEREK A megközelítésmód (a filozófia) A szerkezetvizsgáló módszerek olyan kémiai vizsgáló módszerek, amelyek a minta kémiai szerkezetére

Részletesebben

Abszorpciós fotometria

Abszorpciós fotometria abszorpció A fény Abszorpciós fotometria Ujfalusi Zoltán PTE ÁOK Biofizikai Intézet 2013. január Elektromágneses hullám Transzverzális hullám elektromos térerősségvektor hullámhossz E B x mágneses térerősségvektor

Részletesebben

Fehérjeszerkezet, és tekeredés. Futó Kinga

Fehérjeszerkezet, és tekeredés. Futó Kinga Fehérjeszerkezet, és tekeredés Futó Kinga Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983 H 211861 N

Részletesebben

Röntgendiagnosztika és CT

Röntgendiagnosztika és CT Röntgendiagnosztika és CT 2013.04.08. Röntgensugárzás Elektromágneses sugárzás (f=10 16 10 19 Hz, E=120eV 120keV (1.9*10-17 10-14 J), λ

Részletesebben

Anyagtudomány: hagyományos szerkezeti anyagok és polimerek

Anyagtudomány: hagyományos szerkezeti anyagok és polimerek Anyagtudomány: hagyományos szerkezeti anyagok és polimerek Alapfogalmak Fizikai Kémia és Anyagtudományi Tanszék BME Műanyag- és Gumiipari Laboratórium H ép. I. emelet Vázlat Kötések Ionos, kovalens és

Részletesebben

Az elektron hullámtermészete. Készítette Kiss László

Az elektron hullámtermészete. Készítette Kiss László Az elektron hullámtermészete Készítette Kiss László Az elektron részecske jellemzői Az elektront Joseph John Thomson fedezte fel 1897-ben. 1906-ban Nobel díj! Az elektronoknak, az elektromos és mágneses

Részletesebben

Radioaktív sugárzások tulajdonságai és kölcsönhatásuk az elnyelő közeggel. A radioaktív sugárzások detektálása.

Radioaktív sugárzások tulajdonságai és kölcsönhatásuk az elnyelő közeggel. A radioaktív sugárzások detektálása. Különböző sugárzások tulajdonságai Típus töltés Energia hordozó E spektrum Radioaktí sugárzások tulajdonságai és kölcsönhatásuk az elnyelő közeggel. A radioaktí sugárzások detektálása. α-sugárzás pozití

Részletesebben

Elektronok, atomok. Általános Kémia - Elektronok, Atomok. Dia 1/61

Elektronok, atomok. Általános Kémia - Elektronok, Atomok. Dia 1/61 Elektronok, atomok 2-1 Elektromágneses sugárzás 2-2 Atomi Spektrum 2-3 Kvantumelmélet 2-4 A Bohr Atom 2-5 Az új Kvantummechanika 2-6 Hullámmechanika 2-7 Kvantumszámok Dia 1/61 Tartalom 2-8 Elektronsűrűség

Részletesebben

E (total) = E (translational) + E (rotation) + E (vibration) + E (electronic) + E (electronic

E (total) = E (translational) + E (rotation) + E (vibration) + E (electronic) + E (electronic Abszorpciós spektroszkópia Abszorpciós spektrofotometria 29.2.2. Az abszorpciós spektroszkópia a fényabszorpció jelenségét használja fel híg oldatok minőségi és mennyiségi vizsgálatára. Abszorpció Az elektromágneses

Részletesebben

Röntgenanalitikai módszerek I. Összeállította Dr. Madarász János Frissítve 2016 tavaszán

Röntgenanalitikai módszerek I. Összeállította Dr. Madarász János Frissítve 2016 tavaszán Röntgenanalitikai módszerek I Összeállította Dr. Madarász János Frissítve 2016 tavaszán (Röntgen)analitikai módszerek Kémiai analízis kérdései a mérendő mintáról: Egynemű-e? Az-e, aminek deklarálták? Ha

Részletesebben

Abszorpciós spektroszkópia

Abszorpciós spektroszkópia Tartalomjegyzék Abszorpciós spektroszkópia (Nyitrai Miklós; 2011 február 1.) Dolgozat: május 3. 18:00-20:00. Egész éves anyag. Korábbi dolgozatok nem számítanak bele. Felmentés 80% felett. A fény; Elektromágneses

Részletesebben

Abszorpciós fotometria

Abszorpciós fotometria abszorpció Abszorpciós fotometria Spektroszkópia - Színképvizsgálat Spektro-: görög; jelente kép/szín -szkópia: görög; néz/látás/vizsgálat Ujfalusi Zoltán PTE ÁOK Biofizikai Intézet 2012. február Vizsgálatok

Részletesebben

Atommodellek de Broglie hullámhossz Davisson-Germer-kísérlet

Atommodellek de Broglie hullámhossz Davisson-Germer-kísérlet Atommodellek de Broglie hullámhossz Davisson-Germer-kísérlet Utolsó módosítás: 2016. május 4. 1 Előzmények Az atomok színképe (1) A fehér fény komponensekre bontható: http://en.wikipedia.org/wiki/spectrum

Részletesebben

2. Miért hunyorognak a csillagok? Melyik az egyetlen helyes válasz? a. A Föld légkörének változó törésmutatója miatt Hideg-meleg levegő

2. Miért hunyorognak a csillagok? Melyik az egyetlen helyes válasz? a. A Föld légkörének változó törésmutatója miatt Hideg-meleg levegő 1. Milyen képet látunk a karácsonyfán lévı üveggömbökben? a. Egyenes állású, kicsinyített képet. mert c. Egyenes állású, nagyított képet. domborótükör d. Fordított állású, nagyított képet. b. Fordított

Részletesebben

dinamikai tulajdonságai

dinamikai tulajdonságai Szilárdtest rácsok statikus és dinamikai tulajdonságai Szilárdtestek osztályozása kötéstípusok szerint Kötések eredete: elektronszerkezet k t ionok (atomtörzsek) tö Coulomb- elektronok kölcsönhatás lokalizáltak

Részletesebben

12/5/2012. Biomolekuláris szerkezet. Diffrakció, röntgenkrisztallográfia, fény- és elektronmikroszkópia. Tömegspektrometria, CD.

12/5/2012. Biomolekuláris szerkezet. Diffrakció, röntgenkrisztallográfia, fény- és elektronmikroszkópia. Tömegspektrometria, CD. fáziskülönbség egy adott távolság után konstruktív/destruktív interferencia Biomolekuláris szerkezet. Diffrakció, röntgenkrisztallográfia, fény- és elektronmikroszkópia. Tömegspektrometria, CD. c 2 > c

Részletesebben

A fény terjedése és kölcsönhatásai I.

A fény terjedése és kölcsönhatásai I. A fény terjedése és kölcsönhatásai I. A fény terjedése és kölcsönhatásai I. Kellermayer Miklós Geometriai optika, hullámoptika Fényvisszaverődés, fénytörés, refraktometria Teljes belső visszaverődés, endoszkópia

Részletesebben

Bevezetés az anyagtudományba III. előadás

Bevezetés az anyagtudományba III. előadás Bevezetés az anyagtudományba III. előadás 2010. február 18. Kristályos és s nem-krist kristályos anyagok A kristályos anyag atomjainak elrendeződése sok atomnyi távolságig, a tér mindhárom irányában periodikusan

Részletesebben

Orvosi biofizika II. Orvosi Biofizika II. Az X-sugár. Röntgen- sugárzás Előállítás, tulajdonságok

Orvosi biofizika II. Orvosi Biofizika II. Az X-sugár. Röntgen- sugárzás Előállítás, tulajdonságok Orvosi biofizika II Orvosi Biofizika II Röntgensugárzás előállítása és tulajdonságai Röntgendiagnosztikai alapok Az elektromosság orvosi alkalmazásai Termodinamika - egyensúly, változás, főtételek Diffúzió,

Részletesebben

Spektrográf elvi felépítése. B: maszk. A: távcső. Ø maszk. Rés Itt lencse, de általában komplex tükörrendszer

Spektrográf elvi felépítése. B: maszk. A: távcső. Ø maszk. Rés Itt lencse, de általában komplex tükörrendszer Spektrográf elvi felépítése A: távcső Itt lencse, de általában komplex tükörrendszer Kis kromatikus aberráció fontos Leképezés a fókuszsíkban: sugarak itt metszik egymást B: maszk Fókuszsíkba kerül (kamera

Részletesebben

CCD detektorok Spektrofotométerek Optikai méréstechnika. Németh Zoltán 2013.11.15.

CCD detektorok Spektrofotométerek Optikai méréstechnika. Németh Zoltán 2013.11.15. CCD detektorok Spektrofotométerek Optikai méréstechnika Németh Zoltán 2013.11.15. Detektorok Működésük, fontosabb jellemző adataik Charge Coupled Device - töltéscsatolt eszköz Az alapelvet 1970 körül fejlesztették

Részletesebben

Biomolekuláris szerkezet

Biomolekuláris szerkezet Miért érdekes a szerkezet...? Termodinamika 10 23 Atom Biomolekuláris szerkezet Kellermayer Miklós Mezoskála Poratka Vörösvértest, fehérvérsejt DNS Hangya Emberi hajszál Nanoskála Mikroskála Milliskála

Részletesebben

A hőmérsékleti sugárzás

A hőmérsékleti sugárzás A hőmérsékleti sugárzás Alapfogalmak 1. A hőmérsékleti sugárzás Értelmezés (hőmérsékleti sugárzás): A testek hőmérsékletével kapcsolatos, a teljes elektromágneses spektrumra kiterjedő sugárzást hőmérsékleti

Részletesebben

Infravörös, spektroszkópia

Infravörös, spektroszkópia Infravörös, Raman és CD spektroszkópia Spektroszkópia Az EM sugárzás abszorbcióján alapszik: látható (leggyakrabban kvantitatív) UV IR (inkább kvalitatív) RAMAN ESR (mikrohullám) NMR (rádióhullám) Fény

Részletesebben

Mikroszerkezeti vizsgálatok

Mikroszerkezeti vizsgálatok Mikroszerkezeti vizsgálatok Dr. Szabó Péter BME Anyagtudomány és Technológia Tanszék 463-2954 szpj@eik.bme.hu www.att.bme.hu Tematika Optikai mikroszkópos vizsgálatok, klasszikus metallográfia. Kristálytan,

Részletesebben

Dr. JUVANCZ ZOLTÁN Óbudai Egyetem Dr. FENYVESI ÉVA CycloLab Kft

Dr. JUVANCZ ZOLTÁN Óbudai Egyetem Dr. FENYVESI ÉVA CycloLab Kft Dr. JUVANCZ ZOLTÁN Óbudai Egyetem Dr. FENYVESI ÉVA CycloLab Kft Atom- és molekula-spektroszkópiás módszerek Módszer Elv Vizsgált anyag típusa Atom abszorpciós spektrofotometria (AAS) A szervetlen Lángfotometria

Részletesebben

Tartalomjegyzék. Emlékeztetõ. Emlékeztetõ. Spektroszkópia. Fényelnyelés híg oldatokban A fény; Abszorpciós spektroszkópia

Tartalomjegyzék. Emlékeztetõ. Emlékeztetõ. Spektroszkópia. Fényelnyelés híg oldatokban A fény;  Abszorpciós spektroszkópia Tartalomjegyzék PÉCS TUDOMÁNYEGYETEM ÁLTALÁNOS ORVOSTUDOMÁNY KAR A fény; Abszorpciós spektroszkópia Elektromágneses hullám kölcsönhatása anyaggal; (Nyitrai Miklós; 2015 január 27.) Az abszorpció mérése;

Részletesebben

Kötések kialakítása - oktett elmélet

Kötések kialakítása - oktett elmélet Kémiai kötések Az elemek és vegyületek halmazai az atomok kapcsolódásával - kémiai kötések kialakításával - jönnek létre szabad atomként csak a nemesgázatomok léteznek elsődleges kémiai kötések Kötések

Részletesebben

Szerves kémiai analízis TANTÁRGYI KOMMUNIKÁCIÓS DOSSZIÉ

Szerves kémiai analízis TANTÁRGYI KOMMUNIKÁCIÓS DOSSZIÉ BSC ANYAGMÉRNÖK SZAK VEGYIPARI TECHNOLÓGIAI SZÁMÁRA KÖTELEZŐ TANTÁRGYI KOMMUNIKÁCIÓS DOSSZIÉ MISKOLCI EGYETEM MŰSZAKI ANYAGTUDOMÁNYI KAR KÉMIAI INTÉZET Miskolc, 2016 1 Tartalomjegyzék 1. Tantárgyleírás,

Részletesebben

EGYKRISTÁLY RÖNTGEN DIFFRAKCIÓ

EGYKRISTÁLY RÖNTGEN DIFFRAKCIÓ EGYKRISTÁLY RÖNTGEN DIFFRAKCIÓ 1 EGYKRISTÁLY RÖNTGEN DIFFRAKCIÓ Balogh Levente, Gubicza Jen és Zsoldos Lehel 1. BEVEZET A röntgen diffrakció a mai tudomány egyik meghatározó, nagyon változatos vizsgálati

Részletesebben

11. Egy Y alakú gumikötél egyik ága 20 cm, másik ága 50 cm. A két ág végeit azonos, f = 4 Hz

11. Egy Y alakú gumikötél egyik ága 20 cm, másik ága 50 cm. A két ág végeit azonos, f = 4 Hz Hullámok tesztek 1. Melyik állítás nem igaz a mechanikai hullámok körében? a) Transzverzális hullám esetén a részecskék rezgésének iránya merőleges a hullámterjedés irányára. b) Csak a transzverzális hullám

Részletesebben

Szalai István. ELTE Kémiai Intézet 1/74

Szalai István. ELTE Kémiai Intézet 1/74 Elsőrendű kötések Szalai István ELTE Kémiai Intézet 1/74 Az előadás vázlata ˆ Ismétlés ˆ Ionos vegyületek képződése ˆ Ionok típusai ˆ Kovalens kötés ˆ Fémes kötés ˆ VSEPR elmélet ˆ VB elmélet 2/74 Periodikus

Részletesebben

Kémiai alapismeretek 2. hét

Kémiai alapismeretek 2. hét Kémiai alapismeretek 2. hét Horváth Attila Pécsi Tudományegyetem, Természettudományi Kar, Kémia Intézet, Szervetlen Kémiai Tanszék 2014. szeptember 9.-12. 1/13 2014/2015 I. félév, Horváth Attila c Hullámtermészet:

Részletesebben

2015.02. Általános radiológia - előadás. Arany-Tóth Attila. Radiológia-Aneszteziológia: 6. félév: 3 kredit

2015.02. Általános radiológia - előadás. Arany-Tóth Attila. Radiológia-Aneszteziológia: 6. félév: 3 kredit 1 4 Sebészeti és Szemészeti Tanszék és Klinika Radiológia-Aneszteziológia: 6. félév: 3 kredit KOLLOKVIUM Általános és részletes sebészet I. 7. félév: 2 kredit Részletes sebészet II.: 8. félév: 6 kredit

Részletesebben

Sugárterápia. Ionizáló sugárzások elnyelődésének következményei. Konzultáció: minden hétfőn 15 órakor. 1. Fizikai történések

Sugárterápia. Ionizáló sugárzások elnyelődésének következményei. Konzultáció: minden hétfőn 15 órakor. 1. Fizikai történések Sugárterápia 40% 35% 30% 25% 20% 15% % 5% 0% 2014/2015. tanév FOK biofizika kollokvium jegyspektruma 5 4,5 4 3,5 3 2,5 2 1,5 1 Konzultáció: minden hétfőn 15 órakor Ionizáló sugárzások elnyelődésének következményei

Részletesebben

Az anyagszerkezet alapjai. Az atomok felépítése

Az anyagszerkezet alapjai. Az atomok felépítése Az anyagszerkezet alapjai Az atomok felépítése Kérdések Mik az építőelemek? Milyen elvek szerint épül fel az anyag? Milyen szintjei vannak a struktúrának? Van-e végső, legkisebb építőelem? A legkisebbeknél

Részletesebben

Talián Csaba Gábor Biofizikai Intézet 2012. április 17.

Talián Csaba Gábor Biofizikai Intézet 2012. április 17. SUGÁRZÁSOK. ELEKTROMÁGNESES HULLÁMOK. Talián Csaba Gábor Biofizikai Intézet 2012. április 17. MI A SUGÁRZÁS? ENERGIA TERJEDÉSE A TÉRBEN RÉSZECSKÉK VAGY HULLÁMOK HALADÓ MOZGÁSA RÉVÉN Részecske: α-, β-sugárzás

Részletesebben

Elemi cellák. Kristály: atomok olyan rendeződése, amelyben a mintázat a tér három irányában periódikusan ismétlődik.

Elemi cellák. Kristály: atomok olyan rendeződése, amelyben a mintázat a tér három irányában periódikusan ismétlődik. Kristály: atomok olyan rendeződése, amelyben a mintázat a tér három irányában periódikusan ismétlődik. Elemi cellák amorf vs. mikrokristályos, kristályos anyagok rácspontok lineáris rács síkrács térács

Részletesebben

41. ábra A NaCl rács elemi cellája

41. ábra A NaCl rács elemi cellája 41. ábra A NaCl rács elemi cellája Mindkét rácsra jellemző, hogy egy tetszés szerint kiválasztott pozitív vagy negatív töltésű iont ellentétes töltésű ionok vesznek körül. Különbség a közvetlen szomszédok

Részletesebben

NAGYFELBONTÁSÚ REPÜLÉSI IDŐ DIFFRAKTOMÉTER A BUDAPESTI NEUTRON KUTATÓKÖZPONTBAN

NAGYFELBONTÁSÚ REPÜLÉSI IDŐ DIFFRAKTOMÉTER A BUDAPESTI NEUTRON KUTATÓKÖZPONTBAN 22 Kivonat NAGYFELBONTÁSÚ REPÜLÉSI IDŐ DIFFRAKTOMÉTER A BUDAPESTI NEUTRON KUTATÓKÖZPONTBAN SÁNTA ZSOMBOR MTA Szilárdtestfizikai és Optikai Kutatóintézet, H-1525, POB. 49, Budapest email: santa@szfki.hu

Részletesebben

NAGYFELBONTÁSÚ REPÜLÉSI IDŐ DIFFRAKTOMÉTER A BUDAPESTI NEUTRON KUTATÓKÖZPONTBAN

NAGYFELBONTÁSÚ REPÜLÉSI IDŐ DIFFRAKTOMÉTER A BUDAPESTI NEUTRON KUTATÓKÖZPONTBAN 22 Kivonat NAGYFELBONTÁSÚ REPÜLÉSI IDŐ DIFFRAKTOMÉTER A BUDAPESTI NEUTRON KUTATÓKÖZPONTBAN SÁNTA ZSOMBOR MTA Szilárdtestfizikai és Optikai Kutatóintézet, H-1525, POB. 49, Budapest email: santa@szfki.hu

Részletesebben

Modern műszeres analitika számolási gyakorlat Galbács Gábor

Modern műszeres analitika számolási gyakorlat Galbács Gábor Modern műszeres analitika számolási gyakorlat Galbács Gábor Feladatok a mintavétel, spektroszkópia és automatikus tik analizátorok témakörökből ökből AZ EXTRAKCIÓS MÓDSZEREK Alapfogalmak megoszlási állandó:

Részletesebben

OPTIKA. Vozáry Eszter November

OPTIKA. Vozáry Eszter November OPTIKA Vozáry Eszter 2015. November FÉNY Energia: elektromágneses hullám c = λf részecske foton ε = hf Szubjektív érzet látás fény és színérzékelés ELEKTROMÁGNESES SPEKTRUM c = λf ε = hf FÉNY TRANSZVERZÁLIS

Részletesebben

Az ionizáló sugárzások fajtái, forrásai

Az ionizáló sugárzások fajtái, forrásai Az ionizáló sugárzások fajtái, forrásai magsugárzás Magsugárzások Röntgensugárzás Függelék. Intenzitás 2. Spektrum 3. Atom Repetitio est mater studiorum. Röntgen Ionizációnak nevezzük azt a folyamatot,

Részletesebben

Képrekonstrukció 10. előadás. Balázs Péter Képfeldolgozás és Számítógépes Grafika Tanszék

Képrekonstrukció 10. előadás. Balázs Péter Képfeldolgozás és Számítógépes Grafika Tanszék Képrekonstrukció 10. előadás Balázs Péter Képfeldolgozás és Számítógépes Grafika Tanszék Ultrahang terjedése Fakorhadás vizsgálata (P. Divós, F. Divós) Hullámfront terjedése 20 μs-onként Diffrakciós tomográfia

Részletesebben

Atomszerkezet. Atommag protonok, neutronok + elektronok. atompályák, alhéjak, héjak, atomtörzs ---- vegyérték elektronok

Atomszerkezet. Atommag protonok, neutronok + elektronok. atompályák, alhéjak, héjak, atomtörzs ---- vegyérték elektronok Atomszerkezet Atommag protonok, neutronok + elektronok izotópok atompályák, alhéjak, héjak, atomtörzs ---- vegyérték elektronok periódusos rendszer csoportjai Periódusos rendszer energia szintek atomokban

Részletesebben

Fény, mint elektromágneses hullám, geometriai optika

Fény, mint elektromágneses hullám, geometriai optika Fény, mint elektromágneses hullám, geometriai optika Az elektromágneses hullámok egyik fajtája a szemünk által látható fény. Látható fény (400 nm 800 nm) (vörös ibolyakék) A látható fehér fény a különböző

Részletesebben

Arany-Tóth Attila. Sebészeti röntgenvizit: 8.30. Általános radiológia - előadás

Arany-Tóth Attila. Sebészeti röntgenvizit: 8.30. Általános radiológia - előadás 1 2 Röntgen Osztály 9-15 8.00 10.00 2. illetve 5. csoport 11.00 13.00 1. illetve 4. csoport 13.00 15.00 3. illetve 6. csoport 3 4 Sebészeti röntgenvizit: 8.30 5 6 Honlapok www. univet.hu egységek sebészet

Részletesebben

Hullámok tesztek. 3. Melyik állítás nem igaz a mechanikai hullámok körében?

Hullámok tesztek. 3. Melyik állítás nem igaz a mechanikai hullámok körében? Hullámok tesztek 1. Melyik állítás nem igaz a mechanikai hullámok körében? a) Transzverzális hullám esetén a részecskék rezgésének iránya merıleges a hullámterjedés irányára. b) Csak a transzverzális hullám

Részletesebben

Kémiai kötés Lewis elmélet

Kémiai kötés Lewis elmélet Kémiai kötés 10-1 Lewis elmélet 10-2 Kovalens kötés: bevezetés 10-3 Poláros kovalens kötés 10-4 Lewis szerkezetek 10-5 A molekulák alakja 10-6 Kötésrend, kötéstávolság 10-7 Kötésenergiák Általános Kémia,

Részletesebben

Sillabusz orvosi kémia szemináriumokhoz 1. Kémiai kötések

Sillabusz orvosi kémia szemináriumokhoz 1. Kémiai kötések Sillabusz orvosi kémia szemináriumokhoz 1. Kémiai kötések Pécsi Tudományegyetem Általános Orvostudományi Kar 2010-2011. 1 A vegyületekben az atomokat kémiai kötésnek nevezett erők tartják össze. Az elektronok

Részletesebben

Optika Gröller BMF Kandó MTI

Optika Gröller BMF Kandó MTI Optika Gröller BMF Kandó MTI Optikai alapfogalmak Fény: transzverzális elektromágneses hullám n = c vákuum /c közeg Optika Gröller BMF Kandó MTI Az elektromágneses spektrum Az anyag és a fény kölcsönhatása

Részletesebben

Az anyagszerkezet alapjai

Az anyagszerkezet alapjai Kérdések Az anyagszerkezet alapjai Az atomok felépítése Mik az építőelemek? Milyen elvek szerint épül fel az anyag? Milyen szintjei vannak a struktúrának? Van-e végső, legkisebb építőelem? A legkisebbeknél

Részletesebben

Pásztázó elektronmikroszkóp. Alapelv. Szinkron pásztázás

Pásztázó elektronmikroszkóp. Alapelv. Szinkron pásztázás Pásztázó elektronmikroszkóp Scanning Electron Microscope (SEM) Rasterelektronenmikroskope (REM) Alapelv Egy elektronágyúval vékony elektronnyalábot állítunk elő. Ezzel pásztázzuk (eltérítő tekercsek segítségével)

Részletesebben

A RÖNTGENSUGÁRZÁS HATÁSA HÉTKÖZNAPJAINKRA

A RÖNTGENSUGÁRZÁS HATÁSA HÉTKÖZNAPJAINKRA A RÖNTGENSUGÁRZÁS HATÁSA HÉTKÖZNAPJAINKRA Faigel Gyula MTA Szilárdtestfizikai és Optikai Kutató Intézet 1. ábra. Példa atomok kristályrácsba történô rendezôdésére. Az atomok a kockák csúcsaiban helyezkednek

Részletesebben

Kutatóegyetemi Kiválósági Központ 1. Szuperlézer alprogram: lézerek fejlesztése, alkalmazásai felkészülés az ELI-re Dr. Varjú Katalin egyetemi docens

Kutatóegyetemi Kiválósági Központ 1. Szuperlézer alprogram: lézerek fejlesztése, alkalmazásai felkészülés az ELI-re Dr. Varjú Katalin egyetemi docens Kutatóegyetemi 1. Szuperlézer alprogram: lézerek fejlesztése, alkalmazásai felkészülés az ELI-re Dr. Varjú Katalin egyetemi docens Lézer = speciális fény koherens (fázisban) kicsi a divergenciája (irányított)

Részletesebben

Szerkezetvizsgálat szintjei

Szerkezetvizsgálat szintjei Anyagtudomány 2013/14 Szerkezetvizsgálat Dr. Szabó Péter János szpj@eik.bme.hu Szerkezetvizsgálat szintjei Atomi elrendeződés vizsgálata (röntgendiffrakció, transzmissziós elektronmikroszkóp, atomerő-mikroszkóp)

Részletesebben

Kristályos szilárd anyagok

Kristályos szilárd anyagok Általános és szervetlen kémia 4. hét Elızı héten elsajátítottuk, hogy a kovalens kötés hogyan jön létre, milyen elméletekkel lehet leírni milyen a molekulák alakja melyek a másodlagos kötések Mai témakörök

Részletesebben

9. Fotoelektron-spektroszkópia

9. Fotoelektron-spektroszkópia 9/1 9. Fotoelektron-spektroszkópia 9.1. ábra. Fotoelektron-spektroszkópiai módszerek 9.2. ábra. UP-spektrométer vázlata 9/2 9.3. ábra. N 2 -fotoelektron-spektrum 9.4. ábra. 2:1 mólarányú CO-CO 2 gázelegy

Részletesebben

Bevezetés s az anyagtudományba. nyba február 25. Interferencia. IV. előadás. Intenzitásmaximum (konstruktív interferencia): az útkülönbség nλ,

Bevezetés s az anyagtudományba. nyba február 25. Interferencia. IV. előadás. Intenzitásmaximum (konstruktív interferencia): az útkülönbség nλ, Bevezetés s az anyagtudományba nyba IV. előadás 2010. február 25. A rácsparamr csparaméterek mérésem Interferencia Intenzitásmaximum (konstruktív interferencia): az útkülönbség nλ, Intenzitásminimum (destruktív

Részletesebben

OPT TIKA. Hullámoptika. Dr. Seres István

OPT TIKA. Hullámoptika. Dr. Seres István OPT TIKA Dr. Seres István : A fény elektromágneses hullám r S S = r E r H Seres István 2 http://fft.szie.hu Elektromágneses spektrum c = λf Elnevezés Hullámhossz Frekvencia Váltóáram > 3000 km < 100 Hz

Részletesebben

Száloptika, endoszkópok

Száloptika, endoszkópok Száloptika, endoszkópok Optikai mikroszkópok a diagnosztikában Elektronmikroszkópia, fluorescens és konfokális mikroszkópia PTE-ÁOK Biofizikai ntézet Czimbalek Lívia 2009.03.16. Száloptika, endoszkópok

Részletesebben

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin.

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin. Myoglobin Fehérje-szerkezetek! MGLSDGEWQLVLNVWGKVEADIPGGQEVLIRLFK GPETLEKFDKFKLKSEDEMKASE DLKKGATVLTALGGILKKKGEAEIKPLAQSA TKKIPVKYLEFISECIIQVLQSK PGDFGADAQGAMNKALELFRKDMASNYKELGFQG Fuxreiter Mónika! Debreceni

Részletesebben

A hullámok terjedése során a közegrészecskék egyensúlyi helyzetük körül rezegnek, azaz átlagos elmozdulásuk zérus.

A hullámok terjedése során a közegrészecskék egyensúlyi helyzetük körül rezegnek, azaz átlagos elmozdulásuk zérus. HULLÁMOK MECHANIKAI HULLÁMOK Mechanikai hullám: ha egy rugalmas közeg egyensúlyi állapotát megbolygatva az előidézett zavar tovaterjed a közegben. A zavart a hullámforrás váltja ki. A hullámok terjedése

Részletesebben

Fényérzékeny amorf nanokompozitok: technológia és alkalmazásuk a fotonikában. Csarnovics István

Fényérzékeny amorf nanokompozitok: technológia és alkalmazásuk a fotonikában. Csarnovics István Új irányok és eredményak A mikro- és nanotechnológiák területén 2013.05.15. Budapest Fényérzékeny amorf nanokompozitok: technológia és alkalmazásuk a fotonikában Csarnovics István Debreceni Egyetem, Fizika

Részletesebben

Rezgés, Hullámok. Rezgés, oszcilláció. Harmonikus rezgő mozgás jellemzői

Rezgés, Hullámok. Rezgés, oszcilláció. Harmonikus rezgő mozgás jellemzői Rezgés, oszcilláció Rezgés, Hullámok Fogorvos képzés 2016/17 Szatmári Dávid (david.szatmari@aok.pte.hu) 2016.09.26. Bármilyen azonos időközönként ismétlődő mozgást, periodikus mozgásnak nevezünk. A rezgési

Részletesebben

Gyakorló feladatok Fizikai optikából

Gyakorló feladatok Fizikai optikából Kedves Hallgató! Gyakorló feladatok Fizikai optikából 2008. január 10. Ebben a dokumentumban olyan elméleti kérdéseket és számolós feladatokat talá, melyekhez hasonlókat fogok a vizsga írásbeli részén

Részletesebben

Bevezetés a lézeres anyagmegmunkálásba

Bevezetés a lézeres anyagmegmunkálásba Bevezetés a lézeres anyagmegmunkálásba FBN332E-1 Dr. Geretovszky Zsolt 2010. október 13. A lézeres l anyagmegmunkálás szempontjából l fontos anyagi tulajdonságok Optikai tulajdonságok Mechanikai tulajdonságok

Részletesebben

OPTIKA. Fénykibocsátás mechanizmusa fényforrás típusok. Dr. Seres István

OPTIKA. Fénykibocsátás mechanizmusa fényforrás típusok. Dr. Seres István OPTIKA Fénykibocsátás mechanizmusa Dr. Seres István Bohr modell Niels Bohr (19) Rutherford felfedezte az atommagot, és igazolta, hogy negatív töltésű elektronok keringenek körülötte. Niels Bohr Bohr ezt

Részletesebben

OPTIKA. Hullámoptika Diszperzió, interferencia. Dr. Seres István

OPTIKA. Hullámoptika Diszperzió, interferencia. Dr. Seres István OPTIKA Diszperzió, interferencia Dr. Seres István : A fény elektromágneses hullám A fehér fény összetevői: Seres István 2 http://fft.szie.hu : A fény elektromágneses hullám: Diszperzió: Különböző hullámhosszúságú

Részletesebben

ábra) információt nyújt a kristály fajtájáról és az egykristály

ábra) információt nyújt a kristály fajtájáról és az egykristály tett állapotba kerülnek (azért, hogy ne legyenek képesek kötést hasítani a vándorlás során), és a kialakult elektronkoherencia miatt villámgyorsan eljutnak a reakciócentrumba, ahol a bennük tárolt energia

Részletesebben

Atomszerkezet. Atommag protonok, neutronok + elektronok. atompályák, alhéjak, héjak, atomtörzs ---- vegyérték elektronok

Atomszerkezet. Atommag protonok, neutronok + elektronok. atompályák, alhéjak, héjak, atomtörzs ---- vegyérték elektronok Atomszerkezet Atommag protonok, neutronok + elektronok izotópok atompályák, alhéjak, héjak, atomtörzs ---- vegyérték elektronok periódusos rendszer csoportjai Periódusos rendszer A kémiai kötés Kémiai

Részletesebben

Fehérjeszerkezet, fehérjetekeredés

Fehérjeszerkezet, fehérjetekeredés Fehérjeszerkezet, fehérjetekeredés A fehérjeszerkezet szintjei A fehérjetekeredés elmélete: Anfinsen kísérlet Levinthal paradoxon A feltekeredés tölcsér elmélet 2014.11.05. Aminosavak és fehérjeszerkezet

Részletesebben

Legyen a rések távolsága d, az üveglemez vastagsága w! Az üveglemez behelyezése

Legyen a rések távolsága d, az üveglemez vastagsága w! Az üveglemez behelyezése 6. Gyakorlat 38B-1 Kettős rést 600 nm hullámhosszúságú fénnyel világitunk meg és ezzel egy ernyőn interferenciát hozunk létre. Ezután igen vékony flintüvegből (n = 1,65) készült lemezt helyezünk csak az

Részletesebben

A lézer alapjairól (az iskolában)

A lézer alapjairól (az iskolában) A lézer alapjairól (az iskolában) Dr. Sükösd Csaba c. egyetemi tanár Budapesti Műszaki és Gazdaságtudományi Egyetem Tartalom Elektromágneses hullám (fény) kibocsátása Hogyan bocsát ki fényt egy atom? o

Részletesebben