Fehérjeszerkezet, és tekeredés. Futó Kinga

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "Fehérjeszerkezet, és tekeredés. Futó Kinga"


1 Fehérjeszerkezet, és tekeredés Futó Kinga

2 Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan Titin: 3,435*10 4 aminosav C H N O S 693 Humán kromoszóma 1: 2,25*10 8 nukleotid Biopolimer Alegység Kötés Nukleinsav (RNS, DNS) Nukleotid (CTUGA) Kovalens (foszfodiészter) Poliszacharid (pl. glikogén) Cukor (pl. glukóz) Kovalens (pl. -glikozid) Fehérje Aminosav Kovalens (peptidkötés) Fehérjepolimer (pl. mikrotubulus) Fehérje (pl. tubulin) Másodlagos (Hidrogén kötés, ionos kötés,stb)

3 Fehérje (protein) Elnevezés: 1838 Jöns Jakob Berzelius (Svéd kémikus) Elsődleges fontosságú 1926 James B. Sumner (biokémikus,usa): ureáz egy fehérje Frederick Sanger Frederich Sanger : Kémiai Nobel-díj: Inzulin aminósav szekvenciájának meghatározása Max F. Perutz-t és John C. Kendrew : Kémiai Nobel-díj : hemoglobin és mioglobin kémiai szerkezetének feltérképezése (Röntgen krisztallográfia)

4 Fehérje (protein) Fehérjék: Peptidkötésekkel összekapcsolt aminosavakból álló lineáris polimerek Feladataik: szerkezeti vagy vázfehérjék (kollagének) szállító funkció (miozin) biokémiai folyamatok szereplői (enzimek) immunológiai folyamatok szereplői (antitestek) jelátvitel,információtovábbítás (hormonok)

5 Fehérjék szerkezete: Elsődleges szerkezet: aminosav sorrend Peptid kötés kialakulása

6 Fehérjék másodlagos szerkezete Másodlagos szerkezeti elemek hidrogén kötéseken keresztül stabilizálódnak. β-redő α-hélix

7 Béta-kanyar: olyan, nemhelikális tetrapeptid, amelynél az első és az utolsó alfa-szénatom távolsága 7 angströmnél kisebb. Gamma-kanyar: olyan tripeptid, melyben az első és az utolsó peptidcsoport között hidrogénkötés van. Számos kanyartípust definiáltak a szögek alapján: 7-féle béta kanyar (+ háromnak a tükörképe is), 2-féle gamma-kanyar


9 Fehérjék harmadlagos és negyedleges szerkezete Másodlagos strukturális elemek 3-dimenziós elrendeződése. Több alegység összekapcsolódásából létrejött szerveződési szint. Hemoglobin α-alegysége Hemoglobin A (2α és 2β alegység)

10 Fehérjeszerkezetet összetartó erők: Diszulfid híd : cisztein as.-ak között Hidrogén híd : megosztott proton Sókötés : ellentétesen töltött részecskék között Hidrofób kh. : hidrofób molekularészek között (molekula belsejében)

11 Fehérjék feltekeredésének hajtóereje Hidrofób mag Hidrofil aminosavak

12 Fehérjék feltekeredése (folding)

13 Anfisen kísérlet Anfinsen - féle dogma: A fehérjék 3D szerkezetét az aminosav sorrendjük határozza meg. A felgombolyodás termodinamikai kontroll alatt áll: a natív szerkezet a termodinamikailag legstabilisabb állapot.

14 Energia Levinthal paradoxon Cyrius Levinthal-elméleti biokémikus 100 aminosavból álló peptid 2 konformációs lehetőség aminosavanként variáció 1 konformációs állapot 1ps év szükséges a natív állapot eléréséhez. A valóságban 1 másodpercen belül felgombolyodik! Cyrius Levinthal munka közben Szerkezet A folyamat nem véletlenszerű, a kialalkuló kötések és szerkezeti elemek meghatározzák a köv. lépést.

15 A feltekeredés tölcsér elmélete Kétállapotú rendszer Általános eset Függőleges tengely: a molekula ún. szabad energiája. Vízszintes: fehérjéhez tartozó konfromációs szabadségi fok. A felület minden egyes pontja a fehérje 1 konformációjának felel meg. Az egyes molekulák a globális energiaminimumot, azaz a natív állapotot keresik (legmélyebb pont).

16 Molten globule ( olvadt gombóc )

17 Energia tölcsér elmélet

18 Nem megfelelően feltekeredett (misfolded) proteinek Prion: hibás térszerkezetű fehérjék, melyek fertőző ágensként viselkednek -Kuru ( nevető halál ) Daniel Carleton Gajdusek 1976 Nobel díj -Creutzfeldt-Jakob szindróma -Kergemarha kór Amiloid plakkok kialakulása az agyban Kuru-ban szenvedő őslakosok β-amiloid felhalmozódása Alzheimer s kór

19 Molekuláris chaperonok Segítik a fehérje folding-ot meggátolva a nem megfelelő kölcsönhatásokat, szétszedve a tiltott összekapcsolódásokat. Minden sejtkompartmentben jelen vannak. Olyan fehérjék, amelyek kötik és stabilizálják más fehérjék egyébként nem stabil alakjait, azok kontrollált kötésével és elengedésével elősegítik az előírt in vivo sorsuk beteljesedését, legyen az folding, oligomerizáció, komplexek kialakítása, transzport egy sejtkompartmentbe vagy éppen eliminálás. Legtöbbjük ATP-t igényel funkciója végzéséhez.elrontott fehérje megjavítása: 100 ATP.

20 Összefoglaló


Fehérjeszerkezet, és tekeredés

Fehérjeszerkezet, és tekeredés Fehérjeszerkezet, és tekeredés Futó Kinga 2013.10.08. Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983


Makromolekulák. Fehérjetekeredé. rjetekeredés. Biopolimer. Polimerek

Makromolekulák. Fehérjetekeredé. rjetekeredés. Biopolimer. Polimerek Biopolimerek Makromolekulá Makromolekulák. Fehé Fehérjetekeredé rjetekeredés. Osztódó sejt magorsófonala 2011. November 16. Huber Tamá Tamás Dohány levél epidermális sejtjének aktin hálózata Bakteriofágból


Biopolimer 12/7/09. Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. DNS. Polimerek. Kardos Roland DNS elsődleges szerkezete

Biopolimer 12/7/09. Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. DNS. Polimerek. Kardos Roland DNS elsődleges szerkezete Biopolimerek Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. Osztódó sejt magorsófonala Kardos Roland 2009.10.29. Dohány levél epidermális sejtjének aktin hálózat Bakteriofágból kiszabaduló


DNS, RNS, Fehérjék. makromolekulák biofizikája. Biológiai makromolekulák. A makromolekulák TÖMEG szerinti mennyisége a sejtben NAGY

DNS, RNS, Fehérjék. makromolekulák biofizikája. Biológiai makromolekulák. A makromolekulák TÖMEG szerinti mennyisége a sejtben NAGY makromolekulák biofizikája DNS, RNS, Fehérjék Kellermayer Miklós Tér Méret, alak, lokális és globális szerkezet Idő Fluktuációk, szerkezetváltozások, gombolyodás Kölcsönhatások Belső és külső kölcsöhatások,


Fehérjeszerkezet, fehérjetekeredés

Fehérjeszerkezet, fehérjetekeredés Fehérjeszerkezet, fehérjetekeredés A fehérjeszerkezet szintjei A fehérjetekeredés elmélete: Anfinsen kísérlet Levinthal paradoxon A feltekeredés tölcsér elmélet 2014.11.05. Aminosavak és fehérjeszerkezet


Szerkesztette: Vizkievicz András

Szerkesztette: Vizkievicz András Fehérjék A fehérjék - proteinek - az élő szervezetek számára a legfontosabb vegyületek. Az élet bármilyen megnyilvánulási formája fehérjékkel kapcsolatos. A sejtek szárazanyagának minimum 50 %-át adják.


A fehérjék hierarchikus szerkezete

A fehérjék hierarchikus szerkezete Fehérjék felosztása A fehérjék hierarchikus szerkezete Smeller László Semmelweis Egyetem Biofizikai és Sugárbiológiai Intézet Biológiai funkció alapján Enzimek (pl.: tripszin, citokróm-c ) Transzportfehérjék


Az élő szervezetek felépítése I. Biogén elemek biomolekulák alkotóelemei a természetben előforduló elemek közül 22 fordul elő az élővilágban O; N; C; H; P; és S; - élő anyag 99%-a Biogén elemek sajátosságai:


Az élő anyag szerkezeti egységei: víz, nukleinsavak, fehérjék. elrendeződés, rend, rendszer, periodikus ismétlődés

Az élő anyag szerkezeti egységei: víz, nukleinsavak, fehérjék. elrendeződés, rend, rendszer, periodikus ismétlődés Az élő anyag szerkezeti egységei: víz, nukleinsavak, fehérjék Agócs Gergely 2013. december 3. kedd 10:00 11:40 1. Mit értünk élő anyag alatt? Az élő szervezetet felépítő anyagok. Az anyag azonban nem csupán


A fehérjék szerkezete és az azt meghatározó kölcsönhatások

A fehérjék szerkezete és az azt meghatározó kölcsönhatások A fehérjék szerkezete és az azt meghatározó kölcsönhatások 1. A fehérjék szerepe az élõlényekben 2. A fehérjék szerkezetének szintjei 3. A fehérjék konformációs stabilitásáért felelõs kölcsönhatások 4.


A sejtek élete. 5. Robotoló törpék és óriások Az aminosavak és fehérjék R C NH 2. C COOH 5.1. A fehérjeépítőaminosavak általános

A sejtek élete. 5. Robotoló törpék és óriások Az aminosavak és fehérjék R C NH 2. C COOH 5.1. A fehérjeépítőaminosavak általános A sejtek élete 5. Robotoló törpék és óriások Az aminosavak és fehérjék e csak nézd! Milyen protonátmenetes reakcióra képes egy aminosav? R 2 5.1. A fehérjeépítőaminosavak általános képlete 5.2. A legegyszerűbb


Szimulációk egyszerősített fehérjemodellekkel. Szilágyi András

Szimulációk egyszerősített fehérjemodellekkel. Szilágyi András Szimulációk egyszerősített fehérjemodellekkel Szilágyi András Szimulációs módszerek alkalmazhatósági tartományai Egyszerősített modellek Három típusát mutatjuk be: Játék rácsmodellek Realisztikusabb rácsmodellek





9. Előadás Fehérjék Előzmények Peptidkémia Analitikai kémia Protein kémia 1901 E.Fischer : Gly-Gly 1923 F. Pregl : Mikroanalitika 1952 Stein and Moore : Aminosav analizis 1932 Bergman és Zervas : Benziloxikarbonil


1. Az élő szervezetek felépítése és az életfolyamatok 17

1. Az élő szervezetek felépítése és az életfolyamatok 17 Élődi Pál BIOKÉMIA vomo; Akadémiai Kiadó, Budapest 1980 Tartalom Bevezetés 1. Az élő szervezetek felépítése és az életfolyamatok 17 Mi jellemző az élőre? 17. Biogén elemek 20. Biomolekulák 23. A víz 26.


3. Sejtalkotó molekulák III.

3. Sejtalkotó molekulák III. 3. Sejtalkotó molekulák III. Fehérjék, fehérjeszintézis (transzkripció, transzláció, posztszintetikus módosítások). Enzimműködés 3.1 Fehérjék A genetikai információ egyik fő manifesztálódása Számos funkció


BIOLÓGIA VERSENY 10. osztály 2016. február 20.

BIOLÓGIA VERSENY 10. osztály 2016. február 20. BIOLÓGIA VERSENY 10. osztály 2016. február 20. Kód Elérhető pontszám: 100 Elért pontszám: I. Definíció (2x1 = 2 pont): a) Mikroszkopikus méretű szilárd részecskék aktív bekebelezése b) Molekula, a sejt


TestLine - Biogén elemek, molekulák Minta feladatsor

TestLine - Biogén elemek, molekulák Minta feladatsor TestLine - iogén elemek, molekulák iogén elemek, szervetlen és szerves molekulák az élő szervezetben. gészítsd ki a mondatot! aminocsoportja kondenzáció víz ún. peptidkötés 1. 1:48 Normál fehérjék biológiai


Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete

Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete Polipeptidek térszerkezete Tipikus (rendezett) konformerek em tipikus (rendezetlen) konformerek Periodikus vagy homokonformerek Aperiodikus


Nanotechnológia. Vonderviszt Ferenc. Veszprémi Egyetem Nanotechnológia Tanszék

Nanotechnológia. Vonderviszt Ferenc. Veszprémi Egyetem Nanotechnológia Tanszék Nanotechnológia Vonderviszt Ferenc Veszprémi Egyetem Nanotechnológia Tanszék Ősi technológiák Mikroelektronika Technológia: képesség az anyag szerkezetének, az anyagot felépítő részecskék elrendeződésének


A tananyag felépítése: A BIOLÓGIA ALAPJAI. I. Prokarióták és eukarióták. Az eukarióta sejt. Pécs Miklós: A biológia alapjai

A tananyag felépítése: A BIOLÓGIA ALAPJAI. I. Prokarióták és eukarióták. Az eukarióta sejt. Pécs Miklós: A biológia alapjai A BIOLÓGIA ALAPJAI A tananyag felépítése: Környezetmérnök és műszaki menedzser hallgatók számára Előadó: 2 + 0 + 0 óra, félévközi számonkérés 3 ZH: október 3, november 5, december 5 dr. Pécs Miklós egyetemi


6. Zárványtestek feldolgozása

6. Zárványtestek feldolgozása 6. Zárványtestek feldolgozása... 1 6.1. A zárványtestek... 1 6.1.1. A zárványtestek kialakulása... 2 6.1.2. A feldolgozási technológia... 3 Sejtfeltárás... 3 Centrifugálás, tisztítás...


A negyedleges szerkezet szerepe a kis hő-sokk fehérjék

A negyedleges szerkezet szerepe a kis hő-sokk fehérjék A negyedleges szerkezet szerepe a kis hő-sokk fehérjék chaperon működésében Készítette: Böde Csaba Témavezető: Dr. Fidy Judit egyetemi tanár Semmelweis Egyetem Elméleti Orvostudományok Doktori Iskola Szigorlati


A fehérjék harmadlagos vagy térszerkezete. Még a globuláris fehérjék térszerkezete is sokféle lehet.

A fehérjék harmadlagos vagy térszerkezete. Még a globuláris fehérjék térszerkezete is sokféle lehet. A fehérjék harmadlagos vagy térszerkezete Még a globuláris fehérjék térszerkezete is sokféle lehet. A ribonukleáz redukciója és denaturálódása Chrisian B. Anfinsen A ribonukleáz renaturálódása 1972 obel-díj


1. Bevezetés. Mi az élet, evolúció, információ és energiaáramlás, a szerveződés szintjei

1. Bevezetés. Mi az élet, evolúció, információ és energiaáramlás, a szerveződés szintjei 1. Bevezetés Mi az élet, evolúció, információ és energiaáramlás, a szerveződés szintjei 1.1 Mi az élet? Definíció Alkalmas legyen különbségtételre élő/élettelen közt Ne legyen túl korlátozó (más területen



AMINOSAVAK, FEHÉRJÉK AMINOSAVAK, FEHÉRJÉK Az aminosavak olyan szerves vegyületek, amelyek molekulájában aminocsoport (-NH2) és karboxilcsoport (-COOH) egyaránt előfordul. Felosztás A fehérjéket feloszthatjuk aszerint, hogy


A biológiai mozgás molekuláris mechanizmusai

A biológiai mozgás molekuláris mechanizmusai BIOLÓGIAI MOZGÁSOK A biológiai mozgás molekuláris mechanizmusai Kollektív mozgás Szervezet mozgása ( Az évszázad ugrása ) Szerv mozgás BIOLÓGIAI MOZGÁSOK BIOLÓGIAI MOZGÁSOK Ritmusosan összehúzódó szívizomsejt


A nukleinsavak polimer vegyületek. Mint polimerek, monomerekből épülnek fel, melyeket nukleotidoknak nevezünk.

A nukleinsavak polimer vegyületek. Mint polimerek, monomerekből épülnek fel, melyeket nukleotidoknak nevezünk. Nukleinsavak Szerkesztette: Vizkievicz András A nukleinsavakat először a sejtek magjából sikerült tiszta állapotban kivonni. Innen a név: nucleus = mag (lat.), a sav a kémhatásukra utal. Azonban nukleinsavak


Nukleinsavak. Szerkezet, szintézis, funkció

Nukleinsavak. Szerkezet, szintézis, funkció Nukleinsavak Szerkezet, szintézis, funkció Nukleinsavak, nukleotidok, nukleozidok 1869-ben Miescher a sejtmagból egy savas természetű, lúgban oldódó foszfortartalmú anyagot izolált, amit később, eredetére


A replikáció mechanizmusa

A replikáció mechanizmusa Az öröklődés molekuláris alapjai A DNS megkettőződése, a replikáció Szerk.: Vizkievicz András A DNS-molekula az élőlények örökítő anyaga, kódolt formában tartalmazza mindazon információkat, amelyek a sejt,


Fehérjebiotechnológia Emri, Tamás Csősz, Éva Tőzsér, József Szerkesztette Tőzsér, József, Debreceni Egyetem

Fehérjebiotechnológia Emri, Tamás Csősz, Éva Tőzsér, József Szerkesztette Tőzsér, József, Debreceni Egyetem Fehérjebiotechnológia Emri, Tamás Csősz, Éva Tőzsér, József Szerkesztette Tőzsér, József, Debreceni Egyetem Fehérjebiotechnológia írta Emri, Tamás, Csősz, Éva, Tőzsér, József, Tőzsér, József, és Szerzői


Élettan. előadás tárgykód: bf1c1b10 ELTE TTK, fizika BSc félév: 2015/2016., I. időpont: csütörtök, 8:15 9:45

Élettan. előadás tárgykód: bf1c1b10 ELTE TTK, fizika BSc félév: 2015/2016., I. időpont: csütörtök, 8:15 9:45 Élettan előadás tárgykód: bf1c1b10 ELTE TTK, fizika BSc félév: 2015/2016., I. időpont: csütörtök, 8:15 9:45 oktató: Dr. Tóth Attila, adjunktus ELTE TTK Biológiai Intézet, Élettani és Neurobiológiai tanszék


4. FEHÉRJÉK. 2. Vázanyagok. Az izmok alkotórésze (pl.: a miozin). Inak, izületek, csontok szerves komponensei, az ún. vázfehérjék (szkleroproteinek).

4. FEHÉRJÉK. 2. Vázanyagok. Az izmok alkotórésze (pl.: a miozin). Inak, izületek, csontok szerves komponensei, az ún. vázfehérjék (szkleroproteinek). 4. FEÉRJÉK 4.0. Bevezetés A fehérjék elsısorban α-l-aminosavakból felépülı biopolimerek. A csak α-laminosavakat tartalmazó fehérjék a proteinek. evüket a görög proteios szóból kapták, ami elsırangút jelent.


1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói

1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói 1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói Plazmamembrán Membrán funkciói: sejt integritásának fenntartása állandó hő, energia, és információcsere biztosítása homeosztázis


Fehérjék rövid bevezetés

Fehérjék rövid bevezetés Receptorfehérj rjék szerkezetének felderítése Homológia modellezés Fehérjék rövid bevezetés makromolekulák számos biológiai funkció hordozói: enzimatikus katalízis, molekula transzport, immunválaszok,


A szénhidrátok az élet szempontjából rendkívül fontos, nélkülözhetetlen vegyületek. A bioszféra szerves anyagainak fő tömegét adó vegyületek.

A szénhidrátok az élet szempontjából rendkívül fontos, nélkülözhetetlen vegyületek. A bioszféra szerves anyagainak fő tömegét adó vegyületek. Szénhidrátok Szerkesztette: Vizkievicz András A szénhidrátok az élet szempontjából rendkívül fontos, nélkülözhetetlen vegyületek. A bioszféra szerves anyagainak fő tömegét adó vegyületek. A szénhidrátok


Kollokviumi vizsgakérdések biokémiából humánkineziológia levelező (BSc) 2015

Kollokviumi vizsgakérdések biokémiából humánkineziológia levelező (BSc) 2015 Kollokviumi vizsgakérdések biokémiából humánkineziológia levelező (BSc) 2015 A kérdés 1. A sejtről általában, a szervetlen alkotórészeiről, a vízről részletesen. 2. A sejtről általában, a szervetlen alkotórészeiről,


9. előadás Sejtek közötti kommunikáció

9. előadás Sejtek közötti kommunikáció 9. előadás Sejtek közötti kommunikáció Intracelluláris kommunikáció: Elmozdulás aktin szálak mentén miozin segítségével: A mikrofilamentum rögzített, A miozin mozgékony, vándorol az aktinmikrofilamentum



GYOMOR. EGYES SZERVEK ÉS SZERVREND- SZEREK BIOKÉMIAI MŰKÖDÉSEI 1. Az emésztés és felszívódás PEPSZIN GYOMOR 2. PATKÓBÉL, DUODENUM EGYES SZERVEK ÉS SZERVREND- SZEREK BIOKÉMIAI MŰKÖDÉSEI 1. Az emésztés és felszívódás biokémiája Az emésztőcsatorna szakaszai: Szájüreg: - mechanikai aprítás - megfelelő konzisztencia kialakítása (nyál).


Lehninger et al.: Principles of Biochemistry 3 rd ed (2000); Worth Publ. Voet et al.: Fundamentals of Biochemistry 1 st ed (1999); John Wiley

Lehninger et al.: Principles of Biochemistry 3 rd ed (2000); Worth Publ. Voet et al.: Fundamentals of Biochemistry 1 st ed (1999); John Wiley 1 TANKÖNYVEK Stryer et al.: Biochemistry 5 th ed. (2002); W.H Freeman ISBN: 0716746840 Lehninger et al.: Principles of Biochemistry 3 rd ed (2000); Worth Publ. Garrett & Grisham: Biochemistry 2 nd ed (1998);


Eszközszükséglet: Szükséges anyagok: tojás, NaCl, ammónium-szulfát, réz-szulfát, ólom-acetát, ecetsav, sósav, nátrium-hidroxid, desztillált víz

Eszközszükséglet: Szükséges anyagok: tojás, NaCl, ammónium-szulfát, réz-szulfát, ólom-acetát, ecetsav, sósav, nátrium-hidroxid, desztillált víz A kísérlet, megnevezés, célkitűzései: Fehérjék tulajdonságainak, szerkezetének vizsgálata. Környezeti változások hatásának megfigyelése a fehérjék felépítésében. Eszközszükséglet: Szükséges anyagok: tojás,


Tantárgyi követelmény gimnázium 10. évfolyam

Tantárgyi követelmény gimnázium 10. évfolyam Tantárgyi követelmény gimnázium 10. évfolyam 2015/2016 TARTALOMJEGYZÉK 1. Irodalom és művészetek... 3 2. Anyanyelv és kommunikáció... 4 3. földrajz... 5 4. Történelem és állampolgári ismeretek... 6 5.


A fehérjéket felépítő húsz standard aminosav Fehérjék szerkezetének kialakulása

A fehérjéket felépítő húsz standard aminosav Fehérjék szerkezetének kialakulása A fehérjéket felépítő húsz standard aminosav Fehérjék szerkezetének kialakulása Osváth Szabolcs Semmelweis Egyetem szabolcs.osvath@eok.sote.hu reakció t 1/2 25 ºC-on t 1/2 100 ºC-on DNS hidrolízis Biopolimerek


1. ábra: A hasnyálmirigy Langerhans-szigete

1. ábra: A hasnyálmirigy Langerhans-szigete génmanipulált mikroorganizmusokkal Az elsődleges és másodlagos anyagcseretermékek előállítása után a rekombináns fehérjék gyártásáról lesz szó. Ezek olyan fehérjék, melyeket a sejt eredeti genomja nem


K68464 OTKA pályázat szakmai zárójelentés

K68464 OTKA pályázat szakmai zárójelentés K68464 OTKA pályázat szakmai zárójelentés A fehérjeaggregáció és amiloidképződés szerkezeti alapjai; a különféle morfológiájú aggregátumok kialakulásának körülményei és in vivo hatásuk vizsgálata Vezető


Röntgendiffrakció, tömegspektrometria, infravörös spektrometria.

Röntgendiffrakció, tömegspektrometria, infravörös spektrometria. A biomolekuláris szerkezet és dinamika vizsgálómódszerei: Röntgendiffrakció, tömegspektrometria, infravörös spektrometria. Smeller László A molekuláris szerkezet és dinamika vizsgáló módszereinek áttekintése


A fehérjék hierarchikus szerkezete

A fehérjék hierarchikus szerkezete Fehérjék felosztása A fehérjék hierarchikus szerkezete Smeller László Semmelweis Egyetem Biofizikai és Sugárbiológiai Intézet Biológiai funkció alapján Enzimek (pl.: tripszin, citokróm-c ) Transzportfehérjék


Kémia. Tantárgyi programjai és követelményei A/2. változat

Kémia. Tantárgyi programjai és követelményei A/2. változat 5. sz. melléklet Kémia Tantárgyi programjai és követelményei A/2. változat Az 51/2012. (XII. 21.) számú EMMI rendelethez a 6/2014. (I.29.) EMMI rendelet 3. mellékleteként kiadott és a 34/2014 (IV. 29)


KÉMIA 9-12. évfolyam (Esti tagozat)

KÉMIA 9-12. évfolyam (Esti tagozat) KÉMIA 9-12. évfolyam (Esti tagozat) A kémiai alapműveltség az anyagi világ megismerésének és megértésének egyik fontos eszköze. A kémia tanulása olyan folyamat, amely tartalmain és tevékenységein keresztül


Szilárd anyagok. Műszaki kémia, Anyagtan I. 7. előadás. Dolgosné dr. Kovács Anita egy.doc. PTE MIK Környezetmérnöki Tanszék

Szilárd anyagok. Műszaki kémia, Anyagtan I. 7. előadás. Dolgosné dr. Kovács Anita egy.doc. PTE MIK Környezetmérnöki Tanszék Szilárd anyagok Műszaki kémia, Anyagtan I. 7. előadás Dolgosné dr. Kovács Anita egy.doc. PTE MIK Környezetmérnöki Tanszék Szilárd anyagok felosztása Szilárd anyagok Kristályos szerkezetűek Üvegszerű anyagok


Biológia 3. zh. A gyenge sav típusú molekulák mozgása a szervezetben. Gyengesav transzport. A glükuronsavval konjugált molekulákat a vese kiválasztja.

Biológia 3. zh. A gyenge sav típusú molekulák mozgása a szervezetben. Gyengesav transzport. A glükuronsavval konjugált molekulákat a vese kiválasztja. Biológia 3. zh Az izomösszehúzódás szakaszai, molekuláris mechanizmusa, az izomösszehúzódás során milyen molekula deformálódik és hogyan? Minden izomrosthoz kapcsolódik kegy szinapszis, ez az úgynevezett



7. A SEJT A SEJT 1. ÁLTALÁNOS TUDNIVALÓK A SEJT 1. ÁLTALÁNOS TUDNIVALÓK DIA 1 DIA 2 DIA 3 DIA 4 A sejtbiológia a biológiának az a tudományterülete, amely a sejt szerkezeti felépítésével, a különféle sejtfolyamatokkal (sejtlégzés, anyagtranszport,


Biomolekulák nanomechanikája A biomolekuláris rugalmasság alapjai

Biomolekulák nanomechanikája A biomolekuláris rugalmasság alapjai Fogorvosi Anyagtan Fizikai Alapjai Biomolekulák nanomechanikája A biomolekuláris rugalmasság alapjai Mártonfalvi Zsolt Biofizikai és Sugárbiológiai Intézet Semmelweis Egyetem Budapest Biomolekulák mint


Tejsav alapú polimérek

Tejsav alapú polimérek Tejsav alapú polimérek Majdik Kornélia, Kakes Melinda Babes Bolyai Tudományegyetem, Kolozsvár Tartalom Klasszikus polimérek Biopolimérek Politejsav Biodegradació Kutatási eredmények A jövő polimérjei Polimérek


A kémiai energia átalakítása a sejtekben

A kémiai energia átalakítása a sejtekben A kémiai energia átalakítása a sejtekben A sejtek olyan mikroszkópikus képződmények amelyek működése egy vegyi gyárhoz hasonlítható. Tehát a sejtek mikroszkópikus vegyi gyárak. Mi mindenben hasonlítanak


A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin.

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin. Myoglobin Fehérje-szerkezetek! MGLSDGEWQLVLNVWGKVEADIPGGQEVLIRLFK GPETLEKFDKFKLKSEDEMKASE DLKKGATVLTALGGILKKKGEAEIKPLAQSA TKKIPVKYLEFISECIIQVLQSK PGDFGADAQGAMNKALELFRKDMASNYKELGFQG Fuxreiter Mónika! Debreceni


Víz. A víz biofizikája. A vízmolekula szerkezete. A vízmolekula dinamikája. Forgó-rezgő mozgás

Víz. A víz biofizikája. A vízmolekula szerkezete. A vízmolekula dinamikája. Forgó-rezgő mozgás Víz A víz biofizikája Inspiráció forrása (zene, festészet). Thales (Kr. e. 580):...a víz minden dolgok forrása... Henry Cavendish (1783): a víz H2O. Egyedüli vegyület, amely a természetben mindhárom halmazállapotban


Fehérjék szerkezetének kialakulása II

Fehérjék szerkezetének kialakulása II Egy kis fehérje gombolyodása több párhuzamos úton Fehérjék szerkezetének kialakulása II Osváth Szabolcs Semmelweis Egyetem hélix kialakulás és kollapszus több párhuzamos úton további kollapszus és hélix


Fehérjék nyomás által indukált szerkezetváltozásainak jellemzése infravörös és fluoreszcencia spektroszkópiai módszerekkel

Fehérjék nyomás által indukált szerkezetváltozásainak jellemzése infravörös és fluoreszcencia spektroszkópiai módszerekkel Fehérjék nyomás által indukált szerkezetváltozásainak jellemzése infravörös és fluoreszcencia spektroszkópiai módszerekkel Doktori értekezés Somkuti Judit Semmelweis Egyetem Elméleti Orvostudományok Doktori


BIOFIZIKA. Metodika- 4. Liliom Károly. MTA TTK Enzimológiai Intézet liliom@enzim.hu

BIOFIZIKA. Metodika- 4. Liliom Károly. MTA TTK Enzimológiai Intézet liliom@enzim.hu BIOFIZIKA 2012 11 26 Metodika- 4 Liliom Károly MTA TTK Enzimológiai Intézet liliom@enzim.hu A biofizika előadások temamkája 1. 09-03 Biofizika: fizikai szemlélet, modellalkotás, biometria 2. 09-10 SZÜNET


Fehérjék. Készítette: Friedrichné Irmai Tünde

Fehérjék. Készítette: Friedrichné Irmai Tünde Fehérjék Készítette: Friedrichné Irmai Tünde http://www.youtube.com/watch?v=haee7lnx i2u http://videoklinika.hu/video/tarnai_tejsavo http://shop.biotechusashop.hu/nitro_gold_pr o_enzy_fusion 2200_g_zsak_394


ПРОГРАМА ВСТУПНОГО ВИПРОБУВАННЯ З ХІМІЇ Для вступників на ІІ курс навчання за освітньо-кваліфікаційним рівнем «бакалавр»




BIOKÉMIA TANTÁRGY TEMATIKÁJA GYTK BIOKÉMIA TANTÁRGY TEMATIKÁJA GYTK A biokémia fogalma, tárgya Bioenergetika - Az élő szervezet termodinamikai szempontból nyílt rendszer nyílt rendszer fogalma kémiai/valódi egyensúly és steady state egyensúly


Biomolekuláris kölcsönhatások vizsgálata felületi plazmonrezonancia elvén működő Biacore keszülékkel

Biomolekuláris kölcsönhatások vizsgálata felületi plazmonrezonancia elvén működő Biacore keszülékkel Biomolekuláris kölcsönhatások vizsgálata felületi plazmonrezonancia elvén működő Biacore keszülékkel Biomolekuláris interakciók Fehérje-fehérje Fehérje-ligand Fehérje-DNS/RNS fehérje/ligand-lipid Alegység-kölcsönhatások,


Riboszóma. Golgi. Molekuláris sejtbiológia

Riboszóma. Golgi. Molekuláris sejtbiológia Molekuláris sejtbiológia d-er Riboszóma Golgi Dr. habil KŐHIDAI László egyetemi docens Semmelweis Egyetem, Genetikai, Sejt- és Immunbiológiai Intézet 2005. október 27. Endoplamatikus = sejten belüli; retikulum


FT-IR alapú fehérje másodlagos szerkezet meghatározás optimálása. TDK dolgozat. Kalocsai Réka

FT-IR alapú fehérje másodlagos szerkezet meghatározás optimálása. TDK dolgozat. Kalocsai Réka FT-IR alapú fehérje másodlagos szerkezet meghatározás optimálása TDK dolgozat Kalocsai Réka I. éves biomérnök M.Sc. hallgató Témavezető: Dr. Gergely Szilveszter egyetemi docens Konzulens: Prof. Salgó András



NAPJAINK KOORDINÁCIÓS KÉMIÁJA II * MAGYAR TUDOMÁYOS AKADÉMIA K É M I A I T U D O M Á Y O K O S Z T Á L Y A E L Ö K APJAIK KOORDIÁCIÓS KÉMIÁJA II * Tisztelt Kolléga! A Koordinációs Kémiai Munkabizottság idei első ülésére 2016. május 31-n


Bioinformatika 2 5.. előad

Bioinformatika 2 5.. előad 5.. előad adás Prof. Poppe László BME Szerves Kémia és Technológia Tsz. Bioinformatika proteomika Előadás és gyakorlat 2009. 03. 21. Fehérje térszerkezet t megjelenítése A fehérjék meglehetősen összetett


,:/ " \ OH OH OH - 6 - / \ O / H / H HO-CH, O, CH CH - OH ,\ / "CH - ~(H CH,-OH \OH. ,-\ ce/luló z 5zer.~ezere

,:/  \ OH OH OH - 6 - / \ O / H / H HO-CH, O, CH CH - OH ,\ / CH - ~(H CH,-OH \OH. ,-\ ce/luló z 5zer.~ezere - 6 - o / \ \ o / \ / \ () /,-\ ce/luló z 5zer.~ezere " C=,1 -- J - 1 - - ---,:/ " - -,,\ / " - ~( / \ J,-\ ribóz: a) r.yílt 12"('.1, b) gyürus íormája ~.. ~ en;én'. fu5 héli'(ef1e~: egy menete - 7-5.



A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA 2013.10.09. CITOSZKELETON - DEFINÍCIÓ Fehérjékből felépülő, a sejt vázát alkotó intracelluláris rendszer. Eukarióta és prokarióta sejtekben egyaránt megtalálható.



ANATÓMIA FITNESS AKADÉMIA ANATÓMIA FITNESS AKADÉMIA sejt szövet szerv szervrendszer sejtek általános jellemzése: az élet legkisebb alaki és működési egysége minden élőlény sejtes felépítésű minden sejtre jellemző: határoló rendszer


Egy idegsejt működése

Egy idegsejt működése 2a. Nyugalmi potenciál Egy idegsejt működése A nyugalmi potenciál (feszültség) egy nem stimulált ingerelhető sejt (neuron, izom, vagy szívizom sejt) membrán potenciálját jelenti. A membránpotenciál a plazmamembrán


Szénhidrátok I. (Carbohydrates)

Szénhidrátok I. (Carbohydrates) sztályozás: Szénhidrátok I. (arbohydrates) Polihidroxi-aldehidek (aldózok) vagy polihidroxi-ketonok (ketózok) és származékaik. általános képlet: ( ) n / n ( ) m ; n, m 3 (egész számok) monoszacharidok:


Kevéssé fejlett, sejthártya betüremkedésekből. Citoplazmában, cirkuláris DNS, hisztonok nincsenek

Kevéssé fejlett, sejthártya betüremkedésekből. Citoplazmában, cirkuláris DNS, hisztonok nincsenek 1 A sejtek felépítése Szerkesztette: Vizkievicz András A sejt az élővilág legkisebb, önálló életre képes, minden életjelenséget mutató szerveződési egysége. Minden élőlény sejtes szerveződésű, amelyek


Fehérjék szerkezetének kialakulása II. Semmelweis Egyetem. Osváth Szabolcs

Fehérjék szerkezetének kialakulása II. Semmelweis Egyetem. Osváth Szabolcs Fehérjék szerkezetének kialakulása II Osváth Szabolcs Semmelweis Egyetem szabolcs.osvath@eok.sote.hu Egy kis fehérje gombolyodása több párhuzamos úton hélix kialakulás és kollapszus több párhuzamos úton


Évelő lágyszárú növények biomasszájának hasznosítása

Évelő lágyszárú növények biomasszájának hasznosítása Évelő lágyszárú növények biomasszájának hasznosítása Dr. Hornyák Margit c. egyetemi docens SZE Mezőgazdaság- és Élelmiszertudományi Kar Mosonmagyaróvár MMK Környezetvédelmi Tagozat 2016. január 20. Problémafelvetés



AZ ÉLET KÉMIÁJA... ÉLŐ ANYAG SZERVEZETI ALAPEGYSÉGE AZ ÉLET KÉMIÁJA... ÉLŐ ANYAG SZERVEZETI ALAPEGYSÉGE A biológia az élet tanulmányozásával foglalkozik, az élő szervezetekre viszont vonatkoznak a fizika és kémia törvényei MI ÉPÍTI FEL AZ ÉLŐ ANYAGOT? HOGYAN


A tanári mesterszak pedagógiai - pszichológiai egysége

A tanári mesterszak pedagógiai - pszichológiai egysége A tanári mesterszak pedagógiai - pszichológiai egysége (Tanári záróvizsga témakörök szakmódszertanból) 1. A tanár szerepe a hatékony kémiatanításban. Kémia szakkörök, fakultációs foglalkozások vezetésének


Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek

Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek Hidroxikarbonsavak α-hidroxi karbonsavak -Glikolsav (kézkrémek) - Tejsav (tejtermékek, izomláz, fogszuvasodás) - Citromsav (citrusfélékben,


DER (Felületén riboszómák találhatók) Feladata a biológiai fehérjeszintézis Riboszómák. Az endoplazmatikus membránrendszer. A kódszótár.

DER (Felületén riboszómák találhatók) Feladata a biológiai fehérjeszintézis Riboszómák. Az endoplazmatikus membránrendszer. A kódszótár. Az endoplazmatikus membránrendszer Részei: DER /durva (szemcsés) endoplazmatikus retikulum/ SER /sima felszínű endoplazmatikus retikulum/ Golgi készülék Lizoszómák Peroxiszómák Szekréciós granulumok (váladékszemcsék)


Prológus helyett polimorfizmus kapcsolodó-mutációk

Prológus helyett polimorfizmus kapcsolodó-mutációk Prológus helyett polimorfizmus kapcsolodó-mutációk egy vesebetegség öröklésének vizsgálata során rámutattak, hogy hogyan okozhatnak gyakori genetikai variánsok ritka betegséget. Jó hír ez, mivel segíthet



A METABOLIZMUS ENERGETIKÁJA A METABOLIZMUS ENERGETIKÁJA Futó Kinga 2014.10.01. Metabolizmus Metabolizmus = reakciók együttese, melyek a sejtekben lejátszódnak. Energia nyerés szempontjából vannak fototrófok ill. kemotrófok. szervesanyag


Röntgen sugárzás. Wilhelm Röntgen. Röntgen feleségének keze

Röntgen sugárzás. Wilhelm Röntgen. Röntgen feleségének keze Röntgendiffrakció Kardos Roland 2010.03.08. Előadás vázlata Röntgen sugárzás Interferencia Huygens teória Diffrakció Diffrakciós eljárások Alkalmazás Röntgen sugárzás 1895 röntgen sugárzás felfedezés (1901


Bioaktív peptidek technológiáinak fejlesztése

Bioaktív peptidek technológiáinak fejlesztése Bioaktív peptidek technológiáinak fejlesztése BIOAKTÍV PEPTIDEK A kolosztrum kitűnő fehérjeforrás, melyben az esszenciális aminosavak és más organikus nitrogén-forrásként szolgáló vegyületek rendkívül



BIOMOLEKULÁK KÉMIÁJA. Novák-Nyitrai-Hazai BIOMOLEKULÁK KÉMIÁJA Novák-Nyitrai-Hazai A tankönyv elsısorban szerves kémiai szempontok alapján tárgyalja az élı szervezetek felépítésében és mőködésében kulcsfontosságú szerves vegyületeket. A tárgyalás-


Aminosavak, peptidek, fehérjék

Aminosavak, peptidek, fehérjék Aminosavak, peptidek, fehérjék Az aminosavak a fehérjék építőkövei. A fehérjék felépítésében mindössze 20- féle aminosav vesz részt. Ezek általános képlete: Az aminosavakban, mint arra nevük is utal van


FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest,

FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest, FEHÉRJÉK A MÁGNESEKBEN Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium Alkímia Ma, Budapest, 2013.02.28. I. FEHÉRJÉK: L-α aminosavakból felépülő lineáris polimerek α H 2 N CH COOH amino


Sporttáplálkozás. Étrend-kiegészítők. Készítette: Honti Péter dietetikus. 2015. július

Sporttáplálkozás. Étrend-kiegészítők. Készítette: Honti Péter dietetikus. 2015. július Sporttáplálkozás Étrend-kiegészítők Készítette: Honti Péter dietetikus 2015. július Étrend-kiegészítők Élelmiszerek, amelyek a hagyományos étrend kiegészítését szolgálják, és koncentrált formában tartalmaznak


Új irányok a biomolekuláris felismerés detektálásában

Új irányok a biomolekuláris felismerés detektálásában Magyar Kémiai Folyóirat - Előadások 133 Új irányok a biomolekuláris felismerés detektálásában GYURCSÁNYI E. Róbert a* Budapesti Műszaki és Gazdaságtudományi Egyetem, Általános és Analitikai Kémiai Tanszék,


Orvosi Biofizika. Tematika. Biomolekuláris rendszerek mérettartománya. A tudományos igazság alapja Termodinamika. Komplexitás. Kellermayer Miklós

Orvosi Biofizika. Tematika. Biomolekuláris rendszerek mérettartománya. A tudományos igazság alapja Termodinamika. Komplexitás. Kellermayer Miklós Tematika Orvosi Biofizika Kellermayer Miklós Bevezetés. Az élő anyag szerkezete. Sugárzások. Lumineszcencia Röntgensugárzás Radioaktivitás, dozimetria. Hang, ultrahang. Biomolekuláris rendszerek vizsgálata.


A szénhidrátok lebomlása

A szénhidrátok lebomlása A disszimiláció Szerk.: Vizkievicz András A disszimiláció, vagy lebontás az autotróf, ill. a heterotróf élőlényekben lényegében azonos módon zajlik. A disszimilációs - katabolikus - folyamatok mindig valamilyen


Konferencia a tapasztalatok jegyében

Konferencia a tapasztalatok jegyében Konferencia a tapasztalatok jegyében 2010. november Dornbach Ildikó szakmai igazgató Új biológia, új fizika, régi beidegzések Edzőink felbecsülhetetlen értékű tevékenysége Köztársasági Érdemrendet minden


A minimális sejt. Avagy hogyan alkalmazzuk a biológia több területét egy kérdés megválaszolására

A minimális sejt. Avagy hogyan alkalmazzuk a biológia több területét egy kérdés megválaszolására A minimális sejt Avagy hogyan alkalmazzuk a biológia több területét egy kérdés megválaszolására Anyagcsere Gánti kemoton elmélete Minimum sejt Top down: Meglevő szervezetek genomjából indulunk ki Bottom


Szakközépiskola 9-10. évfolyam Kémia. 9-10. évfolyam

Szakközépiskola 9-10. évfolyam Kémia. 9-10. évfolyam 9-10. évfolyam A szakközépiskolában a kémia tantárgy keretében folyó személyiségfejlesztés a természettudományos nevelés egyik színtereként a hétköznapi életben hasznosulni képes tudás épülését szolgálja.


Fehérjék szerkezetének predikciója, szerkezeti adatok felhasználása adatbázisok segítségével, a számítógépes molekuladinamikai modellezés alapjai

Fehérjék szerkezetének predikciója, szerkezeti adatok felhasználása adatbázisok segítségével, a számítógépes molekuladinamikai modellezés alapjai Fehérjék szerkezetének predikciója, szerkezeti adatok felhasználása adatbázisok segítségével, a számítógépes molekuladinamikai modellezés alapjai Hegedűs Tamás tamas@hegelab.org MTA-SE Membránbiológiai



KÉMIA HELYI TANTERV A 10. ÉVFOLYAM KÉMIA HELYI TANTERV A 10. ÉVFOLYAM KÉTTANNYELVŰ ÉS NYELVI ELŐKÉSZÍTŐ OSZTÁLY SZÁMÁRA Károlyi Mihály Fővárosi Gyakorló Kéttannyelvű Közgazdasági Szakközépiskola 1 KÉMIA A nevelőtestület határozata alapján





Lumineszcencia Fényforrások

Lumineszcencia Fényforrások Kiegészítés: színkeverés Lumineszcencia Fényforrások Alapszinek additív keverése Alapszinek kiegészítő szineinek keverése: Szubtraktív keverés Fidy udit Egyetemi tanár 2015, November 5 Emlékeztető.. Abszorpciós


Polimerek fizikai és kémiai alapjai Nagy, Roland, Pannon Egyetem

Polimerek fizikai és kémiai alapjai Nagy, Roland, Pannon Egyetem Polimerek fizikai és kémiai alapjai Nagy, Roland, Pannon Egyetem Polimerek fizikai és kémiai alapjai írta Nagy, Roland Publication date 2012 Szerzői jog 2012 Pannon Egyetem A digitális tananyag a Pannon
