Makromolekulák. Fehérjetekeredé. rjetekeredés. Biopolimer. Polimerek

Save this PDF as:
 WORD  PNG  TXT  JPG

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "Makromolekulák. Fehérjetekeredé. rjetekeredés. Biopolimer. Polimerek"

Átírás

1 Biopolimerek Makromolekulá Makromolekulák. Fehé Fehérjetekeredé rjetekeredés. Osztódó sejt magorsófonala November 16. Huber Tamá Tamás Dohány levél epidermális sejtjének aktin hálózata Bakteriofágból kiszabaduló DNS Polimerek DNS Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan Titin: 3,435*104 aminosav C132983H211861N36149O40883S693 Humán kromoszóma 1: 2,25*108 nukleotid Biopolimer Alegység 1953 Rosalind Franklin DNS kettős spirál DNS röntgen diffrakciós képe: Kötés Nukleinsav (RNS, DNS) Nukleotid (CTUGA) (foszfodiészter) Poliszacharid (pl. glikogén) Cukor (pl. glükóz) (pl. -glikozid) Fehérje Aminosav (peptidkötés) Fehérjepolimer (pl. mikrotubulus) Fehérje (pl. tubulin) Másodlagos (Hidrogén kötés, ionos kötés, stb) - a molekula fonálszerű, -a fonál két párhuzamos szerkezetből áll. - egyenletes átmérőjű, - spirál alakú James D. Watson és Francis Crick DNS modell T-A (2 hidrogén kötés) C-G (3 hidrogén kötés) DNS elsődleges szerkezete NATURE-1953 Foszfodiészter kötés 2 dezoxi-ribóz között 1962 Nobel díj Robert Cecil Olby - The path to the double helix: The Discovery of DNA James D. Watson The Double Helix DNS kettős hélix Hidrogén kötések a komplementer bázis párok között

2 DNS másodlagos szerkezet Fehérjék szerkezete Elsődleges szerkezet: aminosav sorrend Nagy árok: ligand támadási pont Kis árok Frederick Sanger 1958 Nobel díj DNA Hidrogén kötés Elektrosztatikus kötés Van der Waals Inzulin szekvenciájának meghatározása 1955 A-DNS: rövid (2,4 nm), széles B-DNS: hosszú (3,4 nm), keskeny Z-DNS: megnyúlt (purin-pirimidin alternáció) Fehérjék másodlagos szerkezete Másodlagos szerkezeti elemek hidrogén kötéseken keresztül stabilizálódnak. Peptid kötés kialakulása Fehérjék harmadlagos és negyedleges szerkezete Másodlagos strukturális elemek 3-dimenziós elrendeződése. Több alegység összekapcsolódásából létre jött szerveződési szint. β-redő Hemoglobin α-alegysége α-hélix Fehérjék feltekeredése (folding) Hemoglobin A (2α és 2β alegység) Fehérjék feltekeredésének hajtóereje Hidrofób mag Hidrofil aminosavak

3 Anfinsen kísérlete, RNáz A (1961) Levinthal paradoxon Cyrius Levinthal - elméleti biokémikus Minden peptidegységnek kb. 10 konformációs állapota van 100 aminosavas lánc esetén: variáció 1 konformációs állapot s s, azaz kb év szükséges a natív állapot eléréséhez (több mint az univerzum életkora) Cyrius Levinthal munka közben Szerkezet A valóságban 1 másodpercen belül felgombolyodik! Energia Anfinsen - féle dogma: A fehérjék 3D szerkezetét az aminosav sorrendjük határozza meg. A felgombolyodás termodinamikai kontroll alatt áll: a natív szerkezet a termodinamikailag legstabilisabb állapot. A feltekeredés tölcsér elmélete Kétállapotú rendszer Általános eset Nem megfelelően feltekeredett (misfolded) proteinek Prion: hibás térszerkezetű fehérjék, melyek fertőző ágensként viselkednek -Kuru, Daniel Carleton Gajdusek 1976 Nobel díj -Creutzfeldt-Jakob szindróma -Kergemarha kór β-amiloid felhalmozódása Alzheimer kór Függőleges tengely: a molekula ún. belső szabadentalpiája. Az egyes molekulák a globális energiaminimumot, azaz a natív állapotot keresik. Amiloid plakkok kialakulása az agyban Kuru-ban szenvedő őslakosok A polimerek alakja bolyongó mozgásra emlékeztet (Brown mozgás) Biopolimerek flexibilitását leíró modellek A polimerek nem merev rúdként viselkednek, flexibilitásuk miatt. Flexibilitás oka Leíró modell r 1 Diffúzió: < x 2 >=2D < x 2 > = átlagos négyzetes elmozdulás D = diffúziós állandó = diffúziós idő (megfigyelés időtartama) R r N Négyzetgyök törvény : R 2 Nl 2 Ll r i =elemi vektor R= vég-vég távolság, end-to-end hossz r i l =korrelációs hossz (perzisztencia hossz) N=elemi vektorok száma Nl=L=kontúrhossz Kontúrhossz: polimer kinyújtott hossza Perzisztencia hossz: a polimer azon hossza melynél megtartja az irányultságát (nem hajlik be) 1. C-C kötések körüli rotáció, 2. Súrlódásmentes pántokkal összekapcsolt merev rudak 3. Kötés torzulás pl. DNS, Titin 1 1. Szabadon rotáló lánc 2. Szabadon kapcsolt lánc (FJC), 3. Féregszerű polimerlánc (WLC). 2 3

4 Biopolimerek flexibilitása Biopolimerek mechanikája Merev lánc >>L =1-6 mm Szemiflexibilis lánc ~L =0,1-20 μm <<L Flexibilis lánc <<L =9-16 nm Mikrotubulus Aktin filament Titin Entropikus rugalmasság termikus gerjesztésre a polimerlánc random, ide-oda hajló fluktuációkat végez nő a lánc konformációs entrópiája (elemi vektorok orientációs entrópiája). Az entropikus lánc rugalmassága FL k T R L Vég-vég távolság (R) F=erő =korrelációs hossz (perzisztenciahossz) k B =Boltzmann állandó T=abszolút hőmérséklet L=kontúrhossz R/L=relatív megnyúlás B P ~ Korrelációs hossz Erő (F) Lézer csipesz Csomókötés aktin filamentumra lézercsipesszel Fókuszált lézernyaláb alkalmazása DNS molekula megragadására. Lézer fókusz DNS molekula Latex gyöngy Mozgatható mikropipetta Atom Erő Mikroszkópia (AFM) Titin mechanikai manipulációja AFM-el. Titin megnyújtása AFM-el. F ~ domén stabilitása 2 csúcs közötti távolság ~ kontúr hossz 10μm Erő-megnyújtás görbe

5 Titin biológiai jelentősége -amiloid filamentumok csillámfelszínen (pásztázó üzemmód) Vége!

Fehérjeszerkezet, és tekeredés. Futó Kinga

Fehérjeszerkezet, és tekeredés. Futó Kinga Fehérjeszerkezet, és tekeredés Futó Kinga Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983 H 211861 N

Részletesebben

DNS, RNS, Fehérjék. makromolekulák biofizikája. Biológiai makromolekulák. A makromolekulák TÖMEG szerinti mennyisége a sejtben NAGY

DNS, RNS, Fehérjék. makromolekulák biofizikája. Biológiai makromolekulák. A makromolekulák TÖMEG szerinti mennyisége a sejtben NAGY makromolekulák biofizikája DNS, RNS, Fehérjék Kellermayer Miklós Tér Méret, alak, lokális és globális szerkezet Idő Fluktuációk, szerkezetváltozások, gombolyodás Kölcsönhatások Belső és külső kölcsöhatások,

Részletesebben

Fehérjeszerkezet, és tekeredés

Fehérjeszerkezet, és tekeredés Fehérjeszerkezet, és tekeredés Futó Kinga 2013.10.08. Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983

Részletesebben

Biopolimer 12/7/09. Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. DNS. Polimerek. Kardos Roland DNS elsődleges szerkezete

Biopolimer 12/7/09. Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. DNS. Polimerek. Kardos Roland DNS elsődleges szerkezete Biopolimerek Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. Osztódó sejt magorsófonala Kardos Roland 2009.10.29. Dohány levél epidermális sejtjének aktin hálózat Bakteriofágból kiszabaduló

Részletesebben

Biomolekulák nanomechanikája A biomolekuláris rugalmasság alapjai

Biomolekulák nanomechanikája A biomolekuláris rugalmasság alapjai Fogorvosi Anyagtan Fizikai Alapjai Biomolekulák nanomechanikája A biomolekuláris rugalmasság alapjai Mártonfalvi Zsolt Biofizikai és Sugárbiológiai Intézet Semmelweis Egyetem Budapest Biomolekulák mint

Részletesebben

Az élő anyag szerkezeti egységei: víz, nukleinsavak, fehérjék. elrendeződés, rend, rendszer, periodikus ismétlődés

Az élő anyag szerkezeti egységei: víz, nukleinsavak, fehérjék. elrendeződés, rend, rendszer, periodikus ismétlődés Az élő anyag szerkezeti egységei: víz, nukleinsavak, fehérjék Agócs Gergely 2013. december 3. kedd 10:00 11:40 1. Mit értünk élő anyag alatt? Az élő szervezetet felépítő anyagok. Az anyag azonban nem csupán

Részletesebben

Fehérjeszerkezet, fehérjetekeredés

Fehérjeszerkezet, fehérjetekeredés Fehérjeszerkezet, fehérjetekeredés A fehérjeszerkezet szintjei A fehérjetekeredés elmélete: Anfinsen kísérlet Levinthal paradoxon A feltekeredés tölcsér elmélet 2014.11.05. Aminosavak és fehérjeszerkezet

Részletesebben

A biológiai mozgás molekuláris mechanizmusai

A biológiai mozgás molekuláris mechanizmusai BIOLÓGIAI MOZGÁSOK A biológiai mozgás molekuláris mechanizmusai Kollektív mozgás Szervezet mozgása ( Az évszázad ugrása ) Szerv mozgás BIOLÓGIAI MOZGÁSOK BIOLÓGIAI MOZGÁSOK Ritmusosan összehúzódó szívizomsejt

Részletesebben

Az élő szervezetek felépítése I. Biogén elemek biomolekulák alkotóelemei a természetben előforduló elemek közül 22 fordul elő az élővilágban O; N; C; H; P; és S; - élő anyag 99%-a Biogén elemek sajátosságai:

Részletesebben

Nanotechnológia. Vonderviszt Ferenc. Veszprémi Egyetem Nanotechnológia Tanszék

Nanotechnológia. Vonderviszt Ferenc. Veszprémi Egyetem Nanotechnológia Tanszék Nanotechnológia Vonderviszt Ferenc Veszprémi Egyetem Nanotechnológia Tanszék Ősi technológiák Mikroelektronika Technológia: képesség az anyag szerkezetének, az anyagot felépítő részecskék elrendeződésének

Részletesebben

Nukleinsavak. Szerkezet, szintézis, funkció

Nukleinsavak. Szerkezet, szintézis, funkció Nukleinsavak Szerkezet, szintézis, funkció Nukleinsavak, nukleotidok, nukleozidok 1869-ben Miescher a sejtmagból egy savas természetű, lúgban oldódó foszfortartalmú anyagot izolált, amit később, eredetére

Részletesebben

Biológiai makromolekulák szerkezete

Biológiai makromolekulák szerkezete Biológiai makromolekulák szerkezete Biomolekuláris nemkovalens kölcsönhatások Elektrosztatikus kölcsönhatások (sóhidak: 4-6 kcal/m, dipól-dipól: ~10-1 kcal/m Diszperziós erők (~10-2 kcal/m) Hidrogén hidak

Részletesebben

A fehérjék hierarchikus szerkezete

A fehérjék hierarchikus szerkezete Fehérjék felosztása A fehérjék hierarchikus szerkezete Smeller László Semmelweis Egyetem Biofizikai és Sugárbiológiai Intézet Biológiai funkció alapján Enzimek (pl.: tripszin, citokróm-c ) Transzportfehérjék

Részletesebben

Szerkesztette: Vizkievicz András

Szerkesztette: Vizkievicz András Fehérjék A fehérjék - proteinek - az élő szervezetek számára a legfontosabb vegyületek. Az élet bármilyen megnyilvánulási formája fehérjékkel kapcsolatos. A sejtek szárazanyagának minimum 50 %-át adják.

Részletesebben

Szimulációk egyszerősített fehérjemodellekkel. Szilágyi András

Szimulációk egyszerősített fehérjemodellekkel. Szilágyi András Szimulációk egyszerősített fehérjemodellekkel Szilágyi András Szimulációs módszerek alkalmazhatósági tartományai Egyszerősített modellek Három típusát mutatjuk be: Játék rácsmodellek Realisztikusabb rácsmodellek

Részletesebben

BIOLÓGIA VERSENY 10. osztály 2016. február 20.

BIOLÓGIA VERSENY 10. osztály 2016. február 20. BIOLÓGIA VERSENY 10. osztály 2016. február 20. Kód Elérhető pontszám: 100 Elért pontszám: I. Definíció (2x1 = 2 pont): a) Mikroszkopikus méretű szilárd részecskék aktív bekebelezése b) Molekula, a sejt

Részletesebben

A víz biofizikája O H H. Water. A vízmolekula szerkezete I.

A víz biofizikája O H H. Water. A vízmolekula szerkezete I. Újsághír Az Eagle Rock középiskola diákja nyerte el az első díjat az április 26-án megrendezett Idaho Falls középiskolai Tudományos Konferencián. Dolgozatával azt akarta bemutatni, mennyire ráhangolódtak

Részletesebben

Citoszkeleton. Sejtek rugalmassága. Polimer mechanika: Hooke-rugalmasság. A citoszkeleton filamentumai. Fogászati anyagtan fizikai alapjai 12.

Citoszkeleton. Sejtek rugalmassága. Polimer mechanika: Hooke-rugalmasság. A citoszkeleton filamentumai. Fogászati anyagtan fizikai alapjai 12. Fogászati anyagtan fizikai alapjai 12. Sejtek rugalmassága Citoszkeleton Eukariota sejtek dinamikus vázrendszere Három fő filamentum-osztály: A. Vékony (aktin) B. Intermedier C. Mikrotubulus Polimerizáció:

Részletesebben

Mikrofluidika I. - Alapok

Mikrofluidika I. - Alapok Budapest Műszaki és Gazdaságtudományi Egyetem Mikro és nanotechnika Mikrofluidika I. - Alapok Elektronikus Eszközök Tanszéke www. Ender Ferenc ender@ 1. előadás Bevezetés Mikrofluidikai hatások, arányos

Részletesebben

Nukleinsavak építőkövei

Nukleinsavak építőkövei ukleinsavak Szerkezeti hierarchia ukleinsavak építőkövei Pirimidin Purin Pirimidin Purin Timin (T) Adenin (A) Adenin (A) Citozin (C) Guanin (G) DS bázisai bázis Citozin (C) Guanin (G) RS bázisai bázis

Részletesebben

A tananyag felépítése: A BIOLÓGIA ALAPJAI. I. Prokarióták és eukarióták. Az eukarióta sejt. Pécs Miklós: A biológia alapjai

A tananyag felépítése: A BIOLÓGIA ALAPJAI. I. Prokarióták és eukarióták. Az eukarióta sejt. Pécs Miklós: A biológia alapjai A BIOLÓGIA ALAPJAI A tananyag felépítése: Környezetmérnök és műszaki menedzser hallgatók számára Előadó: 2 + 0 + 0 óra, félévközi számonkérés 3 ZH: október 3, november 5, december 5 dr. Pécs Miklós egyetemi

Részletesebben

3. Sejtalkotó molekulák III.

3. Sejtalkotó molekulák III. 3. Sejtalkotó molekulák III. Fehérjék, fehérjeszintézis (transzkripció, transzláció, posztszintetikus módosítások). Enzimműködés 3.1 Fehérjék A genetikai információ egyik fő manifesztálódása Számos funkció

Részletesebben

A sejtek élete. 5. Robotoló törpék és óriások Az aminosavak és fehérjék R C NH 2. C COOH 5.1. A fehérjeépítőaminosavak általános

A sejtek élete. 5. Robotoló törpék és óriások Az aminosavak és fehérjék R C NH 2. C COOH 5.1. A fehérjeépítőaminosavak általános A sejtek élete 5. Robotoló törpék és óriások Az aminosavak és fehérjék e csak nézd! Milyen protonátmenetes reakcióra képes egy aminosav? R 2 5.1. A fehérjeépítőaminosavak általános képlete 5.2. A legegyszerűbb

Részletesebben

Röntgendiffrakció, tömegspektrometria, infravörös spektrometria.

Röntgendiffrakció, tömegspektrometria, infravörös spektrometria. A biomolekuláris szerkezet és dinamika vizsgálómódszerei: Röntgendiffrakció, tömegspektrometria, infravörös spektrometria. Smeller László A molekuláris szerkezet és dinamika vizsgáló módszereinek áttekintése

Részletesebben

A fehérjék szerkezete és az azt meghatározó kölcsönhatások

A fehérjék szerkezete és az azt meghatározó kölcsönhatások A fehérjék szerkezete és az azt meghatározó kölcsönhatások 1. A fehérjék szerepe az élõlényekben 2. A fehérjék szerkezetének szintjei 3. A fehérjék konformációs stabilitásáért felelõs kölcsönhatások 4.

Részletesebben

6. Zárványtestek feldolgozása

6. Zárványtestek feldolgozása 6. Zárványtestek feldolgozása... 1 6.1. A zárványtestek... 1 6.1.1. A zárványtestek kialakulása... 2 6.1.2. A feldolgozási technológia... 3 6.1.2.1. Sejtfeltárás... 3 6.1.2.2. Centrifugálás, tisztítás...

Részletesebben

A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA

A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA 2013.10.09. CITOSZKELETON - DEFINÍCIÓ Fehérjékből felépülő, a sejt vázát alkotó intracelluláris rendszer. Eukarióta és prokarióta sejtekben egyaránt megtalálható.

Részletesebben

TestLine - Biogén elemek, molekulák Minta feladatsor

TestLine - Biogén elemek, molekulák Minta feladatsor TestLine - iogén elemek, molekulák iogén elemek, szervetlen és szerves molekulák az élő szervezetben. gészítsd ki a mondatot! aminocsoportja kondenzáció víz ún. peptidkötés 1. 1:48 Normál fehérjék biológiai

Részletesebben

9. Előadás Fehérjék Előzmények Peptidkémia Analitikai kémia Protein kémia 1901 E.Fischer : Gly-Gly 1923 F. Pregl : Mikroanalitika 1952 Stein and Moore : Aminosav analizis 1932 Bergman és Zervas : Benziloxikarbonil

Részletesebben

Víz. A víz biofizikája. A vízmolekula szerkezete. A vízmolekula dinamikája. Forgó-rezgő mozgás

Víz. A víz biofizikája. A vízmolekula szerkezete. A vízmolekula dinamikája. Forgó-rezgő mozgás Víz A víz biofizikája Inspiráció forrása (zene, festészet). Thales (Kr. e. 580):...a víz minden dolgok forrása... Henry Cavendish (1783): a víz H2O. Egyedüli vegyület, amely a természetben mindhárom halmazállapotban

Részletesebben

1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói

1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói 1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói Plazmamembrán Membrán funkciói: sejt integritásának fenntartása állandó hő, energia, és információcsere biztosítása homeosztázis

Részletesebben

Eszközszükséglet: Szükséges anyagok: tojás, NaCl, ammónium-szulfát, réz-szulfát, ólom-acetát, ecetsav, sósav, nátrium-hidroxid, desztillált víz

Eszközszükséglet: Szükséges anyagok: tojás, NaCl, ammónium-szulfát, réz-szulfát, ólom-acetát, ecetsav, sósav, nátrium-hidroxid, desztillált víz A kísérlet, megnevezés, célkitűzései: Fehérjék tulajdonságainak, szerkezetének vizsgálata. Környezeti változások hatásának megfigyelése a fehérjék felépítésében. Eszközszükséglet: Szükséges anyagok: tojás,

Részletesebben

Élettan. előadás tárgykód: bf1c1b10 ELTE TTK, fizika BSc félév: 2015/2016., I. időpont: csütörtök, 8:15 9:45

Élettan. előadás tárgykód: bf1c1b10 ELTE TTK, fizika BSc félév: 2015/2016., I. időpont: csütörtök, 8:15 9:45 Élettan előadás tárgykód: bf1c1b10 ELTE TTK, fizika BSc félév: 2015/2016., I. időpont: csütörtök, 8:15 9:45 oktató: Dr. Tóth Attila, adjunktus ELTE TTK Biológiai Intézet, Élettani és Neurobiológiai tanszék

Részletesebben

1. Bevezetés. Mi az élet, evolúció, információ és energiaáramlás, a szerveződés szintjei

1. Bevezetés. Mi az élet, evolúció, információ és energiaáramlás, a szerveződés szintjei 1. Bevezetés Mi az élet, evolúció, információ és energiaáramlás, a szerveződés szintjei 1.1 Mi az élet? Definíció Alkalmas legyen különbségtételre élő/élettelen közt Ne legyen túl korlátozó (más területen

Részletesebben

Röntgen sugárzás. Wilhelm Röntgen. Röntgen feleségének keze

Röntgen sugárzás. Wilhelm Röntgen. Röntgen feleségének keze Röntgendiffrakció Kardos Roland 2010.03.08. Előadás vázlata Röntgen sugárzás Interferencia Huygens teória Diffrakció Diffrakciós eljárások Alkalmazás Röntgen sugárzás 1895 röntgen sugárzás felfedezés (1901

Részletesebben

A replikáció mechanizmusa

A replikáció mechanizmusa Az öröklődés molekuláris alapjai A DNS megkettőződése, a replikáció Szerk.: Vizkievicz András A DNS-molekula az élőlények örökítő anyaga, kódolt formában tartalmazza mindazon információkat, amelyek a sejt,

Részletesebben

Szilárd anyagok. Műszaki kémia, Anyagtan I. 7. előadás. Dolgosné dr. Kovács Anita egy.doc. PTE MIK Környezetmérnöki Tanszék

Szilárd anyagok. Műszaki kémia, Anyagtan I. 7. előadás. Dolgosné dr. Kovács Anita egy.doc. PTE MIK Környezetmérnöki Tanszék Szilárd anyagok Műszaki kémia, Anyagtan I. 7. előadás Dolgosné dr. Kovács Anita egy.doc. PTE MIK Környezetmérnöki Tanszék Szilárd anyagok felosztása Szilárd anyagok Kristályos szerkezetűek Üvegszerű anyagok

Részletesebben

Fehérjebiotechnológia Emri, Tamás Csősz, Éva Tőzsér, József Szerkesztette Tőzsér, József, Debreceni Egyetem

Fehérjebiotechnológia Emri, Tamás Csősz, Éva Tőzsér, József Szerkesztette Tőzsér, József, Debreceni Egyetem Fehérjebiotechnológia Emri, Tamás Csősz, Éva Tőzsér, József Szerkesztette Tőzsér, József, Debreceni Egyetem Fehérjebiotechnológia írta Emri, Tamás, Csősz, Éva, Tőzsér, József, Tőzsér, József, és Szerzői

Részletesebben

A fehérjék térszerkezetének jóslása (Szilágyi András, MTA Enzimológiai Intézete)

A fehérjék térszerkezetének jóslása (Szilágyi András, MTA Enzimológiai Intézete) A fehérjék térszerkezetének jóslása (Szilágyi András, MTA Enzimológiai Intézete) A probléma bonyolultsága Általánosságban: találjuk meg egy tetszőleges szekvencia azon konformációját, amely a szabadentalpia

Részletesebben

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin.

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin. Myoglobin Fehérje-szerkezetek! MGLSDGEWQLVLNVWGKVEADIPGGQEVLIRLFK GPETLEKFDKFKLKSEDEMKASE DLKKGATVLTALGGILKKKGEAEIKPLAQSA TKKIPVKYLEFISECIIQVLQSK PGDFGADAQGAMNKALELFRKDMASNYKELGFQG Fuxreiter Mónika! Debreceni

Részletesebben

Fehérjék rövid bevezetés

Fehérjék rövid bevezetés Receptorfehérj rjék szerkezetének felderítése Homológia modellezés Fehérjék rövid bevezetés makromolekulák számos biológiai funkció hordozói: enzimatikus katalízis, molekula transzport, immunválaszok,

Részletesebben

A borok tisztulása (kolloid tulajdonságok)

A borok tisztulása (kolloid tulajdonságok) A borok tisztulása (kolloid tulajdonságok) Tisztasági problémák a borban Áttetszőség fogyasztói elvárás, különösen a fehérborok esetében Zavarosságok: 1. bor felületén (pl. hártya); 2. borban szétszórtan

Részletesebben

K68464 OTKA pályázat szakmai zárójelentés

K68464 OTKA pályázat szakmai zárójelentés K68464 OTKA pályázat szakmai zárójelentés A fehérjeaggregáció és amiloidképződés szerkezeti alapjai; a különféle morfológiájú aggregátumok kialakulásának körülményei és in vivo hatásuk vizsgálata Vezető

Részletesebben

A fehérjéket felépítő húsz standard aminosav Fehérjék szerkezetének kialakulása

A fehérjéket felépítő húsz standard aminosav Fehérjék szerkezetének kialakulása A fehérjéket felépítő húsz standard aminosav Fehérjék szerkezetének kialakulása Osváth Szabolcs Semmelweis Egyetem szabolcs.osvath@eok.sote.hu reakció t 1/2 25 ºC-on t 1/2 100 ºC-on DNS hidrolízis Biopolimerek

Részletesebben

Kollokviumi vizsgakérdések biokémiából humánkineziológia levelező (BSc) 2015

Kollokviumi vizsgakérdések biokémiából humánkineziológia levelező (BSc) 2015 Kollokviumi vizsgakérdések biokémiából humánkineziológia levelező (BSc) 2015 A kérdés 1. A sejtről általában, a szervetlen alkotórészeiről, a vízről részletesen. 2. A sejtről általában, a szervetlen alkotórészeiről,

Részletesebben

A fehérjék harmadlagos vagy térszerkezete. Még a globuláris fehérjék térszerkezete is sokféle lehet.

A fehérjék harmadlagos vagy térszerkezete. Még a globuláris fehérjék térszerkezete is sokféle lehet. A fehérjék harmadlagos vagy térszerkezete Még a globuláris fehérjék térszerkezete is sokféle lehet. A ribonukleáz redukciója és denaturálódása Chrisian B. Anfinsen A ribonukleáz renaturálódása 1972 obel-díj

Részletesebben

Lumineszcencia Fényforrások

Lumineszcencia Fényforrások Kiegészítés: színkeverés Lumineszcencia Fényforrások Alapszinek additív keverése Alapszinek kiegészítő szineinek keverése: Szubtraktív keverés Fidy udit Egyetemi tanár 2015, November 5 Emlékeztető.. Abszorpciós

Részletesebben

NAGYHATÉKONYSÁGÚ FOLYADÉKKROMA- TOGRÁFIA = NAGYNYOMÁSÚ = HPLC

NAGYHATÉKONYSÁGÚ FOLYADÉKKROMA- TOGRÁFIA = NAGYNYOMÁSÚ = HPLC NAGYHATÉKONYSÁGÚ FOLYADÉKKROMA- TOGRÁFIA = NAGYNYOMÁSÚ = HPLC Az alkalmazott nagy nyomás (100-1000 bar) lehetővé teszi nagyon finom szemcsézetű töltetek (2-10 μm) használatát, ami jelentősen megnöveli

Részletesebben

A nukleinsavak polimer vegyületek. Mint polimerek, monomerekből épülnek fel, melyeket nukleotidoknak nevezünk.

A nukleinsavak polimer vegyületek. Mint polimerek, monomerekből épülnek fel, melyeket nukleotidoknak nevezünk. Nukleinsavak Szerkesztette: Vizkievicz András A nukleinsavakat először a sejtek magjából sikerült tiszta állapotban kivonni. Innen a név: nucleus = mag (lat.), a sav a kémhatásukra utal. Azonban nukleinsavak

Részletesebben

Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete

Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete Polipeptidek térszerkezete Tipikus (rendezett) konformerek em tipikus (rendezetlen) konformerek Periodikus vagy homokonformerek Aperiodikus

Részletesebben

Polimerek fizikai és kémiai alapjai Nagy, Roland, Pannon Egyetem

Polimerek fizikai és kémiai alapjai Nagy, Roland, Pannon Egyetem Polimerek fizikai és kémiai alapjai Nagy, Roland, Pannon Egyetem Polimerek fizikai és kémiai alapjai írta Nagy, Roland Publication date 2012 Szerzői jog 2012 Pannon Egyetem A digitális tananyag a Pannon

Részletesebben

AMINOSAVAK, FEHÉRJÉK

AMINOSAVAK, FEHÉRJÉK AMINOSAVAK, FEHÉRJÉK Az aminosavak olyan szerves vegyületek, amelyek molekulájában aminocsoport (-NH2) és karboxilcsoport (-COOH) egyaránt előfordul. Felosztás A fehérjéket feloszthatjuk aszerint, hogy

Részletesebben

A kolloidika tárgya, a kolloidok osztályozása rendszerezése. Bányai István www.kolloid.unideb.hu

A kolloidika tárgya, a kolloidok osztályozása rendszerezése. Bányai István www.kolloid.unideb.hu A kolloidika tárgya, a kolloidok osztályozása rendszerezése Bányai István www.kolloid.unideb.hu A mindennapi élet: anyagok, eljárások Ipar élelmiszerek: levesek, zselék, élelmiszer színezés, habok építőipar:

Részletesebben

Évelő lágyszárú növények biomasszájának hasznosítása

Évelő lágyszárú növények biomasszájának hasznosítása Évelő lágyszárú növények biomasszájának hasznosítása Dr. Hornyák Margit c. egyetemi docens SZE Mezőgazdaság- és Élelmiszertudományi Kar Mosonmagyaróvár MMK Környezetvédelmi Tagozat 2016. január 20. Problémafelvetés

Részletesebben

Kémia. Tantárgyi programjai és követelményei A/2. változat

Kémia. Tantárgyi programjai és követelményei A/2. változat 5. sz. melléklet Kémia Tantárgyi programjai és követelményei A/2. változat Az 51/2012. (XII. 21.) számú EMMI rendelethez a 6/2014. (I.29.) EMMI rendelet 3. mellékleteként kiadott és a 34/2014 (IV. 29)

Részletesebben

1. Az élő szervezetek felépítése és az életfolyamatok 17

1. Az élő szervezetek felépítése és az életfolyamatok 17 Élődi Pál BIOKÉMIA vomo; Akadémiai Kiadó, Budapest 1980 Tartalom Bevezetés 1. Az élő szervezetek felépítése és az életfolyamatok 17 Mi jellemző az élőre? 17. Biogén elemek 20. Biomolekulák 23. A víz 26.

Részletesebben

A szénhidrátok az élet szempontjából rendkívül fontos, nélkülözhetetlen vegyületek. A bioszféra szerves anyagainak fő tömegét adó vegyületek.

A szénhidrátok az élet szempontjából rendkívül fontos, nélkülözhetetlen vegyületek. A bioszféra szerves anyagainak fő tömegét adó vegyületek. Szénhidrátok Szerkesztette: Vizkievicz András A szénhidrátok az élet szempontjából rendkívül fontos, nélkülözhetetlen vegyületek. A bioszféra szerves anyagainak fő tömegét adó vegyületek. A szénhidrátok

Részletesebben

A fény terjedése és kölcsönhatásai

A fény terjedése és kölcsönhatásai A fény terjedése és kölcsönhatásai A fény terjedése és kölcsönhatásai Kellermayer Miklós A fénytörés (refrakció) alkalmazásai A fényhullám érzékelhető paraméterei A fényhullám fázisa; fáziskontraszt mikroszkópia

Részletesebben

,:/ " \ OH OH OH - 6 - / \ O / H / H HO-CH, O, CH CH - OH ,\ / "CH - ~(H CH,-OH \OH. ,-\ ce/luló z 5zer.~ezere

,:/  \ OH OH OH - 6 - / \ O / H / H HO-CH, O, CH CH - OH ,\ / CH - ~(H CH,-OH \OH. ,-\ ce/luló z 5zer.~ezere - 6 - o / \ \ o / \ / \ () /,-\ ce/luló z 5zer.~ezere " C=,1 -- J - 1 - - ---,:/ " - -,,\ / " - ~( / \ J,-\ ribóz: a) r.yílt 12"('.1, b) gyürus íormája ~.. ~ en;én'. fu5 héli'(ef1e~: egy menete - 7-5.

Részletesebben

Fehérjék szerkezetének kialakulása II

Fehérjék szerkezetének kialakulása II Egy kis fehérje gombolyodása több párhuzamos úton Fehérjék szerkezetének kialakulása II Osváth Szabolcs Semmelweis Egyetem hélix kialakulás és kollapszus több párhuzamos úton további kollapszus és hélix

Részletesebben

Nanomedicina Szimpózium, 2008. Nanomechanika: Egyedi Biomolekulák Manipulálása. Kellermayer Miklós

Nanomedicina Szimpózium, 2008. Nanomechanika: Egyedi Biomolekulák Manipulálása. Kellermayer Miklós Nanomedicina Szimpózium, 28 Nanomechanika: Egyedi Biomolekulák Manipulálása Kellermayer Miklós Semmelweis Egyetem Általános Orvostudományi Kar Biofizikai és Sugárbiológiai Intézet ÉLŐ SEJTBEN: BONYOLULT

Részletesebben

TRANSZPORTFOLYAMATOK 1b. Fehérjék. 1b. FEHÉRJÉK TRANSZPORTJA A MEMBRÁNONOKBA ÉS A SEJTSZERVECSKÉK BELSEJÉBE ÁLTALÁNOS

TRANSZPORTFOLYAMATOK 1b. Fehérjék. 1b. FEHÉRJÉK TRANSZPORTJA A MEMBRÁNONOKBA ÉS A SEJTSZERVECSKÉK BELSEJÉBE ÁLTALÁNOS 1b. FEHÉRJÉK TRANSZPORTJA A MEMBRÁNONOKBA ÉS A SEJTSZERVECSKÉK BELSEJÉBE ÁLTALÁNOS DIA 1 Fő fehérje transzport útvonalak Egy tipikus emlős sejt közel 10,000 féle fehérjét tartalmaz (a test pedig összesen

Részletesebben

A dezmin nanomechanikai vizsgálata

A dezmin nanomechanikai vizsgálata A dezmin nanomechanikai vizsgálata Doktori értekezés Dr. Kiss Balázs Semmelweis Egyetem Elméleti Orvostudományok Doktori Iskola Témavezető: Dr. Kellermayer Miklós egyetemi tanár, az orvostudományok doktora

Részletesebben

Az optikai szálak. FV szálak felépítése, gyakorlati jelenségek

Az optikai szálak. FV szálak felépítése, gyakorlati jelenségek Az optikai szálak FV szálak felépítése, gyakorlati jelenségek Egy kis történelem 1. - 1930 Norman R. French szabadalma optikai távbeszélő rendszerre (merev üvegrudak kötege) - 1950-es évek: 1-1,5m hosszú

Részletesebben

Orvosi Biofizika. Tematika. Biomolekuláris rendszerek mérettartománya. A tudományos igazság alapja Termodinamika. Komplexitás. Kellermayer Miklós

Orvosi Biofizika. Tematika. Biomolekuláris rendszerek mérettartománya. A tudományos igazság alapja Termodinamika. Komplexitás. Kellermayer Miklós Tematika Orvosi Biofizika Kellermayer Miklós Bevezetés. Az élő anyag szerkezete. Sugárzások. Lumineszcencia Röntgensugárzás Radioaktivitás, dozimetria. Hang, ultrahang. Biomolekuláris rendszerek vizsgálata.

Részletesebben

Orvosi implantátumok anyagai

Orvosi implantátumok anyagai 11 Orvosi implantátumok anyagai Dr. Mészáros István Anyagtudomány és Technológia Tanszék Sebészeti, fogorvosi alkalmazások Fémek, ötvözetek Kerámiák Polimerek Kompozitok Fémek ötvözetek hátrányai: korrózió,

Részletesebben

OZMÓZIS, MEMBRÁNTRANSZPORT

OZMÓZIS, MEMBRÁNTRANSZPORT OZMÓZIS, MEMBRÁNTRANSZPORT Vig Andrea PTE ÁOK Biofizikai Intézet 2014.10.28. ÁTTEKINTÉS DIFFÚZIÓ BROWN-MOZGÁS a részecskék rendezetlen hőmozgása DIFFÚZIÓ a részecskék egyenletlen (inhomogén) eloszlásának

Részletesebben

Az élő sejt fizikai Biológiája:

Az élő sejt fizikai Biológiája: Az élő sejt fizikai Biológiája: Modellépítés, biológiai rendszerek skálázódása Kellermayer Miklós Fizikai biológia Ma már nem csak kvalitatív megfigyeléseket, hanem kvantitatív méréseket végzünk (biológiai

Részletesebben

Tantárgyi követelmény gimnázium 10. évfolyam

Tantárgyi követelmény gimnázium 10. évfolyam Tantárgyi követelmény gimnázium 10. évfolyam 2015/2016 TARTALOMJEGYZÉK 1. Irodalom és művészetek... 3 2. Anyanyelv és kommunikáció... 4 3. földrajz... 5 4. Történelem és állampolgári ismeretek... 6 5.

Részletesebben

Modern mikroszkópiai módszerek 2 2011 2012

Modern mikroszkópiai módszerek 2 2011 2012 FLUORESZCENCIA MIKROSZKÓPIA A mintának a megvilágító fény által kiváltott fluoreszcencia emisszióját képezzük le. 1 Bugyi Beáta - PTE ÁOK Biofizikai Intézet 2 FLUOROFÓROK BELSŐ (INTRINSIC) FLUORESZCENCIA

Részletesebben

Termikus analízis alkalmazhatósága a polimerek anyagvizsgálatában és jellemzésében

Termikus analízis alkalmazhatósága a polimerek anyagvizsgálatában és jellemzésében Termikus analízis alkalmazhatósága a polimerek anyagvizsgálatában és jellemzésében Menyhárd Alfréd BME Fizikai Kémia és Anyagtudományi Tanszék PerkinElmer szeminárium Budapest, 2015. október 20. Vázlat

Részletesebben

Tengelykapcsolók. III. konzultáció 2014. április12.

Tengelykapcsolók. III. konzultáció 2014. április12. Tengelykapcsolók III. konzultáció 2014. április12. Tengelykapcsolók csoportosítása Feladatuk: 2 tengelyt nyomaték átvitelre alkalmas módon összekapcsolni Méretezése a nyomaték alapján történik (kdin -

Részletesebben

DNS molekulák elválasztása agaróz gélelektroforézissel és kapilláris elektroforézissel

DNS molekulák elválasztása agaróz gélelektroforézissel és kapilláris elektroforézissel DNS molekulák elválasztása agaróz gélelektroforézissel és kapilláris elektroforézissel Gyakorlat helye: BIOMI Kft. Gödöllő, Szent-Györgyi A. u. 4. (Nemzeti Agrárkutatási és Innovációs Központ épülete volt

Részletesebben

7. A SEJT A SEJT 1. ÁLTALÁNOS TUDNIVALÓK

7. A SEJT A SEJT 1. ÁLTALÁNOS TUDNIVALÓK A SEJT 1. ÁLTALÁNOS TUDNIVALÓK DIA 1 DIA 2 DIA 3 DIA 4 A sejtbiológia a biológiának az a tudományterülete, amely a sejt szerkezeti felépítésével, a különféle sejtfolyamatokkal (sejtlégzés, anyagtranszport,

Részletesebben

A negyedleges szerkezet szerepe a kis hő-sokk fehérjék

A negyedleges szerkezet szerepe a kis hő-sokk fehérjék A negyedleges szerkezet szerepe a kis hő-sokk fehérjék chaperon működésében Készítette: Böde Csaba Témavezető: Dr. Fidy Judit egyetemi tanár Semmelweis Egyetem Elméleti Orvostudományok Doktori Iskola Szigorlati

Részletesebben

12/4/2014. Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció. 1952 Hershey & Chase 1953!!!

12/4/2014. Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció. 1952 Hershey & Chase 1953!!! Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció 1859 1865 1869 1952 Hershey & Chase 1953!!! 1879 1903 1951 1950 1944 1928 1911 1 1. DNS szerkezete Mi az örökítő anyag? Friedrich Miescher

Részletesebben

Fehérjék szerkezetének kialakulása II. Semmelweis Egyetem. Osváth Szabolcs

Fehérjék szerkezetének kialakulása II. Semmelweis Egyetem. Osváth Szabolcs Fehérjék szerkezetének kialakulása II Osváth Szabolcs Semmelweis Egyetem szabolcs.osvath@eok.sote.hu Egy kis fehérje gombolyodása több párhuzamos úton hélix kialakulás és kollapszus több párhuzamos úton

Részletesebben

A kémiai energia átalakítása a sejtekben

A kémiai energia átalakítása a sejtekben A kémiai energia átalakítása a sejtekben A sejtek olyan mikroszkópikus képződmények amelyek működése egy vegyi gyárhoz hasonlítható. Tehát a sejtek mikroszkópikus vegyi gyárak. Mi mindenben hasonlítanak

Részletesebben

FT-IR alapú fehérje másodlagos szerkezet meghatározás optimálása. TDK dolgozat. Kalocsai Réka

FT-IR alapú fehérje másodlagos szerkezet meghatározás optimálása. TDK dolgozat. Kalocsai Réka FT-IR alapú fehérje másodlagos szerkezet meghatározás optimálása TDK dolgozat Kalocsai Réka I. éves biomérnök M.Sc. hallgató Témavezető: Dr. Gergely Szilveszter egyetemi docens Konzulens: Prof. Salgó András

Részletesebben

Fehérjék szerkezetének predikciója, szerkezeti adatok felhasználása adatbázisok segítségével, a számítógépes molekuladinamikai modellezés alapjai

Fehérjék szerkezetének predikciója, szerkezeti adatok felhasználása adatbázisok segítségével, a számítógépes molekuladinamikai modellezés alapjai Fehérjék szerkezetének predikciója, szerkezeti adatok felhasználása adatbázisok segítségével, a számítógépes molekuladinamikai modellezés alapjai Hegedűs Tamás tamas@hegelab.org MTA-SE Membránbiológiai

Részletesebben

ПРОГРАМА ВСТУПНОГО ВИПРОБУВАННЯ З ХІМІЇ Для вступників на ІІ курс навчання за освітньо-кваліфікаційним рівнем «бакалавр»

ПРОГРАМА ВСТУПНОГО ВИПРОБУВАННЯ З ХІМІЇ Для вступників на ІІ курс навчання за освітньо-кваліфікаційним рівнем «бакалавр» ЗАКАРПАТСЬКИЙ УГОРСЬКИЙ ІНСТИТУТ ІМ. Ф. РАКОЦІ ІІ КАФЕДРА МАТЕМАТИКИ ТА ІНФОРМАТИКИ II. RÁKÓCZI FERENC KÁRPÁTALJAI MAGYAR FŐISKOLA MATEMATIKA ÉS INFORMATIKA TANSZÉK ПРОГРАМА ВСТУПНОГО ВИПРОБУВАННЯ З ХІМІЇ

Részletesebben

zis Brown-mozg mozgás Makromolekula (DNS) fluktuáci Vámosi György

zis Brown-mozg mozgás Makromolekula (DNS) fluktuáci Vámosi György Brown-mo mozgás magyarázata Vámosi György Diffúzi zió és s ozmózis zis Az anyag részeskéi állandó mozgásban vannak Haladó mozgás átlagos energiája: E= 3 / kt Emlékeztető: Mawell-féle sebességeloszlás gázokban:

Részletesebben

Mi a biomechanika? Mechanika: a testek mozgásával, a testekre ható erőkkel foglalkozó tudományág

Mi a biomechanika? Mechanika: a testek mozgásával, a testekre ható erőkkel foglalkozó tudományág Biomechanika Mi a biomechanika? Mechanika: a testek mozgásával, a testekre ható erőkkel foglalkozó tudományág Biomechanika: a mechanika törvényszerűségeinek alkalmazása élő szervezetekre, elsősorban az

Részletesebben

Mai témák. Fehérjék dinamikájának jelentősége. Számítógépes modellezés jelentősége

Mai témák. Fehérjék dinamikájának jelentősége. Számítógépes modellezés jelentősége Mai témák Fehérjék szerkezetének predikciója, szerkezeti adatok felhasználása adatbázisok segítségével, a számítógépes molekuladinamikai modellezés alapjai Hegedűs Tamás tamas@hegelab.org Bevezetés szimulációk

Részletesebben

Kiegészítő használati útmutató az ATEX 94/9/EG szerint Tűzvédelmi csappantyú BKA-EN

Kiegészítő használati útmutató az ATEX 94/9/EG szerint Tűzvédelmi csappantyú BKA-EN Kiegészítő használati útmutató az ATEX 94/9/EG szerint Tűzvédelmi csappantyú BKA-EN Ferdinand Schad KG Steigstraße 25-27 D-78600 Kolbingen Telefon +49 (0) 74 63-980 - 0 Telefax +49 (0) 74 63-980 - 200

Részletesebben

KÉMIA 9-12. évfolyam (Esti tagozat)

KÉMIA 9-12. évfolyam (Esti tagozat) KÉMIA 9-12. évfolyam (Esti tagozat) A kémiai alapműveltség az anyagi világ megismerésének és megértésének egyik fontos eszköze. A kémia tanulása olyan folyamat, amely tartalmain és tevékenységein keresztül

Részletesebben

4. FEHÉRJÉK. 2. Vázanyagok. Az izmok alkotórésze (pl.: a miozin). Inak, izületek, csontok szerves komponensei, az ún. vázfehérjék (szkleroproteinek).

4. FEHÉRJÉK. 2. Vázanyagok. Az izmok alkotórésze (pl.: a miozin). Inak, izületek, csontok szerves komponensei, az ún. vázfehérjék (szkleroproteinek). 4. FEÉRJÉK 4.0. Bevezetés A fehérjék elsısorban α-l-aminosavakból felépülı biopolimerek. A csak α-laminosavakat tartalmazó fehérjék a proteinek. evüket a görög proteios szóból kapták, ami elsırangút jelent.

Részletesebben

A titin PEVK domén aktinkötő és mechanikai tulajdonságai

A titin PEVK domén aktinkötő és mechanikai tulajdonságai PhD értekezés A titin PEVK domén aktinkötő és mechanikai tulajdonságai Nagy Attila Pécsi Tudományegyetem Általános Orvostudományi Kar Biofizikai Intézet Pécs 2006 A program megnevezése: Programvezető:

Részletesebben

A polipeptidlánc szabályozott lebontása: mit mondanak a fehérjekristályok? Harmat Veronika ELTE Kémiai Intézet, Szerkezeti Kémia és Biológia Laboratórium MTA-ELTE Fehérjemodellező Kutatócsoport A magyar

Részletesebben

BIOFIZIKA. Metodika- 4. Liliom Károly. MTA TTK Enzimológiai Intézet liliom@enzim.hu

BIOFIZIKA. Metodika- 4. Liliom Károly. MTA TTK Enzimológiai Intézet liliom@enzim.hu BIOFIZIKA 2012 11 26 Metodika- 4 Liliom Károly MTA TTK Enzimológiai Intézet liliom@enzim.hu A biofizika előadások temamkája 1. 09-03 Biofizika: fizikai szemlélet, modellalkotás, biometria 2. 09-10 SZÜNET

Részletesebben

1. ábra: A hasnyálmirigy Langerhans-szigete

1. ábra: A hasnyálmirigy Langerhans-szigete génmanipulált mikroorganizmusokkal Az elsődleges és másodlagos anyagcseretermékek előállítása után a rekombináns fehérjék gyártásáról lesz szó. Ezek olyan fehérjék, melyeket a sejt eredeti genomja nem

Részletesebben

Egy idegsejt működése

Egy idegsejt működése 2a. Nyugalmi potenciál Egy idegsejt működése A nyugalmi potenciál (feszültség) egy nem stimulált ingerelhető sejt (neuron, izom, vagy szívizom sejt) membrán potenciálját jelenti. A membránpotenciál a plazmamembrán

Részletesebben

Szupernova avagy a felrobbanó hűtőgép

Szupernova avagy a felrobbanó hűtőgép Szupernova avagy a felrobbanó hűtőgép (a csillagok termodinamikája 3.) Az atomoktól a csillagokig Dávid Gyula 2013. 09. 19. 1 Szupernova avagy a felrobbanó hűtőgép (a csillagok termodinamikája 3.) Az atomoktól

Részletesebben

8. A fehérjék térszerkezetének jóslása

8. A fehérjék térszerkezetének jóslása 8. A fehérjék térszerkezetének jóslása A probléma bonyolultsága Általánosságban: találjuk meg egy tetszõleges szekvencia azon konformációját, amely a szabadentalpia globális minimumát adja. Egyszerû modellekben

Részletesebben

M E G O L D Ó L A P. Egészségügyi Minisztérium

M E G O L D Ó L A P. Egészségügyi Minisztérium Egészségügyi Minisztérium Szolgálati titok! Titkos! Érvényességi idő: az írásbeli vizsga befejezésének időpontjáig A minősítő neve: Vízvári László A minősítő beosztása: főigazgató M E G O L D Ó L A P szakmai

Részletesebben

CsAvArbiztosítási rendszer

CsAvArbiztosítási rendszer CsAvArbiztosítási rendszer A mûködési elv Az alátétek a lejtős fogazású belső felülettel, egymással szemben összeragasztva kerülnek értékesítésre, így megkönnyítve az első felszerelést és megakadályozva

Részletesebben

A citoszkeletális rendszer, a harántcsíkolt izom biofizikája.

A citoszkeletális rendszer, a harántcsíkolt izom biofizikája. A citoszkeletális rendszer, a harántcsíkolt izom biofizikája. SCIENCE PHOTO LIBRARY Kupi Tünde 2010. 10. 19. Citoszkeleton: eukarióta sejtek dinamikus fehérjevázrendszere Három fı filamentum-osztály: A.

Részletesebben

ozmózis osmosis Egy rendszer termodinamikailag stabilis, ha képződése szabadentalpia csökkenéssel jár, állandó nyomáson és hőmérsékleten.

ozmózis osmosis Egy rendszer termodinamikailag stabilis, ha képződése szabadentalpia csökkenéssel jár, állandó nyomáson és hőmérsékleten. ozmózis osmosis termodinamikai stabilitás thermodynamic stability kinetikai stabilitás kinetic stability felületaktív anyagok surfactants, surface active materials felületinaktív anyagok surface inactive

Részletesebben

(11) Lajstromszám: E 008 375 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA

(11) Lajstromszám: E 008 375 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU00000837T2! (19) HU (11) Lajstromszám: E 008 37 (13) T2 MAGYAR KÖZTÁRSASÁG Szellemi Tulajdon Nemzeti Hivatala EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 07 824187 (22) A bejelentés

Részletesebben

Tejsav alapú polimérek

Tejsav alapú polimérek Tejsav alapú polimérek Majdik Kornélia, Kakes Melinda Babes Bolyai Tudományegyetem, Kolozsvár Tartalom Klasszikus polimérek Biopolimérek Politejsav Biodegradació Kutatási eredmények A jövő polimérjei Polimérek

Részletesebben