A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin.

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin."

Átírás

1 Myoglobin Fehérje-szerkezetek! MGLSDGEWQLVLNVWGKVEADIPGGQEVLIRLFK GPETLEKFDKFKLKSEDEMKASE DLKKGATVLTALGGILKKKGEAEIKPLAQSA TKKIPVKYLEFISECIIQVLQSK PGDFGADAQGAMNKALELFRKDMASNYKELGFQG Fuxreiter Mónika! Debreceni Egyetem, rvos- és Egeszségtudományi Centrum! Biokémiai és Molekuláris Biológiai Intézet! Mastermind Mastermind MVLPTCPMAEFALPRSAVMERLRRRIELCRRSTCEARYEAVSPERLELERQTFAL QRCIQAKAKRAGKRQPPAATAPAPAAPAPRLDAADGPEGRPATLDTVKRNLDSATS PQNGDQQNGYGDLFPGKKTRREAPLGVAISSNGLPPASPLGQSDKPSGADALQSSGKS LGLDSLNKKRLADSSLLNGGSNPSESFPLSLNKELKQEPVEDLPCMITGTVGSISQSNL MPDLNLNEQEWKELIEELNRSVPDEDMKDLFNEDFEEKKDPESSGSATQTPLAQDINIKT EFSPAAFEQEQLGSPQVRAGSAGQTFLGPSSAPVSTDSPSLGGSQTLFTSGQPRADNPS PNLMPASAQAQNAQRALAGVVLPSQGPGGASELSSAQLQQIAAKQKREQMLQNPQQATP APAPGQMSTWQQTGPSSSLDVPYPMEKPASPSSYKQDFTNSKLLMMPSVNKSSPRPGGP YLQPSVNLLSQPPSNLNQNSANNQGSVLDYGNTKPLSYKADCGQGSPGSGQSKPALM AYLPQQLSISEQNSLFLMKPKPGNMPFRSLVPPGQEQNPSSVPVQAQATSVGTQPPAV SVASSNSSPYLSSQQQAAVMKQQLLLDQQKQREQQQKLQQQQFLQRQQLLAEQEKQ QFQRLTRPPPQYQDPTQGSFPQQVGQFTGSSAAVPGMNTLGPSNSSCPRVFPQAGNLMP MGPGASVSSLPTNSGQQDRGVAQFPGSQNMPQSSLYGMASGITQIVAQPPPQATNGA IPRQTNVGQNTSVSAAYGQNSLGSSGLSQQNKGTLNPGLTKPPVPRVSPAMGGQNSSWQ QGMPNLSGQTPGNSNVSPFTAASSFMQQQALKMSSPQFSQAVPNRPMAPMSSAAAVG SLLPPVSAQQRTSAPAPAPPPTAPQQGLPGLSPAGPELGAFSQSPASQMGGRAGLCTQA YPVRTAGQELPFAYSGQPGGSGLSSVAGTDLIDSLLKNRTSEEWMSDLDDLLGSQ Wilson & Kovall Cell (2006) Klasszikus szerkezet-funkció paradigma szekvencia funkció A fehérjék szerkezeti hierarchiája szerkezet! 1

2 Elsődleges szerkezet primer szerkezet - 19 amino, 1 iminosav idrofób, poláros, töltött Elsődleges szerkezet primer szerkezet - 19 amino, 1 iminosav idrofób poláros töltött A,L,V,I,F,W Y S,T,Q,N, D,E,K,R p53 Speciális Speciális Speciális P (hélixtörő) C (kovalens link) G (nincs oldallánc) idrofóbicitási profilok Másodlagos szerkezet lokális (rendezett) szerkezetek β-szál, lemez! különböző skálák! pl. Kyte-Doolittle transzmembrán hélixek predikciója! fehérjén belüli topológia (kívül-belül)! α-helix! Másodlagos szerkezet lokális (rendezett) szerkezetek Fehérjék szerkezetének hierarchiája másodlagos szerkezet torziós szögek,! -kötés mintázat! főlánc szerint! turn! α-helix! Radhakrisnan Cell (1997) 2

3 Feltekeredési tölcsér! armadlagos szerkezet atomok kitüntetett térbeli elrendeződése Nemcsak a másodlagos! másodlagos elemekre vonatkozik! szabályos kötés-mintázat! -kötések! ionos kontaktusok! van der Waals kötések! Levinthal paradoxon! Anfinsen elv! egy natív állapot (kitüntetett)! Feltekeredési tölcsér! egy natív állapot (kitüntetett)! Negyedleges szerkezet Dinamika több peptidlánc elrendeződése molekuláris gépezetek 3

4 L-aminosav Cα királis atom! Építsünk fehérjét lépésenként R C oldallánc CRN-szabály főlánc Peptidkötés: merev szerkezet Transz peptid kötés Ψ N φ C=, N- Delokalizált elektronpár: merev szerkezet dipólusok, polaritás stabilabb Cisz peptid kötés Polipeptid lánc Planáris peptidkötés R 2 N N α α α R1 R3 ritkábban 4

5 Polipeptid lánc geometriájának jellemzése R ϕ C N C N α α C α R R ϕ : C-N-C α -C N-C α Ramachandran-térkép β-lemez φ, Ψ torziós szögek eloszlása R ψ C N C N α α C α R R R C α N C α ω N C α R R ψ : N-C α -C-N C α -C() ω (omega): C α -C-N-C α α-hélix nem G G Mi engedélyezett? α-hélix - ϕ = -60 ± 30 - Ψ = -50 ± 30-3,6 alegység/fordulat - hossz: 5-40 aminosav - -kötések: az n peptidkötés C= része és az n+4 peptidkötés N része között - az oldalláncok kifelé néznek hidrofil v amfipatikus 5.4 Å 3 10 hélix és a többiek Szuper másodlagos szerkezetek β-szál Kendrew, 1957 myoglobin 5

6 parallel β-redő antiparallel β-redő 4.6 Å - ϕ = -140 ± Å - Ψ = 140 ± 30 - legalább 5-10 aminosav hidrofób - -kötések a láncok között vannak - az oldalláncok a lemez síkja alatt/felett helyezkednek el Eisenberg Nature (2005) amiloid képződés (irreverzibilis aggregátumok, Parkinson kór, Alzheimer kór) Nem szabályos másodlagos szerkezeti elemek urkok (turn, coil) urkok! pl. β szálak összekapcsolódásánál VCBP AA között α1a adrenerg receptor et" összekötő szakaszok, hurkok - A fehérjék fontos másodlagos szerkezeti elemei, nem mutatnak periodikus rendezettséget, mint az α-hélixek vagy a β-szerkezetek.! - et kötnek össze.! - Különböző hosszúságúak és alakúak lehetnek.! armadlagos szerkezet - Jellemzően poláros és töltéssel rendelkező aminosavak vannak ezekben a régiókban.! - Általában a fehérjék felszínén fordulnak elő, ezért fontos szerepük van a fehérjék biológiai funkcióiban (fehérje-fehérje kölcsönhatásokban, felismerési folyamatokban, kötődésben, stb.).! - A fehérjék evolúciós fejlődése során az α-hélixek és a β-szerkezetek nagymértékben konzerválódtak, míg a hurkok nagymértékben változtak. 6

7 Globuláris - vízoldható Mi a globuláris fehérje? idrofób mag! idrofil felszín Globuláris - vízoldható A fehérjeszerkezet feltekeredésének problémája hidrofób mag,! hidrofil felszín E Levinthal paradoxon: ogyan találja meg a fehérje a natív! szerkezetet a csillagászati számú! konformáció közül rövid (ms-min)! idő alatt?! 100 aminosav konformáció s / konformációváltozás év kell a natív szerkezethez Globuláris fehérjék feltekeredése: másodlagos szerkezetek először Milyen fehérjék vannak még? hidrofób kölcsönhatások először 7

8 Membránfehérjék Rendezetlen fehérjék sok szerkezet Konzervált szerkezeti/funkcionális egységek: domének W2 8

Fehérjeszerkezet, és tekeredés

Fehérjeszerkezet, és tekeredés Fehérjeszerkezet, és tekeredés Futó Kinga 2013.10.08. Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983

Részletesebben

Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis

Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis Szerkezet Protein Data Bank (PDB) http://www.rcsb.org/pdb ~ 35 701 szerkezet közepes felbontás 1552 szerkezet d 1.5 Å 160 szerkezet d 1.0 Å 10 szerkezet d 0.8 Å (atomi felbontás) E globális minimum? funkció

Részletesebben

A fehérjék hierarchikus szerkezete

A fehérjék hierarchikus szerkezete Fehérjék felosztása A fehérjék hierarchikus szerkezete Smeller László Semmelweis Egyetem Biofizikai és Sugárbiológiai Intézet Biológiai funkció alapján Enzimek (pl.: tripszin, citokróm-c ) Transzportfehérjék

Részletesebben

FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest,

FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest, FEHÉRJÉK A MÁGNESEKBEN Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium Alkímia Ma, Budapest, 2013.02.28. I. FEHÉRJÉK: L-α aminosavakból felépülő lineáris polimerek α H 2 N CH COOH amino

Részletesebben

Biopolimer 12/7/09. Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. DNS. Polimerek. Kardos Roland DNS elsődleges szerkezete

Biopolimer 12/7/09. Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. DNS. Polimerek. Kardos Roland DNS elsődleges szerkezete Biopolimerek Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. Osztódó sejt magorsófonala Kardos Roland 2009.10.29. Dohány levél epidermális sejtjének aktin hálózat Bakteriofágból kiszabaduló

Részletesebben

Fehérjeszerkezet, fehérjetekeredés

Fehérjeszerkezet, fehérjetekeredés Fehérjeszerkezet, fehérjetekeredés A fehérjeszerkezet szintjei A fehérjetekeredés elmélete: Anfinsen kísérlet Levinthal paradoxon A feltekeredés tölcsér elmélet 2014.11.05. Aminosavak és fehérjeszerkezet

Részletesebben

Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek

Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek Hidroxikarbonsavak α-hidroxi karbonsavak -Glikolsav (kézkrémek) - Tejsav (tejtermékek, izomláz, fogszuvasodás) - Citromsav (citrusfélékben,

Részletesebben

Makromolekulák. Fehérjetekeredé. rjetekeredés. Biopolimer. Polimerek

Makromolekulák. Fehérjetekeredé. rjetekeredés. Biopolimer. Polimerek Biopolimerek Makromolekulá Makromolekulák. Fehé Fehérjetekeredé rjetekeredés. Osztódó sejt magorsófonala 2011. November 16. Huber Tamá Tamás Dohány levél epidermális sejtjének aktin hálózata Bakteriofágból

Részletesebben

Fehérjeszerkezet, és tekeredés. Futó Kinga

Fehérjeszerkezet, és tekeredés. Futó Kinga Fehérjeszerkezet, és tekeredés Futó Kinga Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983 H 211861 N

Részletesebben

A fehérjék hierarchikus szerkezete

A fehérjék hierarchikus szerkezete Fehérjék felosztása A fehérjék hierarchikus szerkezete Smeller László Semmelweis Egyetem Biofizikai és Sugárbiológiai Intézet Biológiai funkció alapján Enzimek (pl.: tripszin, citokróm-c ) Transzportfehérjék

Részletesebben

Az élő anyag szerkezeti egységei: víz, nukleinsavak, fehérjék. elrendeződés, rend, rendszer, periodikus ismétlődés

Az élő anyag szerkezeti egységei: víz, nukleinsavak, fehérjék. elrendeződés, rend, rendszer, periodikus ismétlődés Az élő anyag szerkezeti egységei: víz, nukleinsavak, fehérjék Agócs Gergely 2013. december 3. kedd 10:00 11:40 1. Mit értünk élő anyag alatt? Az élő szervezetet felépítő anyagok. Az anyag azonban nem csupán

Részletesebben

Nukleinsavak építőkövei

Nukleinsavak építőkövei ukleinsavak Szerkezeti hierarchia ukleinsavak építőkövei Pirimidin Purin Pirimidin Purin Timin (T) Adenin (A) Adenin (A) Citozin (C) Guanin (G) DS bázisai bázis Citozin (C) Guanin (G) RS bázisai bázis

Részletesebben

Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete

Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete Polipeptidek térszerkezete Tipikus (rendezett) konformerek em tipikus (rendezetlen) konformerek Periodikus vagy homokonformerek Aperiodikus

Részletesebben

MedInProt Szinergia IV. program. Szerkezetvizsgáló módszer a rendezetlen fehérjék szerkezetének és kölcsönhatásainak jellemzésére

MedInProt Szinergia IV. program. Szerkezetvizsgáló módszer a rendezetlen fehérjék szerkezetének és kölcsönhatásainak jellemzésére MedInProt Szinergia IV. program Szerkezetvizsgáló módszer a rendezetlen fehérjék szerkezetének és kölcsönhatásainak jellemzésére Tantos Ágnes MTA TTK Enzimológiai Intézet, Rendezetlen fehérje kutatócsoport

Részletesebben

A fehérjéket felépítő húsz standard aminosav Fehérjék szerkezetének kialakulása

A fehérjéket felépítő húsz standard aminosav Fehérjék szerkezetének kialakulása A fehérjéket felépítő húsz standard aminosav Fehérjék szerkezetének kialakulása Osváth Szabolcs Semmelweis Egyetem szabolcs.osvath@eok.sote.hu reakció t 1/2 25 ºC-on t 1/2 100 ºC-on DNS hidrolízis Biopolimerek

Részletesebben

A kovalens kötés elmélete. Kovalens kötésű molekulák geometriája. Molekula geometria. Vegyértékelektronpár taszítási elmélet (VSEPR)

A kovalens kötés elmélete. Kovalens kötésű molekulák geometriája. Molekula geometria. Vegyértékelektronpár taszítási elmélet (VSEPR) 4. előadás A kovalens kötés elmélete Vegyértékelektronpár taszítási elmélet (VSEPR) az atomok kötő és nemkötő elektronpárjai úgy helyezkednek el a térben, hogy egymástól minél távolabb legyenek A központi

Részletesebben

Szerkesztette: Vizkievicz András

Szerkesztette: Vizkievicz András Fehérjék A fehérjék - proteinek - az élő szervezetek számára a legfontosabb vegyületek. Az élet bármilyen megnyilvánulási formája fehérjékkel kapcsolatos. A sejtek szárazanyagának minimum 50 %-át adják.

Részletesebben

Bioinformatika előad

Bioinformatika előad 7.. előad adás Prof. Poppe László BME Szerves Kémia és Technológia Tsz. Bioinformatika proteomika Előadás és gyakorlat 2009. 04. 03. Térszerkezet előrejelz rejelzés s főf módszerei Homológia modellezés

Részletesebben

Eszközszükséglet: Szükséges anyagok: tojás, NaCl, ammónium-szulfát, réz-szulfát, ólom-acetát, ecetsav, sósav, nátrium-hidroxid, desztillált víz

Eszközszükséglet: Szükséges anyagok: tojás, NaCl, ammónium-szulfát, réz-szulfát, ólom-acetát, ecetsav, sósav, nátrium-hidroxid, desztillált víz A kísérlet, megnevezés, célkitűzései: Fehérjék tulajdonságainak, szerkezetének vizsgálata. Környezeti változások hatásának megfigyelése a fehérjék felépítésében. Eszközszükséglet: Szükséges anyagok: tojás,

Részletesebben

A kovalens kötés polaritása

A kovalens kötés polaritása Általános és szervetlen kémia 4. hét Kovalens kötés A kovalens kötés kialakulásakor szabad atomokból molekulák jönnek létre. A molekulák létrejötte mindig energia csökkenéssel jár. A kovalens kötés polaritása

Részletesebben

Biokémiai kutatások ma

Biokémiai kutatások ma Nyitray László Biokémiai Tanszék Hb Biokémiai kutatások ma Makromolekulák szerkezet-funkció kutatása Molekuláris biológia minden szinten Redukcionista molekuláris biológia vs. holisztikus rendszerbiológia

Részletesebben

7. Fehérjeszekvenciák és térszerkezetek analízise.

7. Fehérjeszekvenciák és térszerkezetek analízise. 7. Fehérjeszekvenciák és térszerkezetek analízise. 1. Egyszerû elemzések 2. Térszerkezet predikció 2.1. A probléma bonyolultsága 2.2. A predikció szintjei 2.3. 1D predikciók (másodlagos szerkezet, hozzáférhetõség,

Részletesebben

A fehérjék szerkezete és az azt meghatározó kölcsönhatások

A fehérjék szerkezete és az azt meghatározó kölcsönhatások A fehérjék szerkezete és az azt meghatározó kölcsönhatások 1. A fehérjék szerepe az élõlényekben 2. A fehérjék szerkezetének szintjei 3. A fehérjék konformációs stabilitásáért felelõs kölcsönhatások 4.

Részletesebben

Fehérjék szerkezetének kialakulása II

Fehérjék szerkezetének kialakulása II Egy kis fehérje gombolyodása több párhuzamos úton Fehérjék szerkezetének kialakulása II Osváth Szabolcs Semmelweis Egyetem hélix kialakulás és kollapszus több párhuzamos úton további kollapszus és hélix

Részletesebben

Immunológia alapjai előadás. Az immunológiai felismerés molekuláris összetevői.

Immunológia alapjai előadás. Az immunológiai felismerés molekuláris összetevői. Immunológia alapjai 3 4. előadás Az immunológiai felismerés molekuláris összetevői. Az antigén fogalma. Antitestek, T- és B- sejt receptorok: molekuláris szerkezet, funkciók, alcsoportok Az antigén meghatározása

Részletesebben

Víz. A víz biofizikája. A vízmolekula szerkezete. A vízmolekula dinamikája. Forgó-rezgő mozgás

Víz. A víz biofizikája. A vízmolekula szerkezete. A vízmolekula dinamikája. Forgó-rezgő mozgás Víz A víz biofizikája Inspiráció forrása (zene, festészet). Thales (Kr. e. 580):...a víz minden dolgok forrása... Henry Cavendish (1783): a víz H2O. Egyedüli vegyület, amely a természetben mindhárom halmazállapotban

Részletesebben

A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA

A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA 2013.10.09. CITOSZKELETON - DEFINÍCIÓ Fehérjékből felépülő, a sejt vázát alkotó intracelluláris rendszer. Eukarióta és prokarióta sejtekben egyaránt megtalálható.

Részletesebben

DNS, RNS, Fehérjék. makromolekulák biofizikája. Biológiai makromolekulák. A makromolekulák TÖMEG szerinti mennyisége a sejtben NAGY

DNS, RNS, Fehérjék. makromolekulák biofizikája. Biológiai makromolekulák. A makromolekulák TÖMEG szerinti mennyisége a sejtben NAGY makromolekulák biofizikája DNS, RNS, Fehérjék Kellermayer Miklós Tér Méret, alak, lokális és globális szerkezet Idő Fluktuációk, szerkezetváltozások, gombolyodás Kölcsönhatások Belső és külső kölcsöhatások,

Részletesebben

Kémiai kötés Lewis elmélet

Kémiai kötés Lewis elmélet Kémiai kötés 10-1 Lewis elmélet 10-2 Kovalens kötés: bevezetés 10-3 Poláros kovalens kötés 10-4 Lewis szerkezetek 10-5 A molekulák alakja 10-6 Kötésrend, kötéstávolság 10-7 Kötésenergiák Általános Kémia,

Részletesebben

Bio-nanorendszerek. Vonderviszt Ferenc. Pannon Egyetem Nanotechnológia Tanszék

Bio-nanorendszerek. Vonderviszt Ferenc. Pannon Egyetem Nanotechnológia Tanszék Bio-nanorendszerek Vonderviszt Ferenc Pannon Egyetem Nanotechnológia Tanszék Technológia: képesség az anyag szerkezetének, az anyagot felépítő részecskék elrendeződésének befolyásolására. A technológiai

Részletesebben

Röntgen sugárzás. Wilhelm Röntgen. Röntgen feleségének keze

Röntgen sugárzás. Wilhelm Röntgen. Röntgen feleségének keze Röntgendiffrakció Kardos Roland 2010.03.08. Előadás vázlata Röntgen sugárzás Interferencia Huygens teória Diffrakció Diffrakciós eljárások Alkalmazás Röntgen sugárzás 1895 röntgen sugárzás felfedezés (1901

Részletesebben

Gáspári Zoltán. Élő molekulák az élet molekulái

Gáspári Zoltán. Élő molekulák az élet molekulái Gáspári Zoltán Élő molekulák az élet molekulái Invokáció Kajtár Márton 1929-1991 www.eotvoskiado.hu Élő és élettelen? Élő és élettelen: a kemoton Élő kémiai rendszer, de nem élőlény (Gánti, 1975) Autokatalitikus

Részletesebben

Atomszerkezet. Atommag protonok, neutronok + elektronok. atompályák, alhéjak, héjak, atomtörzs ---- vegyérték elektronok

Atomszerkezet. Atommag protonok, neutronok + elektronok. atompályák, alhéjak, héjak, atomtörzs ---- vegyérték elektronok Atomszerkezet Atommag protonok, neutronok + elektronok izotópok atompályák, alhéjak, héjak, atomtörzs ---- vegyérték elektronok periódusos rendszer csoportjai Periódusos rendszer A kémiai kötés Kémiai

Részletesebben

Elektrosztatikus számítások. Elektrosztatikus számítások. Elektrosztatikus számítások. Elektrosztatikus számítások Definíciók

Elektrosztatikus számítások. Elektrosztatikus számítások. Elektrosztatikus számítások. Elektrosztatikus számítások Definíciók Jelentősége szubsztrát kötődés szolvatáció ionizációs állapotok (pka) mechanizmus katalízis ioncsatornák szimulációk (szerkezet) all-atom dipolar fluid dipolar lattice continuum Definíciók töltéseloszlás

Részletesebben

Szalai István. ELTE Kémiai Intézet 1/74

Szalai István. ELTE Kémiai Intézet 1/74 Elsőrendű kötések Szalai István ELTE Kémiai Intézet 1/74 Az előadás vázlata ˆ Ismétlés ˆ Ionos vegyületek képződése ˆ Ionok típusai ˆ Kovalens kötés ˆ Fémes kötés ˆ VSEPR elmélet ˆ VB elmélet 2/74 Periodikus

Részletesebben

Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete

Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete Polipeptidek térszerkezete Tipikus (rendezett) konformerek em tipikus (rendezetlen) konformerek Periodikus vagy homokonformerek Aperiodikus

Részletesebben

Adatgyűjtés, mérési alapok, a környezetgazdálkodás fontosabb műszerei

Adatgyűjtés, mérési alapok, a környezetgazdálkodás fontosabb műszerei Tudományos kutatásmódszertani, elemzési és közlési ismeretek modul Gazdálkodási modul Gazdaságtudományi ismeretek I Közgazdasá Adatgyűjtés, mérési alapok, a környezetgazdálkodás fontosabb műszerei KÖRNYEZETGAZDÁLKODÁSI

Részletesebben

Modern Fizika Labor. Fizika BSc. Értékelés: A mérés dátuma: A mérés száma és címe: 13. mérés: Molekulamodellezés PC-n. 2008. április 29.

Modern Fizika Labor. Fizika BSc. Értékelés: A mérés dátuma: A mérés száma és címe: 13. mérés: Molekulamodellezés PC-n. 2008. április 29. Modern Fizika Labor Fizika BSc A mérés dátuma: A mérés száma és címe: 13. mérés: Molekulamodellezés PC-n Értékelés: A beadás dátuma: 2008. május 6. A mérést végezte: 1/5 A mérés célja A mérés célja az

Részletesebben

Biológiai membránok és membrántranszport

Biológiai membránok és membrántranszport Biológiai membránok és membrántranszport Biológiai membránok A citoplazma membrán funkciói: térrészek elválasztása (egész sejt, organellumok) transzport jelátvitel Milyen a membrán szerkezete? lipidek

Részletesebben

TDK lehetőségek az MTA TTK Enzimológiai Intézetben

TDK lehetőségek az MTA TTK Enzimológiai Intézetben TDK lehetőségek az MTA TTK Enzimológiai Intézetben Vértessy G. Beáta egyetemi tanár TDK mind 1-3 helyezettek OTDK Pro Scientia különdíj 1 második díj Diákjaink Eredményei Zsűri különdíj 2 első díj OTDK

Részletesebben

A sztereoizoméria hatása peptidek térszerkezetére és bioaktivitására OTKA PD Szakmai zárójelentés. Dr. Leitgeb Balázs

A sztereoizoméria hatása peptidek térszerkezetére és bioaktivitására OTKA PD Szakmai zárójelentés. Dr. Leitgeb Balázs A sztereoizoméria hatása peptidek térszerkezetére és bioaktivitására OTKA PD 78554 Szakmai zárójelentés Dr. Leitgeb Balázs A projekt során azt tanulmányoztam, hogy a sztereoizoméria milyen hatásokat fejt

Részletesebben

Szerves kémiai és biokémiai alapok:

Szerves kémiai és biokémiai alapok: Szerves kémiai és biokémiai alapok: Másodlagos kémiai kötések: A másodlagos kötések energiája nagyságrenddel kisebb, mint az elsődlegeseké. Energiaközlés hatására a másodlagos kötések bomlanak fel először,

Részletesebben

Kötések kialakítása - oktett elmélet

Kötések kialakítása - oktett elmélet Kémiai kötések Az elemek és vegyületek halmazai az atomok kapcsolódásával - kémiai kötések kialakításával - jönnek létre szabad atomként csak a nemesgázatomok léteznek elsődleges kémiai kötések Kötések

Részletesebben

Infravörös és CD spektroszkópia a fehérjeszerkezet vizsgálatában

Infravörös és CD spektroszkópia a fehérjeszerkezet vizsgálatában Infravörös és CD spektroszkópia a fehérjeszerkezet vizsgálatában Mi történhet, ha egy mintát fénnyel világítunk meg? megvilágító fény (elnyelt fény) minta átjutott fény Abszorpció UV-VIS, IR, CD spektr.

Részletesebben

Enzimek. Enzimek! IUBMB: szisztematikus nevek. Enzimek jellemzése! acetilkolin-észteráz! legalább 10 nagyságrend gyorsulás. szubsztrát-specificitás

Enzimek. Enzimek! IUBMB: szisztematikus nevek. Enzimek jellemzése! acetilkolin-észteráz! legalább 10 nagyságrend gyorsulás. szubsztrát-specificitás Enzimek acetilkolin-észteráz! Enzimek! [s -1 ] enzim víz carbonic anhydrase 6x10 5 10-9 karbonikus anhidráz acetylcholine esterase 2x10 4 8x10-10 acetilkolin észteráz staphylococcal nuclease 10 2 2x10-14

Részletesebben

térrészek elválasztása transzport jelátvitel Milyen a membrán szerkezete? Milyen a membrán szerkezete? lipid kettısréteg, hidrofil/hidrofób részek

térrészek elválasztása transzport jelátvitel Milyen a membrán szerkezete? Milyen a membrán szerkezete? lipid kettısréteg, hidrofil/hidrofób részek Biológiai membránok A citoplazma membrán funkciói: Biológiai membránok és membrántranszport térrészek elválasztása (egész sejt, organellumok) transzport jelátvitel Milyen a membrán szerkezete? lipidek

Részletesebben

Natív antigének felismerése. B sejt receptorok, immunglobulinok

Natív antigének felismerése. B sejt receptorok, immunglobulinok Natív antigének felismerése B sejt receptorok, immunglobulinok B és T sejt receptorok A B és T sejt receptorok is az immunglobulin fehérje család tagjai A TCR nem ismeri fel az antigéneket, kizárólag az

Részletesebben

Sillabusz orvosi kémia szemináriumokhoz 1. Kémiai kötések

Sillabusz orvosi kémia szemináriumokhoz 1. Kémiai kötések Sillabusz orvosi kémia szemináriumokhoz 1. Kémiai kötések Pécsi Tudományegyetem Általános Orvostudományi Kar 2010-2011. 1 A vegyületekben az atomokat kémiai kötésnek nevezett erők tartják össze. Az elektronok

Részletesebben

1. jelentésük. Nevüket az alkotó szén, hidrogén, oxigén 1 : 2 : 1 arányából hajdan elképzelt képletről [C n (H 2 O) m ] kapták.

1. jelentésük. Nevüket az alkotó szén, hidrogén, oxigén 1 : 2 : 1 arányából hajdan elképzelt képletről [C n (H 2 O) m ] kapták. Összefoglalás II. Szénhidrátok 1. jelentésük Nevüket az alkotó szén, hidrogén, oxigén 1 : 2 : 1 arányából hajdan elképzelt képletről [C n (H 2 O) m ] kapták. Ha ezeket az anyagokat hevítjük vizet vesztenek

Részletesebben

Atomszerkezet. Atommag protonok, neutronok + elektronok. atompályák, alhéjak, héjak, atomtörzs ---- vegyérték elektronok

Atomszerkezet. Atommag protonok, neutronok + elektronok. atompályák, alhéjak, héjak, atomtörzs ---- vegyérték elektronok Atomszerkezet Atommag protonok, neutronok + elektronok izotópok atompályák, alhéjak, héjak, atomtörzs ---- vegyérték elektronok periódusos rendszer csoportjai Periódusos rendszer energia szintek atomokban

Részletesebben

BIOMOLEKULÁK KÉMIÁJA. Novák-Nyitrai-Hazai

BIOMOLEKULÁK KÉMIÁJA. Novák-Nyitrai-Hazai BIOMOLEKULÁK KÉMIÁJA Novák-Nyitrai-Hazai A tankönyv elsısorban szerves kémiai szempontok alapján tárgyalja az élı szervezetek felépítésében és mőködésében kulcsfontosságú szerves vegyületeket. A tárgyalás-

Részletesebben

Prológus helyett polimorfizmus kapcsolodó-mutációk

Prológus helyett polimorfizmus kapcsolodó-mutációk Prológus helyett polimorfizmus kapcsolodó-mutációk egy vesebetegség öröklésének vizsgálata során rámutattak, hogy hogyan okozhatnak gyakori genetikai variánsok ritka betegséget. Jó hír ez, mivel segíthet

Részletesebben

Az NMR spektroszkópia a fehérjék szolgálatában. Bodor Andrea. ELTE Szerkezeti Kémia és Biológia Laboratórium Visegrád

Az NMR spektroszkópia a fehérjék szolgálatában. Bodor Andrea. ELTE Szerkezeti Kémia és Biológia Laboratórium Visegrád Az NMR spektroszkópia a fehérjék szolgálatában Bodor Andrea ELTE Szerkezeti Kémia és Biológia Laboratórium 2011.01.18. Visegrád Nobel díjak tükrében 1952 Fizika: Módszer és elméleti alapok Felix Bloch

Részletesebben

Az elektronpályák feltöltődési sorrendje

Az elektronpályák feltöltődési sorrendje 3. előadás 12-09-17 2 12-09-17 Az elektronpályák feltöltődési sorrendje 3 Az elemek rendszerezése, a periódusos rendszer Elsőként Dimitrij Ivanovics Mengyelejev és Lothar Meyer vette észre az elemek halmazában

Részletesebben

A BIOLÓGIAI JELENSÉGEK FIZIKAI HÁTTERE Zimányi László

A BIOLÓGIAI JELENSÉGEK FIZIKAI HÁTTERE Zimányi László A BIOLÓGIAI JELENSÉGEK FIZIKAI HÁTTERE Zimányi László Összefoglalás A négy alapvető fizikai kölcsönhatás közül az elektromágneses kölcsönhatásnak van fontos szerepe a biológiában. Atomi és molekuláris

Részletesebben

Természetes polimer szerkezeti anyagok: Makromolekulák

Természetes polimer szerkezeti anyagok: Makromolekulák POLIMERTECHNIKA TANSZÉK Dr. Morlin Bálint Dr. Tábi Tamás Természetes polimer szerkezeti anyagok: Makromolekulák 2016. Szeptember 9. Természetes polimer szerkezeti anyagok - Természetes polimer szerkezeti

Részletesebben

2. Ismert térszerkezetű transzmembrán fehérjék adatbázisa: a PDBTM adatbázis. 3. A transzmembrán fehérje topológiai adatbázis, a TOPDB szerver

2. Ismert térszerkezetű transzmembrán fehérjék adatbázisa: a PDBTM adatbázis. 3. A transzmembrán fehérje topológiai adatbázis, a TOPDB szerver A 2005 és 2007 között megvalósított project célja transzmembrán fehérjék vizsgálata és az ehhez szükséges eljárások kifejlesztése volt. Ez utóbbi magába foglalta új adatbázisok és szerkezet becslő módszerek

Részletesebben

Biológiai makromolekulák szerkezete

Biológiai makromolekulák szerkezete Biológiai makromolekulák szerkezete Biomolekuláris nemkovalens kölcsönhatások Elektrosztatikus kölcsönhatások (sóhidak: 4-6 kcal/m, dipól-dipól: ~10-1 kcal/m Diszperziós erők (~10-2 kcal/m) Hidrogén hidak

Részletesebben

A periódusos rendszer, periodikus tulajdonságok

A periódusos rendszer, periodikus tulajdonságok A periódusos rendszer, periodikus tulajdonságok Szalai István ELTE Kémiai Intézet 1/45 Az előadás vázlata ˆ Ismétlés ˆ Történeti áttekintés ˆ Mengyelejev periódusos rendszere ˆ Atomsugár, ionsugár ˆ Ionizációs

Részletesebben

Nanotechnológia. Vonderviszt Ferenc. Veszprémi Egyetem Nanotechnológia Tanszék

Nanotechnológia. Vonderviszt Ferenc. Veszprémi Egyetem Nanotechnológia Tanszék Nanotechnológia Vonderviszt Ferenc Veszprémi Egyetem Nanotechnológia Tanszék Ősi technológiák Mikroelektronika Technológia: képesség az anyag szerkezetének, az anyagot felépítő részecskék elrendeződésének

Részletesebben

Biomolekulák nanomechanikája A biomolekuláris rugalmasság alapjai

Biomolekulák nanomechanikája A biomolekuláris rugalmasság alapjai Fogorvosi Anyagtan Fizikai Alapjai Biomolekulák nanomechanikája A biomolekuláris rugalmasság alapjai Mártonfalvi Zsolt Biofizikai és Sugárbiológiai Intézet Semmelweis Egyetem Budapest Biomolekulák mint

Részletesebben

1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói

1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói 1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói Plazmamembrán Membrán funkciói: sejt integritásának fenntartása állandó hő, energia, és információcsere biztosítása homeosztázis

Részletesebben

MÉRNÖKI ANYAGISMERET AJ002_1 Közlekedésmérnöki BSc szak Csizmazia Ferencné dr. főiskolai docens B 403. Dr. Dogossy Gábor Egyetemi adjunktus B 408

MÉRNÖKI ANYAGISMERET AJ002_1 Közlekedésmérnöki BSc szak Csizmazia Ferencné dr. főiskolai docens B 403. Dr. Dogossy Gábor Egyetemi adjunktus B 408 MÉRNÖKI ANYAGISMERET AJ002_1 Közlekedésmérnöki BSc szak Csizmazia Ferencné dr. főiskolai docens B 403 Dr. Dogossy Gábor Egyetemi adjunktus B 408 Az anyag Az anyagot az ember nyeri ki a természetből és

Részletesebben

A sejtek élete. 5. Robotoló törpék és óriások Az aminosavak és fehérjék R C NH 2. C COOH 5.1. A fehérjeépítőaminosavak általános

A sejtek élete. 5. Robotoló törpék és óriások Az aminosavak és fehérjék R C NH 2. C COOH 5.1. A fehérjeépítőaminosavak általános A sejtek élete 5. Robotoló törpék és óriások Az aminosavak és fehérjék e csak nézd! Milyen protonátmenetes reakcióra képes egy aminosav? R 2 5.1. A fehérjeépítőaminosavak általános képlete 5.2. A legegyszerűbb

Részletesebben

9. Előadás Fehérjék Előzmények Peptidkémia Analitikai kémia Protein kémia 1901 E.Fischer : Gly-Gly 1923 F. Pregl : Mikroanalitika 1952 Stein and Moore : Aminosav analizis 1932 Bergman és Zervas : Benziloxikarbonil

Részletesebben

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Azonosító szám: TÁMOP-4.1.2-08/1/A-2009-0011 Az orvosi

Részletesebben

3. Sejtalkotó molekulák III.

3. Sejtalkotó molekulák III. 3. Sejtalkotó molekulák III. Fehérjék, fehérjeszintézis (transzkripció, transzláció, posztszintetikus módosítások). Enzimműködés 3.1 Fehérjék A genetikai információ egyik fő manifesztálódása Számos funkció

Részletesebben

Fehérjék szerkezetének predikciója, szerkezeti adatok felhasználása adatbázisok segítségével, a számítógépes molekuladinamikai modellezés alapjai

Fehérjék szerkezetének predikciója, szerkezeti adatok felhasználása adatbázisok segítségével, a számítógépes molekuladinamikai modellezés alapjai Fehérjék szerkezetének predikciója, szerkezeti adatok felhasználása adatbázisok segítségével, a számítógépes molekuladinamikai modellezés alapjai Hegedűs Tamás tamas@hegelab.org MTA-SE Molekuláris Biofizikai

Részletesebben

Anyagszerkezet és vizsgálat

Anyagszerkezet és vizsgálat SZÉCHENYI ISTVÁN EGYETEM Anyagtudományi és Technológiai Tanszék Anyagszerkezet és vizsgálat NGB_AJ021_1 Dr. Hargitai Hajnalka hargitai@sze.hu www.sze.hu/~hargitai B 403. (L316) (Csizmazia Ferencné dr.

Részletesebben

Anyagszerkezet és vizsgálat Fémtan, anyagvizsgálat

Anyagszerkezet és vizsgálat Fémtan, anyagvizsgálat SZÉCHENYI ISTVÁN EGYETEM Anyagtudományi és Technológiai Tanszék Anyagszerkezet és vizsgálat Fémtan, anyagvizsgálat Dr. Hargitai Hajnalka hargitai@sze.hu www.sze.hu/~hargitai B 403. (L316) (Csizmazia Ferencné

Részletesebben

MULTICELLULÁRIS SZERVEZŐDÉS: SEJT-SEJT (SEJT-MÁTRIX) KÖLCSÖNHATÁSOK 1. Bevezetés (2.)Extracelluláris mátrix (ECM) (Kollagén, hialuron sav,

MULTICELLULÁRIS SZERVEZŐDÉS: SEJT-SEJT (SEJT-MÁTRIX) KÖLCSÖNHATÁSOK 1. Bevezetés (2.)Extracelluláris mátrix (ECM) (Kollagén, hialuron sav, MULTICELLULÁRIS SZERVEZŐDÉS: SEJT-SEJT (SEJT-MÁTRIX) KÖLCSÖNHATÁSOK 1. Bevezetés (2.)Extracelluláris mátrix (ECM) (Kollagén, hialuron sav, proteoglikánok) (3.)Multiadhéziós fehérjék és sejtfelszíni receptorok

Részletesebben

Kémiai kötések. Kémiai kötések. A bemutatót összeállította: Fogarasi József, Petrik Lajos SZKI, 2011

Kémiai kötések. Kémiai kötések. A bemutatót összeállította: Fogarasi József, Petrik Lajos SZKI, 2011 Kémiai kötések A bemutatót összeállította: Fogarasi József, Petrik Lajos SZKI, 2011 1 Cl + Na Az ionos kötés 1. Cl + - + Na Klór: 1s 2 2s 2 2p 6 3s 2 3p 5 Kloridion: 1s2 2s2 2p6 3s2 3p6 Nátrium: 1s 2 2s

Részletesebben

Csermely Péter. Stresszfehérjék. Sejtjeink ősi védekező mechanizmusa. Vince Kiadó

Csermely Péter. Stresszfehérjék. Sejtjeink ősi védekező mechanizmusa. Vince Kiadó Csermely Péter Stresszfehérjék Sejtjeink ősi védekező mechanizmusa Vince Kiadó 3 A TUDOMÁNY-EGYETEM sorozat főszerkesztője: Glatz Ferenc akadémikus A Természettudomány alsorozat szerkesztője: Staar Gyula

Részletesebben

A rácsmodell. Szabadenergia felületek.

A rácsmodell. Szabadenergia felületek. 1. A spinüveg modell 2. A rácsmodellek típusai 3. A rácsmodellek elõnyei és hátrányai 4. A rácsmodellek elemzése 5. Egyszerû rácsmodellek 6. Rácsmodellek natív állapotai 7. Oldalláncok 8. Rácsmodellek

Részletesebben

A tárgy címe: Bioinformatika

A tárgy címe: Bioinformatika A tárgy címe: Bioinformatika Kötelezően választható tárgy IV. és V. évfolyamos biológus hallgatók számára; heti 2+3 óra Előkövetelmény: Biokémia főkollégium; genetika főkollégium; alapszintű számítógépes

Részletesebben

Szerkezet és tulajdonságok

Szerkezet és tulajdonságok Szerkezet és tulajdonságok Bevezetés Molekulaszerkezet és tulajdonságok Kristályos polimerek a kristályosodás feltétele, szabályos lánc kristályos szerkezet kristályosodás, gócképződés kristályosodás,

Részletesebben

Béta-redők stabilitásvizsgálata párkorrelációk statisztikai és kvantumkémiai modellezésével

Béta-redők stabilitásvizsgálata párkorrelációk statisztikai és kvantumkémiai modellezésével Tudományos Diákköri Dolgozat KOVÁCS BERTALAN Béta-redők stabilitásvizsgálata párkorrelációk statisztikai és kvantumkémiai modellezésével Dr. Jákli Imre, tudományos főmunkatárs Dr. Perczel András, egyetemi

Részletesebben

Fehérjék szerkezetének predikciója, szerkezeti adatok felhasználása adatbázisok segítségével, a számítógépes molekuladinamikai modellezés alapjai

Fehérjék szerkezetének predikciója, szerkezeti adatok felhasználása adatbázisok segítségével, a számítógépes molekuladinamikai modellezés alapjai Fehérjék szerkezetének predikciója, szerkezeti adatok felhasználása adatbázisok segítségével, a számítógépes molekuladinamikai modellezés alapjai Hegedűs Tamás tamas@hegelab.org MTA-SE Membránbiológiai

Részletesebben

Ö Á Í Í ű ű ú ű ű ű ű ú ú ú ú ű ű ű ű ű ű ű ű ű ú ű ú ú ú ű ú Á ú ű ű Ó ú ű ű ű ú Ó ú ű ú É ú ú ú ű ű ú ű ú Ú Á ú É ú Ó ú ú ú ú ű ű ű ú É Á É É ű ű Í ú ú Ó Í ű Í ű ű ú ű ű ű É ű ú Á ű ű ú Í ű Á ű ú ú É

Részletesebben

ö ö ö ö ö ö ö ű ű ö ö ö ö ö Ő ö Ó Ú ö Ö ö ö ö ö Ö Ő ö ö Í Ó Ó Ő ö ö ö ö ö Ő Ő Ó Ő É ö Ú ö ö Ő ö ö ö ö ö ö ö Ő ö Ő É ö Ő ö ö Ő ö ö ö Ó ű ö ö ö Ő ö ö ö Í Ő Ó Í ö ö ö ö Ő Ő Ő Ő Í Ó Ő Ő Í Ő ö ö ö ö ö Ő Ő ö

Részletesebben

Ú ű ü ü Ü ű É É Ö Ö Á ü ü ü ű É ú Á Ö Ü ü ü ű É Á É Ű ű Ü Ü ű ü ű ü ű ü Ü ü ü Ű Á Á Á ű ú ű Á Ó Ó É Á Ó Á Ó ű ü ü ű ű ü ú ú ü ü ü ű ü ű Ü ű ü ü ú ü Ö ü ú ú ü ü ü ü ű ú ü Ó ü Ó Ó ü ü Ó ü ü Ó ű ű ú ű ű ü

Részletesebben

Bár az elő szervezetek 70 95%-a víz, a többi elsősorban szénalapú vegyületekből áll

Bár az elő szervezetek 70 95%-a víz, a többi elsősorban szénalapú vegyületekből áll Szén a szerves molekulák alapja Bár az elő szervezetek 70 95%-a víz, a többi elsősorban szénalapú vegyületekből áll A szén példátlan képessége, hogy nagyméretű, komplex, különböző molekulákat képes kialakítani

Részletesebben

Fehérjebiotechnológia

Fehérjebiotechnológia Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Fehérjebiotechnológia Emri Tamás Csősz Éva Tőzsér József

Részletesebben

Aminosavak, peptidek, fehérjék

Aminosavak, peptidek, fehérjék Aminosavak, peptidek, fehérjék Aminosavak NH 2, NH, N, N C Amino- és karboxilcsoport egy molekulában. H Csoportosítás - az amin rendűsége szerint (első, másod, harmad, negyedrendű) - az amino- és karboxil-csoportok

Részletesebben

Aminosavak, peptidek, fehérjék. Béres Csilla

Aminosavak, peptidek, fehérjék. Béres Csilla Aminosavak, peptidek, fehérjék Béres Csilla Aminosavak Az aminosavak (más néven aminokarbonsavak) olyan szerves vegyületek, amelyek molekulájában aminocsoport (- NH 2 ) és karboxilcsoport (-COOH) egyaránt

Részletesebben

Aminosavak általános képlete NH 2. Csoportosítás: R oldallánc szerkezete alapján: Semleges. Esszenciális aminosavak

Aminosavak általános képlete NH 2. Csoportosítás: R oldallánc szerkezete alapján: Semleges. Esszenciális aminosavak Aminosavak 1 Aminosavak általános képlete N 2 soportosítás: oldallánc szerkezete alapján: Apoláris Poláris Bázikus Savas Semleges Esszenciális aminosavak 2 (apoláris) Glicin Név Gly 3 Alanin Ala 3 3 Valin

Részletesebben

Cikloalkánok és származékaik konformációja

Cikloalkánok és származékaik konformációja 1 ikloalkánok és származékaik konformációja telített gyűrűs szénhidrogének legegyszerűbb képviselője a ciklopropán. Gyűrűje szabályos háromszög alakú, ennek megfelelően szénatomjai egy síkban helyezkednek

Részletesebben

HŐ (q) és MUNKA (w): energia átmenet közben a rendszer és környezete között. A különböző energiafajták átalakulásukkor végső soron termikus energiává

HŐ (q) és MUNKA (w): energia átmenet közben a rendszer és környezete között. A különböző energiafajták átalakulásukkor végső soron termikus energiává TERMODINAMIKA 1 HŐ (q) és MUNKA (w): energia átmenet közben a rendszer és környezete között. A különböző energiafajták átalakulásukkor végső soron termikus energiává degradálódnak (disszipáció). BELSŐ

Részletesebben

Bioinformatika 2 5.. előad

Bioinformatika 2 5.. előad 5.. előad adás Prof. Poppe László BME Szerves Kémia és Technológia Tsz. Bioinformatika proteomika Előadás és gyakorlat 2009. 03. 21. Fehérje térszerkezet t megjelenítése A fehérjék meglehetősen összetett

Részletesebben

CD-spektroszkópia. Az ORD spektroskópia alapja

CD-spektroszkópia. Az ORD spektroskópia alapja CD-spektroszkópia Az ORD spektroskópia alapja - A XIX. század elején Biot megfigyelte, hogy bizonyos, a természetben előforduló szerves anyagok a lineárisan polarizált fény síkját elforgatják. - 1817-ben

Részletesebben

A sejtek közötti kommunikáció módjai és mechanizmusa. kommunikáció a szomszédos vagy a távoli sejtek között intracellulári jelátviteli folyamatok

A sejtek közötti kommunikáció módjai és mechanizmusa. kommunikáció a szomszédos vagy a távoli sejtek között intracellulári jelátviteli folyamatok A sejtek közötti kommunikáció módjai és mechanizmusa kommunikáció a szomszédos vagy a távoli sejtek között intracellulári jelátviteli folyamatok A kommunikáció módjai szomszédos sejtek esetén autokrin

Részletesebben

Fehérje szintézis 2. TRANSZLÁCIÓ Molekuláris biológia kurzus 7. hét. Kun Lídia Genetikai, Sejt- és immunbiológiai Intézet

Fehérje szintézis 2. TRANSZLÁCIÓ Molekuláris biológia kurzus 7. hét. Kun Lídia Genetikai, Sejt- és immunbiológiai Intézet Fehérje szintézis 2. TRANSZLÁCIÓ Molekuláris biológia kurzus 7. hét Kun Lídia Genetikai, Sejt- és immunbiológiai Intézet Gén mrns Fehérje Transzkripció Transzláció A transzkriptum : mrns Hogyan mutatható

Részletesebben

Szakdolgozat. Lakatos Dóra Fizika BSc., biofizikus szakirány III. évfolyam

Szakdolgozat. Lakatos Dóra Fizika BSc., biofizikus szakirány III. évfolyam Szakdolgozat Fehérjeaggregátumok előállítása és vizsgálata Lakatos Dóra Fizika BSc., biofizikus szakirány III. évfolyam Témavezető: Dr. Smeller László Semmelweis Egyetem, Biofizikai és Sugárbiológiai Intézet

Részletesebben

Immunológia alapjai előadás MHC. szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás.

Immunológia alapjai előadás MHC. szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás. Immunológia alapjai 5-6. előadás MHC szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás. Antigén felismerés Az ellenanyagok és a B sejt receptorok natív formában

Részletesebben

Atomi, illetve molekuláris kölcsönhatások és alkalmazásaik

Atomi, illetve molekuláris kölcsönhatások és alkalmazásaik Atomi, illetve molekuláris kölcsönhatások és alkalmazásaik Bozó Tamás 2012. október 16. Atomi kölcsönhatások Nemesgázok: atomi előfordulás (He, Ne, Ar, Kr, Xe, Rn) Többi elem: molekulákat alkot (pl. H

Részletesebben

hosszú szénláncú, telített vagy telítetlen karbonsavak palmitinsav (hexadekánsav) olajsav (cisz-9 oktadecénsav) néhány, állatokban előforduló zsírsav

hosszú szénláncú, telített vagy telítetlen karbonsavak palmitinsav (hexadekánsav) olajsav (cisz-9 oktadecénsav) néhány, állatokban előforduló zsírsav Lipidek: zsírsavak hosszú szénláncú, telített vagy telítetlen karbonsavak palmitinsav (hexadekánsav) sztearinsav (oktadekánsav) olajsav (cisz-9 oktadecénsav) Szénatomszám Kettős kötések száma néhány, állatokban

Részletesebben

Röntgendiffrakciós szerkezetvizsgálat. A szerkezetmegoldás menete Lehetőségek és korlátok Alkalmazások

Röntgendiffrakciós szerkezetvizsgálat. A szerkezetmegoldás menete Lehetőségek és korlátok Alkalmazások Röntgendiffrakciós szerkezetvizsgálat A szerkezetmegoldás menete Lehetőségek és korlátok Alkalmazások A krisztallográfia alapjai Diffrakció: a sugárzás rugalmas kölcsönhatása az anyaggal Röntgendiffrakció

Részletesebben

NMR a peptid- és fehérje-kutatásban

NMR a peptid- és fehérje-kutatásban NMR a peptid- és fehérje-kutatásban A PDB adatbázisban megtalálható NMR alapú fehérjeszerkezetek számának alakulása az elmúlt évek során 4000 3500 3000 2500 2000 1500 1000 500 0 1987 1988 1989 1990 1991

Részletesebben

Vezikuláris transzport

Vezikuláris transzport Molekuláris Sejtbiológia Vezikuláris transzport Dr. habil KŐHIDAI László Semmelweis Egyetem, Genetikai, Sejt- és Immunbiológiai Intézet 2005. november 3. Intracelluláris vezikul uláris transzport Kommunikáció

Részletesebben