Szerkesztette: Vizkievicz András

Save this PDF as:
 WORD  PNG  TXT  JPG

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "Szerkesztette: Vizkievicz András"

Átírás

1 Fehérjék A fehérjék - proteinek - az élő szervezetek számára a legfontosabb vegyületek. Az élet bármilyen megnyilvánulási formája fehérjékkel kapcsolatos. A sejtek szárazanyagának minimum 50 %-át adják. Szerkesztette: Vizkievicz András Csoportosításuk biológiai feladataik alapján történik, lehetnek: szerkezeti fehérjék: tartó, szilárdító feladatokat látnak el, pl. a kollagén szinte mindenütt, keratin a hajban, összehúzékony fehérjék: ilyen az aktin, miozin, pl. az izmokban, transzportfehérjék: szállító feladatokat látnak el, pl. a hemoglobin oxigént szállít, védőfehérjék: fertőzésekkel szembeni védekezésben közreműködnek, pl. immunoglobulinok, hormonok: kémiai jelek, szervek, szövetek működését befolyásolják, pl. inzulin, enzimek: biokatalizátorok, a sejtekben zajló kémiai folyamatok aktiválási energiáját csökkentik, aminek következtében az átalakulások reakciósebessége megnő. Az emberi szervezet működési körülményei között, katalizátorok nélkül az életfolyamatok végtelen lassú sebességgel zajlanának. A szerves anyagok zöme 37 fokon gyakorlatilag nem bomlik le katalizátorok nélkül. Az aminosavak A fehérjék makromolekulák, monomerjeiket aminosavaknak nevezzük. Az aminosavaknak alapvetően két csoportjuk van: nem fehérjeeredetű, fehérjeeredetű aminosavak. A nem fehérjeeredetű aminosavak nem vesznek részt a fehérjék felépítésében, hanem az anyagcserében fontos előanyagként vagy köztes termékként szerepelnek, ill. egyéb feladatokat láthatnak el. Legalább 150 típusuk van, ilyen pl. gamma-amino-vajsav, amely fontos ingerület átvivő vegyület, az ornitin, citrullin, amelyek az emlősök nitrogénürítésének folyamatában keletkeznek (urea ciklus) A fehérjeeredetű aminosavak szabad állapotban csak kis mennyiségben találhatók meg a sejtekben, főleg fehérjék felépítésében vesznek részt. Kémiailag amino-karbonsavak, azaz a molekulában két eltérő jellegű funkciós csoport is megtalálható: bázisos aminocsoport, savas karboxilcsoport. E kettős jelleg sajátos tulajdonságokat ikerionos szerkezet, amfoter jelleg - kölcsönöz az aminosavaknak. 1

2 Minden aminosav egy azonos, és egy eltérő molekula részletből áll: az azonos rész tartalmazza az amino-, és a karboxilcsoportokat, az eltérő rész az ún. oldallánc, amely szerkezetileg 20 féle lehet. Az aminosavakat az eltérő oldallánc alapján 4 nagy csoportba osztjuk: 1. Apoláris oldalláncú aminosavak. glicin (Gly) -H alanin (Ala) -CH3 2. Poláris oldalláncú aminosavak szerin (Ser) -CH2OH cisztein (Cys) -CH2SH 3. Savas oldalláncú aminosavak asparaginsav (Asp) -CH2COOH glutaminsav (Glu) -CH2CH2COOH 4. Bázisos oldalláncú aminosavak Lizin (Lys) -CH2CH2CH2CH2NH2 2

3 A fehérjeeredetű aminosavak ún. alfa aminosavak, mivel a bázisos aminocsoport a karboxilcsoport melletti, ún. alfa szénatomhoz kapcsolódik. Ismertek béta-, ill. gamma aminosavak is, mint pl. a gammaamino-vajsav (GABA). Az aminosavak királis vegyületek, mivel az alfa C-atomhoz - a glicin kivételével - 4 különböző ligandum kapcsolódik. A természetben mindenhol - a baktériumok sejtfal anyagát a mureint kivéve - az aminosavaknak a balra forgató L (laevus= bal, lat.) izomerje (enantiomerje) fordul elő. Az aminosavak tulajdonságai Az aminosavak jellegzetes tulajdonságai különös szerkezetükre vezethetők vissza, amelyet döntően a jelenlévő funkciós csoportok határoznak meg. Szerkezet Az élő sejtek citoplazmájának megfelelő ph értéken - kb a molekulában megtalálható két ellentétes funkciós csoport egyaránt megnyilvánul: a bázisos -NH2 csoport H + -t felvéve (+) töltésűvé, a savas COOH csoport H + -t leadva (-) töltésűvé alakul. Ennek eredményeképpen a molekulában egyszerre van jelen a két ellentétes töltés. Az ilyen képződményeket ikerionnak nevezzük. A fizikai tulajdonságaik ionrácsos szerkezetükre vezethetők vissza: magas olvadáspontú, szilárd vegyületek, vízben általában jól oldódnak, vizes oldatuk az áramot jól vezeti. Kémiai tulajdonságok Amfoter vegyületek, azonban sav-bázis sajátságaikat az oldallánc kémiai természete is befolyásolja. Biológiai szempontból legfontosabb reakciójuk a kondenzáció, melynek során az egyik aminosav aminocsoportja, és a másik aminosav karboxil csoportja között víz kilépéssel, ún. peptidkötés jön létre. 3

4 A reakció eredményeként a két aminosavat egy amidcsoport köti össze. 2,3,4 aminosav összekapcsolódásakor di-, tri-, tetrapeptidek jönnek létre, néhány 10 aminosav összekapcsolódásakor oligopeptidek jönnek létre, néhány 100 aminosav összekapcsolódásakor polipeptidek jönnek létre, néhány 1000 aminosav összekapcsolódásakor fehérjék jönnek létre. Az aminosavak összekapcsolódásából kialakuló polipeptidlánc: mindig elágazásmentes, C-atomokon keresztül összekapcsolódott amidcsoportok láncolata, a lánc -NH2 csoportot viselő része az N-terminális, a -COOH csoportot hordozó része a C-terminális, a lánc aminosavsorrendjének felírásánál a felsorolást mindig az N-terminálisnál kezdjük a jobb oldalon, az aminosavsorrend felírásánál az aminosavak nemzetközi rövidítését használjuk: Gly- Ala-Ser-Cys-..., a polipeptidlánc aminosavsorrendjét szekvenciának nevezzük. Szekvencia 2 aminosav kétféleképpen kapcsolódhat egymáshoz, attól függően, hogy melyik helyezkedik el az N-terminálison. 3 aminosavat már 6 féle sorrendben kapcsolhatunk össze. 100 db- 20 féle- aminosavból már féle polipeptid alkotható. A szekvencia döntően meghatározza a fehérjék tulajdonságait, ezért az aminosavsorrendet a fehérjék elsődleges szerkezetének nevezzük. Akár egyetlen aminosav helyének megváltoztatása az egész fehérje működésére hatással lehet. Sarlósejtes vérszegénység A rendellenesség nevét onnan kapta, hogy a betegek vérében - az egyébként korong alakú - vörösvértestek sarló formájúak. A hibás vörösvértesteket az immunrendszer folyamatosan eltávolítja, aminek következtében csökken a vörösvértest szám (vérszegénység). 4

5 A betegség oka az, hogy a vörösvértesteket kitöltő hemoglobin egyik polipeptidláncában az egyik aminosav kicserélődik egy másikra (az egyik béta-láncban a 6. helyen levő Glu helyet Val található). Ennek következtében a hemoglobin oldékonysága megszűnik, kikristályosodik, megváltozik a sejt alakja és oxigénszállítása jelentősen romlik. Genetikai betegség. A polipeptidek térszerkezete, konformáció A polipeptidlánc C-atomokon keresztül kapcsolódó amidcsoportok láncolata. Az amidcsoportok szerkezete merev, sík alakú. Elmozdulás csak az amidsíkokat összekapcsoló C-atomok mentén lehetséges. Az elmozdulási pontokon az amidsíkok egymáshoz képest különféle szögben elcsavarodhatnak. Az elcsavarodás mértékét tekintve elvileg végtelen sok konformációs izomer vezethető le, azonban a természetben csak két stabil forma létezik: alfa-hélix, béta-szalag. Béta-szalag (redő) A béta-konformációban az amidsíkok összetolt háztetőkhöz hasonló felületet hoznak létre. A szerkezet azáltal stabilizálódik, hogy a láncok egymás mellé rendeződnek és az amidcsoportok között H-kötés alakul ki. Alfa-hélix Az alfa-hélixben a polipeptidlánc csavarvonalszerűen tekeredik. A spirál szerkezetét a láncon belül az amidcsoportok között kialakuló H-kötések stabilizálják, amelyek a közel függőlegesen és egymással párhuzamosan elhelyezkedő C=O és NH csoportok között jönnek létre. Az alfa-hélix a polipeptidlánc legkedvezőbb konformációja. Egy menetre kb. 3.6 aminosavrész jut. Az L-aminosavakból felépülő alfahélix jobb csavarodású. A polipeptidlánc konformációját - alfa-hélix vagy bétaszalag - a fehérjék másodlagos szerkezetének nevezzük. A másodlagos szerkezetet alapvetően az aminosavak minősége és sorrendje határozza meg. 5

6 Fibrilláris fehérjék Azokat a fehérjéket, amelyek végig azonos másodlagos szerkezettel jellemezhetők - végig alfa-hélix vagy béta-szalag -, fibrilláris fehérjéknek nevezzük. A fibrilláris fehérjék hosszú, elnyúlt, szálas szerkezetűek, igen stabilak, vízben nem oldódnak. Fibrilláris fehérje pl.: fibroin: a selyem fehérjéje, keratin: a haj fehérjéje. A fibroin A fibroin a selyemhernyó bebábozódásakor a lárva által termelt fehérje. Másodlagos szerkezete béta-szalag. Mindössze 3 féle aminosav építi fel, Gly, Ala, Ser 3:2:1 arányban (Gly- Ala-Gly-Ala-Gly-Ser)n. A selyemszál az egyes béta-szalagok további rendeződésével jön létre: A polipeptidláncok erős H-kötésekkel összekapcsolódva, párhuzamosan rendeződve, rétegekké állnak össze. Az rétegek egymás alá és fölé rendeződve az oldalláncok között fellépő másodrendű kötéssekkel kapcsolódnak össze. A keratin Az elszarusodó hámszövetekben termelődő szerkezeti fehérje. Fő összetevője a szőrnek, hajnak, tollnak, szarupikkelynek. Szekunder szerkezete alfa-hélix. Felépítésében az összes aminosav részt vesz. A hajszál az egyes alfa-hélixek további rendeződésével jön létre. A hajszál rendkívül erős, ami annak köszönhető, hogy az egyes molekulák különböző erősségű kötésekkel összekapcsolódnak. Az egyik jelentős kötés a cisztein oldalláncok között kialakuló diszulfid-híd. A diszulfid-hidak felbontásával, a mikrofilamentumok elcsúszásával, majd újra a szálak összekapcsolódásával magyarázható a dauerolás. A fibrilláris fehérjék közé tartozik még: a kollagén, a miozin, és a fibrin. A globuláris fehérjék A fehérjék harmadlagos szerkezetét a polipeptidlánc további térbeli elrendeződése határozza meg. A globuláris fehérjékben a polipeptidlánc konformációja szakaszonként váltakozik, ezért a molekula egésze gömb alakú. Az eltérő konformációjú részeket ún. rendezetlen szakaszok kapcsolják össze, ahol az alfa-hélix és a béta-szalag közötti átmeneti konformáció alakul ki. A harmadlagos szerkezet stabilitását különféle kötések biztosítják: hidrogén-kötés, pl. a szerin oldalláncok között, van der Waals kötés, pl. az apoláris alanin oldalláncok között, ionos kötés, pl. a savas glutaminsav és a bázisos lizin között található, kovalens kötés, pl. ilyen két cisztein közötti diszulfid-híd. 6

7 Az egyes másodlagos szerkezettel rendelkező szakaszok egymáshoz viszonyított térbeli helyzete tehát a harmadlagos szerkezettel jellemezhető. A globuláris fehérjék jól oldódnak vízben, kolloid állapotot hozva létre. Ez annak köszönhető, hogy a poláris, hidrofil oldalláncok a gombolyag felületén, míg az apoláris hidrofób oldalláncok a molekula közepén helyezkednek el. A felszínen levő hidrofil aminosav részek jól hidratálódnak, az apoláris részek egy hidrofób belső magot hoznak létre. A belső hidrofób mag, ill. a külső hidrátburok nagymértékben hozzájárul a fehérjék stabilitásához. Ugyanakkor nagyon fontos tény, hogy a fehérjék térszerkezete rendkívül bonyolult, ebből következően igen érzékenyen válaszol térszerkezetének megváltozásával a környezet hatásaira. A fehérjék harmadlagos szerkezetét befolyásoló környezeti tényezők: A hőmérséklet, könnyűfémsó koncentráció, a közeg hidrogénion koncentrációja, a nehézfémsók. A hőmérséklet emelésekor a molekularészek hőmozgása egyre intenzívebb lesz, aminek következtében az oldalláncok közötti stabilizáló kötések felszakadnak. A változás hatására a molekula elveszti jellegzetes térszerkezetét, letekeredik, azaz denaturálódik. A letekeredett láncok összeakadva térhálót alkotnak, melynek hézagaiban vízmolekulák helyezkednek el. A rendszer kolloid állapota megszűnik, durva diszperz rendszerré alakul, azaz a fehérjék kicsapódnak, koagulálnak. A folyamat visszafordíthatatlan, azaz irreverzibilis. (Kisméretű peptidek esetén lehet reverzibilis.) Irreverzibilis denaturáció zajlik le tojás főzéskor is, minek hatására a molekulák véglegesen elvesztik harmadlagos szerkezetüket, biológiai aktivitásuk megszűnik. Az élő sejtek ph-ja 7.1 körül van, a sejtekben a fehérjék működése, szerkezete ekkor optimális. Amennyiben változik a ph - azaz megváltozik a H+-ion koncentráció -, a bevitt ionok hatására megváltoznak a fehérjemolekulák töltésviszonyai. Az aminosav oldalláncok töltésének megváltozásakor a molekulát stabilizáló kötések felszakadnak, a molekula gombolyag letekeredik, a fehérje irreverzibilisen denaturálódik. 7

8 A nehézfémsók - pl. Pb, Hg, - hatására a fehérjék irreverzibilisen denaturálódnak. A nehézfém ionok hozzákapcsolódnak a polipeptidlánchoz, felszakítják a láncot stabilizáló kötéseket. A könnyűfémsók koncentrációjának emelésekor az oldatba kerülő ionok hidratálódnak és nagy koncentrációjuk esetén saját hidrátburkuk kialakításához a vízmolekulákat a fehérjék hidrátburkából vonják el. A fehérjemolekulák, mivel hidrátburkukat elvesztik, összecsapódnak, azaz koagulálnak. Kiválva az oldatból megszűnik a kolloid állapotuk. A folyamat reverzibilis, azaz megfordítható, mivel ha a kicsapódott fehérjékhez feleslegben vizet adunk, a molekulák hidrátburka helyreáll, ismét kolloid állapotba kerülnek. A folyamatot kisózásnak is nevezzük, amely pl. (NH4)2SO4 hatására következhet be. Ismertek olyan fehérjék, amelyek nem egy, hanem több polipeptidláncból épülnek fel. Ilyen fehérje pl. a hemoglobin. A fehérjét felépítő egyes polipeptidláncokat alegységnek nevezzük. Az alegységek egymáshoz viszonyított térbeli helyzetét a negyedleges szerkezettel jellemezzük. Pl. a hemoglobin négy alegysége egy tetraéder 4 csúcsának megfelelően helyezkedik el, melyeket másodrendű kötések tartanak egybe. A fehérjék kimutatási reakciói Biuret-próba, xantoprotein reakció. A Biuret-próbával a fehérjékben jelenlévő amidcsoportot lehet kimutatni. Pozitív próba esetén ibolya színeződést tapasztalunk, mivel a reagensben található réz-ionok komplexet képeznek az amidcsoporttal. Egy kevés fehérje oldathoz adjunk néhány csepp 40%-os nátrium-hidroxid oldatot, majd 1-2 csepp réz II-szulfát reagenst. A xantoprotein reakcióval a fehérjékben jelenlévő, aromás oldalláncot tartalmazó - fenilalanin, tirozin, triptofán - aminosavakat lehet kimutatni. A reakció lényege, hogy tömény salétromsav hatására az aromás benzolgyűrű nitrálódik és sárga színű nitrovegyületek jönnek létre. Pozitív próba esetén sárga színeződést tapasztalunk. Kevés fehérje oldathoz óvatosan adjunk 1 csepp cc. salétromsavat, majd enyhén melegítsük

9 A fehérjék csoportosítása összetételük szerint történik. 1. Proteidek vagy összetett fehérjék Nem fehérje természetű, ún. prosztetikus csoportot is tartalmaznak: glükoproteidek: prosztetikus csoportjuk szénhidrát, o mucin a nyálban, o globulinok a vérben, lipoproteidek: prosztetikus csoportjuk lipid, o sejthártya fehérjéi, nukleoproteidek: prosztetikus csoportjuk nukleinsav, o hisztonok, foszfoproteidek: prosztetikus csoportjuk foszforsav, o kazein, a tej fehérjéje, metalloproteidek: prosztetikus csoportjuk fémion, o hemoglobin, o citokrómok, kromoproteidek: prosztetikus csoportjuk valamilyen színanyag, o opszin a retinában a retinallal. Hemoglobin 2. Proteinek vagy egyszerű fehérjék. Csak aminosavakból állnak: albuminok a vérben, kollagén, inzulin, stb. 9

10 Összefoglalás, ami az emelt szintű érettségihez mindenképpen szükséges A fehérjék csoportosítása biológiai feladataik alapján történik, lehetnek: szerkezeti fehérjék: tartó, szilárdító feladatokat látnak el, pl. a kollagén szinte mindenütt, keratin a hajban, összehúzékony fehérjék: ilyen az aktin, miozin, pl. az izmokban, transzportfehérjék: szállító feladatokat látnak el, pl. a hemoglobin oxigént szállít, védőfehérjék: fertőzésekkel szembeni védekezésben közreműködnek, pl. immunoglobulinok, hormonok: kémiai jelek, szervek, szövetek működését befolyásolják, pl. inzulin, enzimek: biokatalizátorok, a sejtekben zajló kémiai folyamatok aktiválási energiáját csökkentik, aminek következtében az átalakulások reakciósebessége megnő. Az emberi szervezet működési körülményei között, katalizátorok nélkül az életfolyamatok végtelen lassú sebességgel zajlanának. A szerves anyagok zöme 37 fokon gyakorlatilag nem bomlik le katalizátorok nélkül. Az aminosavak A fehérjék makromolekulák, monomerjeiket fehérjeeredetű aminosavaknak nevezzük. A fehérjeeredetű aminosavak szabad állapotban csak kis mennyiségben találhatók meg a sejtekben, főleg fehérjék felépítésében vesznek részt. Kémiailag amino-karbonsavak, azaz a molekulában két eltérő jellegű funkciós csoport is megtalálható: bázisos aminocsoport, savas karboxilcsoport. Minden aminosav egy azonos, és egy eltérő molekula részletből áll: az azonos rész tartalmazza az amino-, és a karboxilcsoportokat, az eltérő rész az ún. oldallánc, amely szerkezetileg 20 (21) féle lehet. A fehérjeeredetű aminosavak ún. alfa aminosavak, mivel a bázisos aminocsoport a karboxilcsoport melletti, ún. alfa szénatomhoz kapcsolódik. Az aminosavak tulajdonságai Szerkezet Az élő sejtek citoplazmájának megfelelő ph értéken - kb a molekulában megtalálható két ellentétes funkciós csoport egyaránt megnyilvánul: a bázisos -NH2 csoport H + -t felvéve (+) töltésűvé, a savas COOH csoport H + -t leadva (-) töltésűvé alakul. Ennek eredményeképpen a molekulában egyszerre van jelen a két ellentétes töltés. Az ilyen képződményeket ikerionnak nevezzük. Kémiai tulajdonságok Amfoter vegyületek, azonban sav-bázis sajátságaikat az oldallánc kémiai természete is befolyásolja. 10

11 Biológiai szempontból legfontosabb reakciójuk a kondenzáció, melynek során az egyik aminosav aminocsoportja, és a másik aminosav karboxil csoportja között víz kilépéssel, ún. peptidkötés jön létre. Az aminosavak összekapcsolódásából kialakuló polipeptidlánc: mindig elágazásmentes, C-atomokon keresztül összekapcsolódott amidcsoportok láncolata, a lánc -NH2 csoportot viselő része az N-terminális, a -COOH csoportot hordozó része a C-terminális. Szekvencia, aminosavsorrend A szekvencia döntően meghatározza a fehérjék tulajdonságait, ezért az aminosavsorrendet a fehérjék elsődleges szerkezetének nevezzük. Akár egyetlen aminosav helyének megváltoztatása az egész fehérje működésére hatással lehet. Sarlósejtes vérszegénység A rendellenesség nevét onnan kapta, hogy a betegek vérében - az egyébként korong alakú - vörösvértestek sarló formájúak. A hibás vörösvértesteket az immunrendszer folyamatosan eltávolítja, aminek következtében csökken a vörösvértest szám (vérszegénység). A betegség oka az, hogy a vörösvértesteket kitöltő hemoglobin egyik polipeptidláncában az egyik aminosav kicserélődik egy másikra. Ennek következtében a hemoglobin oldékonysága megszűnik, kikristályosodik, megváltozik a sejt alakja és oxigénszállítása jelentősen romlik. Genetikai betegség. A polipeptidek térszerkezete, konformáció A természetben a polipepetidlánc szerkezetét tekintve két stabil forma létezik: alfa-hélix, béta-szalag. Béta-szalag (redő) A béta-konformációban a polipeptidlánc összetolt háztetőkhöz hasonló szerkezetet hoz létre. A szerkezet azáltal stabilizálódik, hogy a láncok egymás mellé rendeződnek és a peptidkötések között H-kötés alakul ki. Alfa-hélix Az alfa-hélixben a polipeptidlánc csavarvonalszerűen tekeredik. A spirál szerkezetét a láncon belül a peptid-kötések között kialakuló H-kötések stabilizálják. A polipeptidlánc konformációját - alfa-hélix vagy béta-szalag - a fehérjék másodlagos szerkezetének nevezzük. A másodlagos szerkezetet alapvetően az aminosavak minősége és sorrendje határozza meg. 11

12 Fibrilláris fehérjék Azokat a fehérjéket, amelyek végig azonos másodlagos szerkezettel jellemezhetők - végig alfa-hélix vagy béta-szalag -, fibrilláris fehérjéknek nevezzük. A fibrilláris fehérjék hosszú, elnyúlt, szálas szerkezetűek, igen stabilak, vízben nem oldódnak. Fibrilláris fehérje pl.: fibroin: a selyem fehérjéje, keratin: a haj fehérjéje. A fibrilláris fehérjék közé tartozik még: a kollagén, a miozin, és a fibrin. A globuláris fehérjék A fehérjék harmadlagos szerkezetét a polipeptidlánc további térbeli elrendeződése határozza meg. A globuláris fehérjékben a polipeptidlánc konformációja szakaszonként váltakozik, ezért a molekula egésze gömb alakú. Az eltérő konformációjú részeket ún. rendezetlen szakaszok kapcsolják össze, ahol az alfa-hélix és a béta-szalag közötti átmeneti konformáció alakul ki. A harmadlagos szerkezet stabilitását különféle kötések biztosítják: hidrogén-kötés, pl. a szerin oldalláncok között, van der Waals kötés, pl. az apoláris alanin oldalláncok között, ionos kötés, pl. a savas glutaminsav és a bázisos lizin között található, kovalens kötés, pl. ilyen két cisztein közötti diszulfid-híd. Az egyes másodlagos szerkezettel rendelkező szakaszok egymáshoz viszonyított térbeli helyzete tehát a harmadlagos szerkezettel jellemezhető. A globuláris fehérjék jól oldódnak vízben, kolloid állapotot hozva létre. Ez annak köszönhető, hogy a poláris, hidrofil oldalláncok a gombolyag felületén, míg az apoláris hidrofób oldalláncok a molekula közepén helyezkednek el. A felszínen levő hidrofil aminosav részek jól hidratálódnak, az apoláris részek egy hidrofób belső magot hoznak létre. A belső hidrofób mag, ill. a külső hidrátburok nagymértékben hozzájárul a fehérjék stabilitásához. Ugyanakkor nagyon fontos tény, hogy a fehérjék térszerkezete rendkívül bonyolult, ebből következően igen érzékenyen válaszol térszerkezetének megváltozásával a környezet hatásaira. A fehérjék harmadlagos szerkezetét befolyásoló környezeti tényezők: A hőmérséklet, könnyűfémsó koncentráció, a közeg hidrogénion koncentrációja, a nehézfémsók. A hőmérséklet emelésekor a molekularészek hőmozgása egyre intenzívebb lesz, aminek következtében az oldalláncok közötti stabilizáló kötések felszakadnak. A változás hatására a molekula elveszti jellegzetes térszerkezetét, letekeredik, azaz denaturálódik. A letekeredett láncok összeakadva térhálót alkotnak, melynek hézagaiban 12

13 vízmolekulák helyezkednek el. A rendszer kolloid állapota megszűnik, durva diszperz rendszerré alakul, azaz a fehérjék kicsapódnak, koagulálnak. A folyamat visszafordíthatatlan, azaz irreverzibilis. (Kisméretű peptidek esetén lehet reverzibilis.) Irreverzibilis denaturáció zajlik le tojás főzéskor is, minek hatására a molekulák véglegesen elvesztik harmadlagos szerkezetüket, biológiai aktivitásuk megszűnik. Az élő sejtek ph-ja 7.1 körül van, a sejtekben a fehérjék működése, szerkezete ekkor optimális. Amennyiben változik a ph - azaz megváltozik a H + -ion koncentráció -, a bevitt ionok hatására megváltoznak a fehérjemolekulák töltésviszonyai. Az aminosav oldalláncok töltésének megváltozásakor a molekulát stabilizáló kötések felszakadnak, a molekula gombolyag letekeredik, a fehérje irreverzibilisen denaturálódik. A nehézfémsók - pl. Pb, Hg, - hatására a fehérjék irreverzibilisen denaturálódnak. A nehézfém ionok hozzákapcsolódnak a polipeptidlánchoz, felszakítják a láncot stabilizáló kötéseket. A könnyűfémsók koncentrációjának emelésekor az oldatba kerülő ionok hidratálódnak és nagy koncentrációjuk esetén saját hidrátburkuk kialakításához a vízmolekulákat a fehérjék hidrátburkából vonják el. A fehérjemolekulák, mivel hidrátburkukat elvesztik, összecsapódnak, azaz koagulálnak. Kiválva az oldatból megszűnik a kolloid állapotuk. A folyamat reverzibilis, azaz megfordítható, mivel ha a kicsapódott fehérjékhez feleslegben vizet adunk, a molekulák hidrátburka helyreáll, ismét kolloid állapotba kerülnek. A folyamatot kisózásnak is nevezzük, amely pl. (NH4)2SO4 hatására következhet be. Ismertek olyan fehérjék, amelyek nem egy, hanem több polipeptidláncból épülnek fel. Ilyen fehérje pl. a hemoglobin. A fehérjét felépítő egyes polipeptidláncokat alegységnek nevezzük. Az alegységek egymáshoz viszonyított térbeli helyzetét a negyedleges szerkezettel jellemezzük. Pl. a hemoglobin. A fehérjék kimutatási reakciói Biuret-próba, xantoprotein reakció. A Biuret-próba. Pozitív próba esetén ibolya színeződést tapasztalunk. A xantoprotein reakcióval a fehérjékben jelenlévő, aromás oldalláncot tartalmazó aminosavakat lehet kimutatni. Pozitív próba esetén sárga színeződést tapasztalunk. A fehérjék csoportosítása összetételük szerint történik. 3. Proteidek vagy összetett fehérjék Nem fehérje természetű, ún. prosztetikus csoportot is tartalmaznak: glükoproteidek: prosztetikus csoportjuk szénhidrát, o mucin a nyálban, o globulinok a vérben, lipoproteidek: prosztetikus csoportjuk lipid, o sejthártya fehérjéi, 13

14 nukleoproteidek: prosztetikus csoportjuk nukleinsav, o hisztonok. 4. Proteinek vagy egyszerű fehérjék. Csak aminosavakból állnak: albuminok a vérben, kollagén, inzulin, stb. 14

Szerkesztette: Vizkievicz András

Szerkesztette: Vizkievicz András Fehérjék A fehérjék - proteinek - az élő szervezetek számára a legfontosabb vegyületek. Az élet bármilyen megnyilvánulási formája fehérjékkel kapcsolatos. A sejtek szárazanyagának minimum 50 %-át adják.

Részletesebben

Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek

Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek Hidroxikarbonsavak α-hidroxi karbonsavak -Glikolsav (kézkrémek) - Tejsav (tejtermékek, izomláz, fogszuvasodás) - Citromsav (citrusfélékben,

Részletesebben

A sejtek élete. 5. Robotoló törpék és óriások Az aminosavak és fehérjék R C NH 2. C COOH 5.1. A fehérjeépítőaminosavak általános

A sejtek élete. 5. Robotoló törpék és óriások Az aminosavak és fehérjék R C NH 2. C COOH 5.1. A fehérjeépítőaminosavak általános A sejtek élete 5. Robotoló törpék és óriások Az aminosavak és fehérjék e csak nézd! Milyen protonátmenetes reakcióra képes egy aminosav? R 2 5.1. A fehérjeépítőaminosavak általános képlete 5.2. A legegyszerűbb

Részletesebben

1. jelentésük. Nevüket az alkotó szén, hidrogén, oxigén 1 : 2 : 1 arányából hajdan elképzelt képletről [C n (H 2 O) m ] kapták.

1. jelentésük. Nevüket az alkotó szén, hidrogén, oxigén 1 : 2 : 1 arányából hajdan elképzelt képletről [C n (H 2 O) m ] kapták. Összefoglalás II. Szénhidrátok 1. jelentésük Nevüket az alkotó szén, hidrogén, oxigén 1 : 2 : 1 arányából hajdan elképzelt képletről [C n (H 2 O) m ] kapták. Ha ezeket az anyagokat hevítjük vizet vesztenek

Részletesebben

Aminosavak, peptidek, fehérjék. Béres Csilla

Aminosavak, peptidek, fehérjék. Béres Csilla Aminosavak, peptidek, fehérjék Béres Csilla Aminosavak Az aminosavak (más néven aminokarbonsavak) olyan szerves vegyületek, amelyek molekulájában aminocsoport (- NH 2 ) és karboxilcsoport (-COOH) egyaránt

Részletesebben

Fehérjeszerkezet, és tekeredés

Fehérjeszerkezet, és tekeredés Fehérjeszerkezet, és tekeredés Futó Kinga 2013.10.08. Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983

Részletesebben

A fehérjék hierarchikus szerkezete

A fehérjék hierarchikus szerkezete Fehérjék felosztása A fehérjék hierarchikus szerkezete Smeller László Semmelweis Egyetem Biofizikai és Sugárbiológiai Intézet Biológiai funkció alapján Enzimek (pl.: tripszin, citokróm-c ) Transzportfehérjék

Részletesebben

Aminosavak, peptidek, fehérjék

Aminosavak, peptidek, fehérjék Aminosavak, peptidek, fehérjék Az aminosavak a fehérjék építőkövei. A fehérjék felépítésében mindössze 20- féle aminosav vesz részt. Ezek általános képlete: Az aminosavakban, mint arra nevük is utal van

Részletesebben

TestLine - Biogén elemek, molekulák Minta feladatsor

TestLine - Biogén elemek, molekulák Minta feladatsor TestLine - iogén elemek, molekulák iogén elemek, szervetlen és szerves molekulák az élő szervezetben. gészítsd ki a mondatot! aminocsoportja kondenzáció víz ún. peptidkötés 1. 1:48 Normál fehérjék biológiai

Részletesebben

AMINOSAVAK, FEHÉRJÉK

AMINOSAVAK, FEHÉRJÉK AMINOSAVAK, FEHÉRJÉK Az aminosavak olyan szerves vegyületek, amelyek molekulájában aminocsoport (-NH2) és karboxilcsoport (-COOH) egyaránt előfordul. Felosztás A fehérjéket feloszthatjuk aszerint, hogy

Részletesebben

A fehérjék szerkezete és az azt meghatározó kölcsönhatások

A fehérjék szerkezete és az azt meghatározó kölcsönhatások A fehérjék szerkezete és az azt meghatározó kölcsönhatások 1. A fehérjék szerepe az élõlényekben 2. A fehérjék szerkezetének szintjei 3. A fehérjék konformációs stabilitásáért felelõs kölcsönhatások 4.

Részletesebben

A fehérjék hierarchikus szerkezete

A fehérjék hierarchikus szerkezete Fehérjék felosztása A fehérjék hierarchikus szerkezete Smeller László Semmelweis Egyetem Biofizikai és Sugárbiológiai Intézet Biológiai funkció alapján Enzimek (pl.: tripszin, citokróm-c ) Transzportfehérjék

Részletesebben

Aminosavak általános képlete NH 2. Csoportosítás: R oldallánc szerkezete alapján: Semleges. Esszenciális aminosavak

Aminosavak általános képlete NH 2. Csoportosítás: R oldallánc szerkezete alapján: Semleges. Esszenciális aminosavak Aminosavak 1 Aminosavak általános képlete N 2 soportosítás: oldallánc szerkezete alapján: Apoláris Poláris Bázikus Savas Semleges Esszenciális aminosavak 2 (apoláris) Glicin Név Gly 3 Alanin Ala 3 3 Valin

Részletesebben

Az élő szervezetek felépítése I. Biogén elemek biomolekulák alkotóelemei a természetben előforduló elemek közül 22 fordul elő az élővilágban O; N; C; H; P; és S; - élő anyag 99%-a Biogén elemek sajátosságai:

Részletesebben

A tananyag felépítése: A BIOLÓGIA ALAPJAI. I. Prokarióták és eukarióták. Az eukarióta sejt. Pécs Miklós: A biológia alapjai

A tananyag felépítése: A BIOLÓGIA ALAPJAI. I. Prokarióták és eukarióták. Az eukarióta sejt. Pécs Miklós: A biológia alapjai A BIOLÓGIA ALAPJAI A tananyag felépítése: Környezetmérnök és műszaki menedzser hallgatók számára Előadó: 2 + 0 + 0 óra, félévközi számonkérés 3 ZH: október 3, november 5, december 5 dr. Pécs Miklós egyetemi

Részletesebben

A szénhidrátok az élet szempontjából rendkívül fontos, nélkülözhetetlen vegyületek. A bioszféra szerves anyagainak fő tömegét adó vegyületek.

A szénhidrátok az élet szempontjából rendkívül fontos, nélkülözhetetlen vegyületek. A bioszféra szerves anyagainak fő tömegét adó vegyületek. Szénhidrátok Szerkesztette: Vizkievicz András A szénhidrátok az élet szempontjából rendkívül fontos, nélkülözhetetlen vegyületek. A bioszféra szerves anyagainak fő tömegét adó vegyületek. A szénhidrátok

Részletesebben

Biogén elemeknek az élő szervezeteket felépítő kémiai elemeket nevezzük. A természetben található 90 elemből ez mindössze kb. 30.

Biogén elemeknek az élő szervezeteket felépítő kémiai elemeket nevezzük. A természetben található 90 elemből ez mindössze kb. 30. A sejtek kémiai felépítése Szerkesztette: Vizkievicz András A biogén elemek Biogén elemeknek az élő szervezeteket felépítő kémiai elemeket nevezzük. A természetben található 90 elemből ez mindössze kb.

Részletesebben

9. Előadás Fehérjék Előzmények Peptidkémia Analitikai kémia Protein kémia 1901 E.Fischer : Gly-Gly 1923 F. Pregl : Mikroanalitika 1952 Stein and Moore : Aminosav analizis 1932 Bergman és Zervas : Benziloxikarbonil

Részletesebben

6. változat. 3. Jelöld meg a nem molekuláris szerkezetű anyagot! A SO 2 ; Б C 6 H 12 O 6 ; В NaBr; Г CO 2.

6. változat. 3. Jelöld meg a nem molekuláris szerkezetű anyagot! A SO 2 ; Б C 6 H 12 O 6 ; В NaBr; Г CO 2. 6. változat Az 1-től 16-ig terjedő feladatokban négy válaszlehetőség van, amelyek közül csak egy helyes. Válaszd ki a helyes választ és jelöld be a válaszlapon! 1. Jelöld meg azt a sort, amely helyesen

Részletesebben

3. Sejtalkotó molekulák III.

3. Sejtalkotó molekulák III. 3. Sejtalkotó molekulák III. Fehérjék, fehérjeszintézis (transzkripció, transzláció, posztszintetikus módosítások). Enzimműködés 3.1 Fehérjék A genetikai információ egyik fő manifesztálódása Számos funkció

Részletesebben

Fehérjeszerkezet, fehérjetekeredés

Fehérjeszerkezet, fehérjetekeredés Fehérjeszerkezet, fehérjetekeredés A fehérjeszerkezet szintjei A fehérjetekeredés elmélete: Anfinsen kísérlet Levinthal paradoxon A feltekeredés tölcsér elmélet 2014.11.05. Aminosavak és fehérjeszerkezet

Részletesebben

KÉMIA ÍRÁSBELI ÉRETTSÉGI- FELVÉTELI FELADATOK 2000

KÉMIA ÍRÁSBELI ÉRETTSÉGI- FELVÉTELI FELADATOK 2000 Megoldás 000. oldal KÉMIA ÍRÁSBELI ÉRETTSÉGI- FELVÉTELI FELADATOK 000 JAVÍTÁSI ÚTMUTATÓ I. A NITROGÉN ÉS SZERVES VEGYÜLETEI s s p 3 molekulák között gyenge kölcsönhatás van, ezért alacsony olvadás- és

Részletesebben

Az élő anyag szerkezeti egységei: víz, nukleinsavak, fehérjék. elrendeződés, rend, rendszer, periodikus ismétlődés

Az élő anyag szerkezeti egységei: víz, nukleinsavak, fehérjék. elrendeződés, rend, rendszer, periodikus ismétlődés Az élő anyag szerkezeti egységei: víz, nukleinsavak, fehérjék Agócs Gergely 2013. december 3. kedd 10:00 11:40 1. Mit értünk élő anyag alatt? Az élő szervezetet felépítő anyagok. Az anyag azonban nem csupán

Részletesebben

Eszközszükséglet: Szükséges anyagok: tojás, NaCl, ammónium-szulfát, réz-szulfát, ólom-acetát, ecetsav, sósav, nátrium-hidroxid, desztillált víz

Eszközszükséglet: Szükséges anyagok: tojás, NaCl, ammónium-szulfát, réz-szulfát, ólom-acetát, ecetsav, sósav, nátrium-hidroxid, desztillált víz A kísérlet, megnevezés, célkitűzései: Fehérjék tulajdonságainak, szerkezetének vizsgálata. Környezeti változások hatásának megfigyelése a fehérjék felépítésében. Eszközszükséglet: Szükséges anyagok: tojás,

Részletesebben

AZ ÉLET KÉMIÁJA... ÉLŐ ANYAG SZERVEZETI ALAPEGYSÉGE

AZ ÉLET KÉMIÁJA... ÉLŐ ANYAG SZERVEZETI ALAPEGYSÉGE AZ ÉLET KÉMIÁJA... ÉLŐ ANYAG SZERVEZETI ALAPEGYSÉGE A biológia az élet tanulmányozásával foglalkozik, az élő szervezetekre viszont vonatkoznak a fizika és kémia törvényei MI ÉPÍTI FEL AZ ÉLŐ ANYAGOT? HOGYAN

Részletesebben

Az anyagi rendszer fogalma, csoportosítása

Az anyagi rendszer fogalma, csoportosítása Az anyagi rendszer fogalma, csoportosítása A bemutatót összeállította: Fogarasi József, Petrik Lajos SZKI, 2011 1 1 A rendszer fogalma A körülöttünk levő anyagi világot atomok, ionok, molekulák építik

Részletesebben

SZÉNHIDRÁTOK. Biológiai szempontból legjelentősebb a hat szénatomos szőlőcukor (glükóz) és gyümölcscukor(fruktóz),

SZÉNHIDRÁTOK. Biológiai szempontból legjelentősebb a hat szénatomos szőlőcukor (glükóz) és gyümölcscukor(fruktóz), SZÉNHIDRÁTOK A szénhidrátok döntő többségének felépítésében három elem, a C, a H és az O atomjai vesznek részt. Az egyszerű szénhidrátok (monoszacharidok) részecskéi egyetlen cukormolekulából állnak. Az

Részletesebben

4. FEHÉRJÉK. 2. Vázanyagok. Az izmok alkotórésze (pl.: a miozin). Inak, izületek, csontok szerves komponensei, az ún. vázfehérjék (szkleroproteinek).

4. FEHÉRJÉK. 2. Vázanyagok. Az izmok alkotórésze (pl.: a miozin). Inak, izületek, csontok szerves komponensei, az ún. vázfehérjék (szkleroproteinek). 4. FEÉRJÉK 4.0. Bevezetés A fehérjék elsısorban α-l-aminosavakból felépülı biopolimerek. A csak α-laminosavakat tartalmazó fehérjék a proteinek. evüket a görög proteios szóból kapták, ami elsırangút jelent.

Részletesebben

FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest,

FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest, FEHÉRJÉK A MÁGNESEKBEN Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium Alkímia Ma, Budapest, 2013.02.28. I. FEHÉRJÉK: L-α aminosavakból felépülő lineáris polimerek α H 2 N CH COOH amino

Részletesebben

A szénhidrátok az élet szempontjából rendkívül fontos, nélkülözhetetlen vegyületek. A bioszféra szerves anyagainak fő tömegét adó vegyületek.

A szénhidrátok az élet szempontjából rendkívül fontos, nélkülözhetetlen vegyületek. A bioszféra szerves anyagainak fő tömegét adó vegyületek. Szénhidrátok Szerkesztette: Vizkievicz András A szénhidrátok az élet szempontjából rendkívül fontos, nélkülözhetetlen vegyületek. A bioszféra szerves anyagainak fő tömegét adó vegyületek. A szénhidrátok

Részletesebben

1. változat. 4. Jelöld meg azt az oxidot, melynek megfelelője a vas(iii)-hidroxid! A FeO; Б Fe 2 O 3 ; В OF 2 ; Г Fe 3 O 4.

1. változat. 4. Jelöld meg azt az oxidot, melynek megfelelője a vas(iii)-hidroxid! A FeO; Б Fe 2 O 3 ; В OF 2 ; Г Fe 3 O 4. 1. változat z 1-től 16-ig terjedő feladatokban négy válaszlehetőség van, amelyek közül csak egy helyes. Válaszd ki a helyes választ és jelöld be a válaszlapon! 1. Melyik sor fejezi be helyesen az állítást:

Részletesebben

Tartalmi követelmények kémia tantárgyból az érettségin K Ö Z É P S Z I N T

Tartalmi követelmények kémia tantárgyból az érettségin K Ö Z É P S Z I N T 1. Általános kémia Atomok és a belőlük származtatható ionok Molekulák és összetett ionok Halmazok A kémiai reakciók A kémiai reakciók jelölése Termokémia Reakciókinetika Kémiai egyensúly Reakciótípusok

Részletesebben

Az atom- olvasni. 1. ábra Az atom felépítése 1. Az atomot felépítő elemi részecskék. Proton, Jele: (p+) Neutron, Jele: (n o )

Az atom- olvasni. 1. ábra Az atom felépítése 1. Az atomot felépítő elemi részecskék. Proton, Jele: (p+) Neutron, Jele: (n o ) Az atom- olvasni 2.1. Az atom felépítése Az atom pozitív töltésű atommagból és negatív töltésű elektronokból áll. Az atom atommagból és elektronburokból álló semleges kémiai részecske. Az atommag pozitív

Részletesebben

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin.

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin. Myoglobin Fehérje-szerkezetek! MGLSDGEWQLVLNVWGKVEADIPGGQEVLIRLFK GPETLEKFDKFKLKSEDEMKASE DLKKGATVLTALGGILKKKGEAEIKPLAQSA TKKIPVKYLEFISECIIQVLQSK PGDFGADAQGAMNKALELFRKDMASNYKELGFQG Fuxreiter Mónika! Debreceni

Részletesebben

DNS, RNS, Fehérjék. makromolekulák biofizikája. Biológiai makromolekulák. A makromolekulák TÖMEG szerinti mennyisége a sejtben NAGY

DNS, RNS, Fehérjék. makromolekulák biofizikája. Biológiai makromolekulák. A makromolekulák TÖMEG szerinti mennyisége a sejtben NAGY makromolekulák biofizikája DNS, RNS, Fehérjék Kellermayer Miklós Tér Méret, alak, lokális és globális szerkezet Idő Fluktuációk, szerkezetváltozások, gombolyodás Kölcsönhatások Belső és külső kölcsöhatások,

Részletesebben

Táplálkozási ismeretek. Fehérjék. fehérjéinek és egyéb. amelyeket

Táplálkozási ismeretek. Fehérjék. fehérjéinek és egyéb. amelyeket Táplálkozási ismeretek haladóknak I. Az előző három fejezetben megismerkedtünk az alapokkal (táplálék-piramis, alapanyag-csere, napi energiaszükséglet, tápanyagok energiatartalma, naponta szükséges fehérje,

Részletesebben

Szénhidrátok. Szénhidrátok. Szénhidrátok. Csoportosítás

Szénhidrátok. Szénhidrátok. Szénhidrátok. Csoportosítás Szénhidrátok Definíció: Szénhidrátok Polihidroxi aldehidek vagy ketonok, vagy olyan vegyületek, melyek hidrolízisével polihidroxi aldehidek vagy ketonok keletkeznek. Elemi összetétel: - Mindegyik tartalmaz

Részletesebben

Fehérjék színreakciói

Fehérjék színreakciói A kísérlet, mérés megnevezése, célkitűzései: Fehérjéket felépítő aminosavak és a köztük lévő peptid kötés kimutatása Eszközszükséglet: Szükséges anyagok: tej, burgonya, víz, nátrium-hidroxid-oldat, réz(ii)-szulfát,

Részletesebben

Fehérjeszerkezet, és tekeredés. Futó Kinga

Fehérjeszerkezet, és tekeredés. Futó Kinga Fehérjeszerkezet, és tekeredés Futó Kinga Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983 H 211861 N

Részletesebben

Biopolimer 12/7/09. Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. DNS. Polimerek. Kardos Roland DNS elsődleges szerkezete

Biopolimer 12/7/09. Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. DNS. Polimerek. Kardos Roland DNS elsődleges szerkezete Biopolimerek Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. Osztódó sejt magorsófonala Kardos Roland 2009.10.29. Dohány levél epidermális sejtjének aktin hálózat Bakteriofágból kiszabaduló

Részletesebben

Szerves kémiai és biokémiai alapok:

Szerves kémiai és biokémiai alapok: Szerves kémiai és biokémiai alapok: Másodlagos kémiai kötések: A másodlagos kötések energiája nagyságrenddel kisebb, mint az elsődlegeseké. Energiaközlés hatására a másodlagos kötések bomlanak fel először,

Részletesebben

MEDICINÁLIS ALAPISMERETEK AZ ÉLŐ SZERVEZETEK KÉMIAI ÉPÍTŐKÖVEI A LIPIDEK 1. kulcsszó cím: A lipidek szerepe az emberi szervezetben

MEDICINÁLIS ALAPISMERETEK AZ ÉLŐ SZERVEZETEK KÉMIAI ÉPÍTŐKÖVEI A LIPIDEK 1. kulcsszó cím: A lipidek szerepe az emberi szervezetben Modul cím: MEDICINÁLIS ALAPISMERETEK AZ ÉLŐ SZERVEZETEK KÉMIAI ÉPÍTŐKÖVEI A LIPIDEK 1. kulcsszó cím: A lipidek szerepe az emberi szervezetben Tartalék energiaforrás, membránstruktúra alkotása, mechanikai

Részletesebben

Kémiai kötések. Kémiai kötések. A bemutatót összeállította: Fogarasi József, Petrik Lajos SZKI, 2011

Kémiai kötések. Kémiai kötések. A bemutatót összeállította: Fogarasi József, Petrik Lajos SZKI, 2011 Kémiai kötések A bemutatót összeállította: Fogarasi József, Petrik Lajos SZKI, 2011 1 Cl + Na Az ionos kötés 1. Cl + - + Na Klór: 1s 2 2s 2 2p 6 3s 2 3p 5 Kloridion: 1s2 2s2 2p6 3s2 3p6 Nátrium: 1s 2 2s

Részletesebben

Fejlesztő neve: VADICSKÓ JUDIT. Tanóra címe: A SEJTET FELÉPÍTŐ KÉMIAI ANYAGOK ÉS JELLEMZŐ REAKCIÓIK

Fejlesztő neve: VADICSKÓ JUDIT. Tanóra címe: A SEJTET FELÉPÍTŐ KÉMIAI ANYAGOK ÉS JELLEMZŐ REAKCIÓIK Fejlesztő neve: VADICSKÓ JUDIT Tanóra címe: A SEJTET FELÉPÍTŐ KÉMIAI ANYAGOK ÉS JELLEMZŐ REAKCIÓIK 1. Az óra tartalma A tanulási téma bemutatása; A téma és a módszer összekapcsolásának indoklása: A természettudományos

Részletesebben

3. változat. 2. Melyik megállapítás helyes: Az egyik gáz másikhoz viszonyított sűrűsége nem más,

3. változat. 2. Melyik megállapítás helyes: Az egyik gáz másikhoz viszonyított sűrűsége nem más, 3. változat z 1-től 16-ig terjedő feladatokban négy válaszlehetőség van, amelyek közül csak egy helyes. Válaszd ki a helyes választ és jelöld be a válaszlapon! 1. Jelöld meg az egyszerű anyagok számát

Részletesebben

A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA

A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA 2013.10.09. CITOSZKELETON - DEFINÍCIÓ Fehérjékből felépülő, a sejt vázát alkotó intracelluláris rendszer. Eukarióta és prokarióta sejtekben egyaránt megtalálható.

Részletesebben

7. évfolyam kémia osztályozó- és pótvizsga követelményei Témakörök: 1. Anyagok tulajdonságai és változásai (fizikai és kémiai változás) 2.

7. évfolyam kémia osztályozó- és pótvizsga követelményei Témakörök: 1. Anyagok tulajdonságai és változásai (fizikai és kémiai változás) 2. 7. évfolyam kémia osztályozó- és pótvizsga követelményei 1. Anyagok tulajdonságai és változásai (fizikai és kémiai változás) 2. Hőtermelő és hőelnyelő folyamatok, halmazállapot-változások 3. A levegő,

Részletesebben

A szénhidrátok lebomlása

A szénhidrátok lebomlása A disszimiláció Szerk.: Vizkievicz András A disszimiláció, vagy lebontás az autotróf, ill. a heterotróf élőlényekben lényegében azonos módon zajlik. A disszimilációs - katabolikus - folyamatok mindig valamilyen

Részletesebben

a. 35-ös tömegszámú izotópjában 18 neutron található. b. A 3. elektronhéján két vegyértékelektront tartalmaz. c. 2 mól atomjának tömege 32 g.

a. 35-ös tömegszámú izotópjában 18 neutron található. b. A 3. elektronhéján két vegyértékelektront tartalmaz. c. 2 mól atomjának tömege 32 g. MAGYAR TANNYELVŰ KÖZÉPISKOLÁK IX. ORSZÁGOS VETÉLKEDŐJE AL IX.-LEA CONCURS PE ŢARĂ AL LICEELOR CU LIMBĂ DE PREDARE MAGHIARĂ FABINYI RUDOLF KÉMIA VERSENY - SZERVETLEN KÉMIA Marosvásárhely, Bolyai Farkas

Részletesebben

Szerves Kémia II. Dr. Patonay Tamás egyetemi tanár E 405 Tel:

Szerves Kémia II. Dr. Patonay Tamás egyetemi tanár E 405 Tel: Szerves Kémia II. TKBE0312 Előfeltétel: TKBE03 1 Szerves kémia I. Előadás: 2 óra/hét Dr. Patonay Tamás egyetemi tanár E 405 Tel: 22464 tpatonay@puma.unideb.hu A 2010/11. tanév tavaszi félévében az előadás

Részletesebben

Bioinformatika 2 5.. előad

Bioinformatika 2 5.. előad 5.. előad adás Prof. Poppe László BME Szerves Kémia és Technológia Tsz. Bioinformatika proteomika Előadás és gyakorlat 2009. 03. 21. Fehérje térszerkezet t megjelenítése A fehérjék meglehetősen összetett

Részletesebben

Nukleinsavak építőkövei

Nukleinsavak építőkövei ukleinsavak Szerkezeti hierarchia ukleinsavak építőkövei Pirimidin Purin Pirimidin Purin Timin (T) Adenin (A) Adenin (A) Citozin (C) Guanin (G) DS bázisai bázis Citozin (C) Guanin (G) RS bázisai bázis

Részletesebben

Laboratóriumi technikus laboratóriumi technikus Drog és toxikológiai

Laboratóriumi technikus laboratóriumi technikus Drog és toxikológiai A 10/2007 (II. 27.) SzMM rendelettel módosított 1/2006 (II. 17.) OM rendelet Országos Képzési Jegyzékről és az Országos Képzési Jegyzékbe történő felvétel és törlés eljárási rendjéről alapján. Szakképesítés,

Részletesebben

Aminosavak, peptidek, fehérjék. Szerkezet, előállítás, kémiai tulajdonság

Aminosavak, peptidek, fehérjék. Szerkezet, előállítás, kémiai tulajdonság Aminosavak, peptidek, fehérjék Szerkezet, előállítás, kémiai tulajdonság Aminosavak Aminosavaknak nevezzük azokat a karbonsavakat, amelyekben a szénlánc egy vagy több hidrogénjét amino (NH 2 ) csoportra

Részletesebben

Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete

Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete Polipeptidek térszerkezete Tipikus (rendezett) konformerek em tipikus (rendezetlen) konformerek Periodikus vagy homokonformerek Aperiodikus

Részletesebben

A kémiatanári zárószigorlat tételsora

A kémiatanári zárószigorlat tételsora 1. A. tétel A kémiatanári zárószigorlat tételsora Kémiai alapfogalmak: Atom- és molekulatömeg, anyagmennyiség, elemek és vegyületek elnevezése, jelölése. Kémiai egyenlet, sztöchiometria. A víz jelentősége

Részletesebben

A szénhidrátok lebomlása

A szénhidrátok lebomlása A disszimiláció Szerk.: Vizkievicz András A disszimiláció, vagy lebontás az autotróf, ill. a heterotróf élőlényekben lényegében azonos módon zajlik. A disszimilációs - katabolikus - folyamatok mindig valamilyen

Részletesebben

Vegyületek - vegyületmolekulák

Vegyületek - vegyületmolekulák Vegyületek - vegyületmolekulák 3.Az anyagok csoportosítása összetételük szerint Egyszerű összetett Azonos atomokból állnak különböző atomokból állnak Elemek vegyületek keverékek Fémek Félfémek Nemfémek

Részletesebben

Farmakológus szakasszisztens Farmakológus szakasszisztens 2/34

Farmakológus szakasszisztens Farmakológus szakasszisztens 2/34 -06 Farmakológus szakasszisztens feladatok A 0/007 (II. 7.) SzMM rendelettel módosított /006 (II. 7.) OM rendelet Országos Képzési Jegyzékről és az Országos Képzési Jegyzékbe történő felvétel és törlés

Részletesebben

Fémionok szerepe az élő szervezetben: a bioszervetlen kémia alapjainak megismerése

Fémionok szerepe az élő szervezetben: a bioszervetlen kémia alapjainak megismerése Fémionok szerepe az élő szervezetben: a bioszervetlen kémia alapjainak megismerése Előadó: Lihi Norbert Debreceni Egyetem Szervetlen és Analitikai Kémiai Tanszék Bioszervetlen Kémiai Kutatócsoport A bioszervetlen

Részletesebben

A felépítő és lebontó folyamatok. Biológiai alapismeretek

A felépítő és lebontó folyamatok. Biológiai alapismeretek A felépítő és lebontó folyamatok Biológiai alapismeretek Anyagforgalom: Lebontó Felépítő Lebontó folyamatok csoportosítása: Biológiai oxidáció Erjedés Lebontó folyamatok összehasonlítása Szénhidrátok

Részletesebben

Cikloalkánok és származékaik konformációja

Cikloalkánok és származékaik konformációja 1 ikloalkánok és származékaik konformációja telített gyűrűs szénhidrogének legegyszerűbb képviselője a ciklopropán. Gyűrűje szabályos háromszög alakú, ennek megfelelően szénatomjai egy síkban helyezkednek

Részletesebben

BIOMOLEKULÁK KÉMIÁJA. Novák-Nyitrai-Hazai

BIOMOLEKULÁK KÉMIÁJA. Novák-Nyitrai-Hazai BIOMOLEKULÁK KÉMIÁJA Novák-Nyitrai-Hazai A tankönyv elsısorban szerves kémiai szempontok alapján tárgyalja az élı szervezetek felépítésében és mőködésében kulcsfontosságú szerves vegyületeket. A tárgyalás-

Részletesebben

Atomszerkezet. Atommag protonok, neutronok + elektronok. atompályák, alhéjak, héjak, atomtörzs ---- vegyérték elektronok

Atomszerkezet. Atommag protonok, neutronok + elektronok. atompályák, alhéjak, héjak, atomtörzs ---- vegyérték elektronok Atomszerkezet Atommag protonok, neutronok + elektronok izotópok atompályák, alhéjak, héjak, atomtörzs ---- vegyérték elektronok periódusos rendszer csoportjai Periódusos rendszer A kémiai kötés Kémiai

Részletesebben

ANATÓMIA FITNESS AKADÉMIA

ANATÓMIA FITNESS AKADÉMIA ANATÓMIA FITNESS AKADÉMIA sejt szövet szerv szervrendszer sejtek általános jellemzése: az élet legkisebb alaki és működési egysége minden élőlény sejtes felépítésű minden sejtre jellemző: határoló rendszer

Részletesebben

A bioenergetika a biokémiai folyamatok során lezajló energiaváltozásokkal foglalkozik.

A bioenergetika a biokémiai folyamatok során lezajló energiaváltozásokkal foglalkozik. Modul cím: MEDICINÁLIS ALAPISMERETEK BIOKÉMIA BIOENERGETIKA I. 1. kulcsszó cím: Energia A termodinamika első főtétele kimondja, hogy a különböző energiafajták átalakulhatnak egymásba ez az energia megmaradásának

Részletesebben

Biotechnológiai alapismeretek tantárgy

Biotechnológiai alapismeretek tantárgy Biotechnológiai alapismeretek tantárgy A biotechnológiai alapismeretek tantárgy magába foglalja a kémia, fizikai kémia és a biológia tantárgyak témaköreit. 1. A) Ismertesse az atomok elektronszerkezetét!

Részletesebben

IPARI ENZIMEK 2. Proteázok. Alkalikus proteázok. Pécs Miklós: Biotermék technológia 1. 6. fejezet: Ipari enzimek 2.

IPARI ENZIMEK 2. Proteázok. Alkalikus proteázok. Pécs Miklós: Biotermék technológia 1. 6. fejezet: Ipari enzimek 2. IPARI ENZIMEK 2 Proteázok A proteázok az ipari enzimek egyik legfontosabb csoportja (6200 t tiszta E/év) Peptid kötéseket bont (létrehoz) (hidrolízis, szintézis) Fehérje lebontás: élelmiszer, tejalvadás,

Részletesebben

A borok tisztulása (kolloid tulajdonságok)

A borok tisztulása (kolloid tulajdonságok) A borok tisztulása (kolloid tulajdonságok) Tisztasági problémák a borban Áttetszőség fogyasztói elvárás, különösen a fehérborok esetében Zavarosságok: 1. bor felületén (pl. hártya); 2. borban szétszórtan

Részletesebben

SZILÁGYI JÓZSEF MÉSZÁROS SÁNDOR MEZÕGAZDASÁGI TERMÉKEK ÁRUISMERETE SAPIENTIA ERDÉLYI MAGYAR TUDOMÁNYEGYETEM CSÍKSZEREDAI KAR MÛSZAKI- ÉS TERMÉSZETTUDOMÁNYOK TANSZÉK A kiadvány megjelenését a Sapientia

Részletesebben

12/4/2014. Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció. 1952 Hershey & Chase 1953!!!

12/4/2014. Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció. 1952 Hershey & Chase 1953!!! Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció 1859 1865 1869 1952 Hershey & Chase 1953!!! 1879 1903 1951 1950 1944 1928 1911 1 1. DNS szerkezete Mi az örökítő anyag? Friedrich Miescher

Részletesebben

Fémorganikus kémia 1

Fémorganikus kémia 1 Fémorganikus kémia 1 A fémorganikus kémia tárgya a szerves fémvegyületek előállítása, szerkezetvizsgálata és kémiai reakcióik tanulmányozása A fémorganikus kémia fejlődése 1760 Cadet bisz(dimetil-arzén(iii))-oxid

Részletesebben

ПРОГРАМА ВСТУПНОГО ВИПРОБУВАННЯ З ХІМІЇ Для вступників на ІІ курс навчання за освітньо-кваліфікаційним рівнем «бакалавр»

ПРОГРАМА ВСТУПНОГО ВИПРОБУВАННЯ З ХІМІЇ Для вступників на ІІ курс навчання за освітньо-кваліфікаційним рівнем «бакалавр» ЗАКАРПАТСЬКИЙ УГОРСЬКИЙ ІНСТИТУТ ІМ. Ф. РАКОЦІ ІІ КАФЕДРА МАТЕМАТИКИ ТА ІНФОРМАТИКИ II. RÁKÓCZI FERENC KÁRPÁTALJAI MAGYAR FŐISKOLA MATEMATIKA ÉS INFORMATIKA TANSZÉK ПРОГРАМА ВСТУПНОГО ВИПРОБУВАННЯ З ХІМІЇ

Részletesebben

Biológia 3. zh. A gyenge sav típusú molekulák mozgása a szervezetben. Gyengesav transzport. A glükuronsavval konjugált molekulákat a vese kiválasztja.

Biológia 3. zh. A gyenge sav típusú molekulák mozgása a szervezetben. Gyengesav transzport. A glükuronsavval konjugált molekulákat a vese kiválasztja. Biológia 3. zh Az izomösszehúzódás szakaszai, molekuláris mechanizmusa, az izomösszehúzódás során milyen molekula deformálódik és hogyan? Minden izomrosthoz kapcsolódik kegy szinapszis, ez az úgynevezett

Részletesebben

2016. 01. 28 Róka András

2016. 01. 28 Róka András ALkonyhaKÍMIA 2016. 01. 28 Róka András A makromolekulák mindennapjaink részévé váltak A Magnufuel fő része két neodímium mágnes (NdFeB). Amikor az üzemanyag keresztülhalad az erős mágneses mezőkön, a szénhidrát

Részletesebben

A glükóz reszintézise.

A glükóz reszintézise. A glükóz reszintézise. A glükóz reszintézise. A reszintézis nem egyszerű megfordítása a glikolízisnek. A glikolízis 3 irrevezibilis lépése más úton játszódik le. Ennek oka egyrészt energetikai, másrészt

Részletesebben

TANMENETJAVASLAT. Maróthy Miklósné KÉMIA éveseknek. címû tankönyvéhez

TANMENETJAVASLAT. Maróthy Miklósné KÉMIA éveseknek. címû tankönyvéhez TANMENETJAVASLAT Maróthy Miklósné KÉMIA 14 16 éveseknek címû tankönyvéhez 9. osztály 10.osztály éves órakeret 55 óra 74 óra 55 óra 74 óra (1,5 óra/hét) (2 óra/hét) (1,5 óra/hét) (2 óra/hét) bevezetés 1

Részletesebben

A polifenol vegyületek rendszerezése

A polifenol vegyületek rendszerezése A polifenol vegyületek rendszerezése Nem flavonoid fenolok tulajdonságai: Kevésbé összehúzó ízűek Hidroxi-fahéjsav és származékai (kávésav, ferulasav, kumársav) Szabad állapotban és antocianinokkal acilezett

Részletesebben

,:/ " \ OH OH OH - 6 - / \ O / H / H HO-CH, O, CH CH - OH ,\ / "CH - ~(H CH,-OH \OH. ,-\ ce/luló z 5zer.~ezere

,:/  \ OH OH OH - 6 - / \ O / H / H HO-CH, O, CH CH - OH ,\ / CH - ~(H CH,-OH \OH. ,-\ ce/luló z 5zer.~ezere - 6 - o / \ \ o / \ / \ () /,-\ ce/luló z 5zer.~ezere " C=,1 -- J - 1 - - ---,:/ " - -,,\ / " - ~( / \ J,-\ ribóz: a) r.yílt 12"('.1, b) gyürus íormája ~.. ~ en;én'. fu5 héli'(ef1e~: egy menete - 7-5.

Részletesebben

NÖVÉNYGENETIKA. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP /1/A

NÖVÉNYGENETIKA. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP /1/A NÖVÉNYGENETIKA Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 A NÖVÉNYI TÁPANYAG TRANSZPORTEREK az előadás áttekintése A tápionok útja a növényben Növényi tápionok passzív és

Részletesebben

Szerkesztette: Vizkievicz András

Szerkesztette: Vizkievicz András Fehérjék A fehérjék - proteinek - az élő szervezetek számára a legfontosabb vegyületek. Az élet bármilyen megnyilvánulási formája fehérjékkel kapcsolatos. A sejtek szárazanyagának minimum 50 %-át adják.

Részletesebben

Magyar tannyelvű középiskolák VII Országos Tantárgyversenye Fabinyi Rudolf - Kémiaverseny 2012 XI osztály

Magyar tannyelvű középiskolák VII Országos Tantárgyversenye Fabinyi Rudolf - Kémiaverseny 2012 XI osztály 1. A Freon-12 fantázianéven ismert termék felhasználható illatszerek és más kozmetikai cikkek tartályainak nyomógázaként, mert: a. nagy a párolgási hője b. szobahőmérsékleten cseppfolyós c. szagtalan és

Részletesebben

I. Atomszerkezeti ismeretek (9. Mozaik Tankönyv:10-30. oldal) 1. Részletezze az atom felépítését!

I. Atomszerkezeti ismeretek (9. Mozaik Tankönyv:10-30. oldal) 1. Részletezze az atom felépítését! I. Atomszerkezeti ismeretek (9. Mozaik Tankönyv:10-30. oldal) 1. Részletezze az atom felépítését! Az atom az anyagok legkisebb, kémiai módszerekkel tovább már nem bontható része. Az atomok atommagból és

Részletesebben

Természetes vizek, keverékek mindig tartalmaznak oldott anyagokat! Írd le milyen természetes vizeket ismersz!

Természetes vizek, keverékek mindig tartalmaznak oldott anyagokat! Írd le milyen természetes vizeket ismersz! Összefoglalás Víz Természetes víz. Melyik anyagcsoportba tartozik? Sorolj fel természetes vizeket. Mitől kemény, mitől lágy a víz? Milyen okokból kell a vizet tisztítani? Kémiailag tiszta víz a... Sorold

Részletesebben

GYOMOR. EGYES SZERVEK ÉS SZERVREND- SZEREK BIOKÉMIAI MŰKÖDÉSEI 1. Az emésztés és felszívódás PEPSZIN GYOMOR 2. PATKÓBÉL, DUODENUM

GYOMOR. EGYES SZERVEK ÉS SZERVREND- SZEREK BIOKÉMIAI MŰKÖDÉSEI 1. Az emésztés és felszívódás PEPSZIN GYOMOR 2. PATKÓBÉL, DUODENUM EGYES SZERVEK ÉS SZERVREND- SZEREK BIOKÉMIAI MŰKÖDÉSEI 1. Az emésztés és felszívódás biokémiája Az emésztőcsatorna szakaszai: Szájüreg: - mechanikai aprítás - megfelelő konzisztencia kialakítása (nyál).

Részletesebben

A nukleinsavak polimer vegyületek. Mint polimerek, monomerekből épülnek fel, melyeket nukleotidoknak nevezünk.

A nukleinsavak polimer vegyületek. Mint polimerek, monomerekből épülnek fel, melyeket nukleotidoknak nevezünk. Nukleinsavak Szerkesztette: Vizkievicz András A nukleinsavakat először a sejtek magjából sikerült tiszta állapotban kivonni. Innen a név: nucleus = mag (lat.), a sav a kémhatásukra utal. Azonban nukleinsavak

Részletesebben

A másodlagos biogén elemek a szerves vegyületekben kb. 1-2 %-ban jelen lévő elemek. Mint pl.: P, S, Fe, Mg, Na, K, Ca, Cl.

A másodlagos biogén elemek a szerves vegyületekben kb. 1-2 %-ban jelen lévő elemek. Mint pl.: P, S, Fe, Mg, Na, K, Ca, Cl. A sejtek kémiai felépítése Szerkesztette: Vizkievicz András A biogén elemek Biogén elemeknek az élő szervezeteket felépítő kémiai elemeket nevezzük. A természetben található 90 elemből ez mindössze kb.

Részletesebben

KÉMIA A KÉMIÁT SZERETŐK SZÁMÁRA

KÉMIA A KÉMIÁT SZERETŐK SZÁMÁRA XXI. Századi Közoktatás (fejlesztés, koordináció) II. szakasz TÁMOP-3.1.1-11/1-2012-0001 KÉMIA A KÉMIÁT SZERETŐK SZÁMÁRA A művelődési anyag tematikájának összeállítása a Nemzeti Alaptanterv és a kapcsolódó

Részletesebben

ELTE BOLYAI JÁNOS GYAKORLÓ ÁLTALÁNOS ISKOLA ÉS GIMNÁZIUM SZÓBELI ÉRETTSÉGI TÉMAKÖRÖK KÉMIÁBÓL

ELTE BOLYAI JÁNOS GYAKORLÓ ÁLTALÁNOS ISKOLA ÉS GIMNÁZIUM SZÓBELI ÉRETTSÉGI TÉMAKÖRÖK KÉMIÁBÓL ELTE BOLYAI JÁNOS GYAKORLÓ ÁLTALÁNOS ISKOLA ÉS GIMNÁZIUM SZÓBELI ÉRETTSÉGI TÉMAKÖRÖK KÉMIÁBÓL 2017 1. Az atom szerkezete Az atomok, az elemek jellemzése. Az elektronszerkezet és a periódusos rendszer.

Részletesebben

1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói

1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói 1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói Plazmamembrán Membrán funkciói: sejt integritásának fenntartása állandó hő, energia, és információcsere biztosítása homeosztázis

Részletesebben

Szakközépiskola 9-10. évfolyam Kémia. 9-10. évfolyam

Szakközépiskola 9-10. évfolyam Kémia. 9-10. évfolyam 9-10. évfolyam A szakközépiskolában a kémia tantárgy keretében folyó személyiségfejlesztés a természettudományos nevelés egyik színtereként a hétköznapi életben hasznosulni képes tudás épülését szolgálja.

Részletesebben

6. Zárványtestek feldolgozása

6. Zárványtestek feldolgozása 6. Zárványtestek feldolgozása... 1 6.1. A zárványtestek... 1 6.1.1. A zárványtestek kialakulása... 2 6.1.2. A feldolgozási technológia... 3 6.1.2.1. Sejtfeltárás... 3 6.1.2.2. Centrifugálás, tisztítás...

Részletesebben

ENZIMSZINTŰ SZABÁLYOZÁS

ENZIMSZINTŰ SZABÁLYOZÁS ENZIMEK 1833.: Sörfőzés kapcsán kezdtek el vele foglalkozni (csírázó árpa vizsgálata) valamilyen anyag katalizátorként működik (Berzelius, 1835.) 1850. körül: ez valamilyen N-tartalmú szervesanyag 1874.:

Részletesebben

MEDICINÁLIS ALAPISMERETEK BIOKÉMIA AZ AMINOSAVAK ANYAGCSERÉJE 1. kulcsszó cím: Az aminosavak szerepe a szervezetben

MEDICINÁLIS ALAPISMERETEK BIOKÉMIA AZ AMINOSAVAK ANYAGCSERÉJE 1. kulcsszó cím: Az aminosavak szerepe a szervezetben Modul cím: MEDICINÁLIS ALAPISMERETEK BIOKÉMIA AZ AMINOSAVAK ANYAGCSERÉJE 1. kulcsszó cím: Az aminosavak szerepe a szervezetben A szénhidrátokkal és a lipidekkel ellentétben szervezetünkben nincsenek aminosavakból

Részletesebben

Kollokviumi vizsgakérdések biokémiából humánkineziológia levelező (BSc) 2015

Kollokviumi vizsgakérdések biokémiából humánkineziológia levelező (BSc) 2015 Kollokviumi vizsgakérdések biokémiából humánkineziológia levelező (BSc) 2015 A kérdés 1. A sejtről általában, a szervetlen alkotórészeiről, a vízről részletesen. 2. A sejtről általában, a szervetlen alkotórészeiről,

Részletesebben

b./ Hány gramm szénatomban van ugyanannyi proton, mint 8g oxigénatomban? Hogyan jelöljük ezeket az anyagokat? Egyforma-e minden atom a 8g szénben?

b./ Hány gramm szénatomban van ugyanannyi proton, mint 8g oxigénatomban? Hogyan jelöljük ezeket az anyagokat? Egyforma-e minden atom a 8g szénben? 1. Az atommag. a./ Az atommag és az atom méretének, tömegének és töltésének összehasonlítása, a nukleonok jellemzése, rendszám, tömegszám, izotópok, nuklidok, jelölések. b./ Jelöld a Ca atom 20 neutront

Részletesebben

2. változat. 6. Jelöld meg, hány párosítatlan elektronja van alapállapotban a 17-es rendszámú elemnek! A 1; Б 3; В 5; Г 7.

2. változat. 6. Jelöld meg, hány párosítatlan elektronja van alapállapotban a 17-es rendszámú elemnek! A 1; Б 3; В 5; Г 7. 2. változat 1-től 16-ig terjedő feladatokban négy válaszlehetőség van, amelyek közül csak egy helyes. Válaszd ki a helyes választ és jelöld be a válaszlapon! 1. Melyik sor fejezi be helyesen az állítást:

Részletesebben

A piruvát-dehidrogenáz komplex. Csala Miklós

A piruvát-dehidrogenáz komplex. Csala Miklós A piruvát-dehidrogenáz komplex Csala Miklós szénhidrátok fehérjék lipidek glikolízis glukóz aminosavak zsírsavak acil-koa szintetáz e - piruvát acil-koa légz. lánc H + H + H + O 2 ATP szint. piruvát H

Részletesebben

Makromolekulák. Fehérjetekeredé. rjetekeredés. Biopolimer. Polimerek

Makromolekulák. Fehérjetekeredé. rjetekeredés. Biopolimer. Polimerek Biopolimerek Makromolekulá Makromolekulák. Fehé Fehérjetekeredé rjetekeredés. Osztódó sejt magorsófonala 2011. November 16. Huber Tamá Tamás Dohány levél epidermális sejtjének aktin hálózata Bakteriofágból

Részletesebben

SZAK: KÉMIA Általános és szervetlen kémia 1. A periódusos rendszer 14. csoportja. a) Írják le a csoport nemfémes elemeinek az elektronkonfigurációit

SZAK: KÉMIA Általános és szervetlen kémia 1. A periódusos rendszer 14. csoportja. a) Írják le a csoport nemfémes elemeinek az elektronkonfigurációit SZAK: KÉMIA Általános és szervetlen kémia 1. A periódusos rendszer 14. csoportja. a) Írják le a csoport nemfémes elemeinek az elektronkonfigurációit b) Tárgyalják összehasonlító módon a csoport első elemének

Részletesebben