Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek"

Átírás

1 Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek

2 Hidroxikarbonsavak α-hidroxi karbonsavak -Glikolsav (kézkrémek) - Tejsav (tejtermékek, izomláz, fogszuvasodás) - Citromsav (citrusfélékben, citromsav-ciklus)

3 Hidroxikarbonsavak β-hidroxi karbonsavak -Béta-hidroxivajsav (anyagcseretermék, ketózisdiabétesz) - Szalicilsav (aszpirin, tartósítószer, növényi hormon, fiatalító krémek)) - Karnitin (zsírégető szer, izomfejlődéshez kell)

4 Hidroxikarbonsavak γ-hidroxi karbonsavak -Gamma-hidroxivajsav (GHB, Gina) pszichotrop szer, ingerületátadás (gyógyászat (alváskór ellen, party drog)

5 Oxokarbonsavak (ketosavak) Piroszőlősav (fontos anyagcsere köztitermék) Oxálecetsav (fontos anyagcsere köztitermék) ketoglutársav (aminosav anyagcsere termék)

6 Aminosavak, peptidek, fehérjék 8. előadás

7 3.1 Fehérjék A genetikai információ egyik fő manifesztálódása Számos funkció (katalízis, transzport, váz, mozgás, érzékelés, felismerés, növekedés stb.) Enzimek (biokatalizátorok) Polimerek Aminosav építőegységekből

8 Építőkövek: aminosavak L aminosavak (α amino karbonsavak) 20 (22) fehérjeépítő DNS ben kódolva 25 aminosav (fehérjeépítő aminosavak további módosításával)

9

10 L konfiguráció (kivéve Gly) Ikerionos szerkezet (ph függő)

11 Aminosavak Csoportosítás Apoláris (Gly, Leu, ile, Pro, Ala, Val) Poláris (Cys, Thr, Met, Ser, Asn, Gln, Sec) Savas (Asp, Glu) Bázisos (Arg, Lys, His, Pyl) Aromás (Phe, Trp, Tyr) Esszenciális aminosavak (az állati / emberi) szervezet nem képes előállítani Met, Thr, Lys, Ile, Val, Leu, Phe, Trp, His

12 A peptidkötés Szabad NH2, COOH (NH 3 +, COO - ) N-terminális, C-terminális N C irány oligopeptidek (kb 10 aminosavig) polipeptidek, fehérjék

13 A peptidek / fehérjék szerkezete Elsődleges (primer) szerkezet: az aminosav sorrend /szekvencia Másodlagos (szekunder) szerkezet: a hidrogén hidak által stabilizált, legalább négy aminosavra kiterjedő rendezettség A peptidsíkok által bezárt szögek jellemzik

14 Másodlagos szerkezet α-hélix β-redő β-kanyar

15 Másodlagos szerkezet - α-hélix

16 Másodlagos szerkezet - β-redő (antiparallel)

17 Másodlagos szerkezet - β-kanyar Antiparallel Általában tartalmaz Prolint

18 Fehérjék harmadlagos szerkezete A fehérje 3D szerkezete Összetartó erők Apoláris (diszperziós erők) a fehérje belsejében Ionos kölcsönhatás (kívül) H híd Dipol dipol Kovalens (diszulfidhidak) Globuláris, fibrilláris

19 Fehérjék harmadlagos szerkezete

20 Fehérjék negyedleges szerkezete Ha több polipeptid láncból áll össze a funkcionális fehérje Az alegységek egymáshoz viszonyított helyzete Nem-kovalens összetartó erők Az egész fehérje 3D szerkezete

21

22 A fehérjék szerkezetének felbontása Denaturáció (a hidrátburok elvesztése) Hő, ph, nehézfém ionok, savak, UV sugárzás, elektromos áram stb. hatására Reverzibilis Irreverzibilis Eredeti funkció elvesztése

23 Fehérjék csoportosítása Összetétel szerint - Egyszerű fehérjék (csak aminosavakból áll) - Összetett fehérjék (metallo-, hem-, nukleo-, gliko-, lipo-proteinek) Funkció szerint - enzim, transzport, struktúr, védő, hormon, motor, toxin stb.

24 Enzimek Kémiai reakciót katalizáló fehérjék Csökkentik a reakció E a -ját (átmeneti állapot stabilizáció) Aktív centrum + ligandum(ok) Fischer: kulcs-zár elmélet

25 Kofaktorok (szerves: pl. hem; szvetlen: pl. vas) Kofaktorok: Összetett fehérjék prosztetikus csoport (szorosan kötődik az enzimhez) koenzim lazábban kötődik Enzimeknél: Apoenzim (kofaktor nélkül) holoenzim (kofaktorral) Inhibitorok (enzimgátlók)

26 Aminosavak szintézise Fehérjék lebontásából (elöregedett, táplálék) Esszenciális aminosavak csak táplálékból Újonnan glükózból

27 Aminosavak lebontása Az aminosavak glutaminsavvá alakulnak A glutaminsavból ketoglutaminsav lesz Ebből piruvát, majd belép a citromsav ciklusba

28 Egyéb fontos aminosav γ-aminosav Gamma-aminovajsav (GABA) Neurotranszmitter (ingerületátvivő, gátló hatás)

3. Sejtalkotó molekulák III.

3. Sejtalkotó molekulák III. 3. Sejtalkotó molekulák III. Fehérjék, fehérjeszintézis (transzkripció, transzláció, posztszintetikus módosítások). Enzimműködés 3.1 Fehérjék A genetikai információ egyik fő manifesztálódása Számos funkció

Részletesebben

A fehérjék hierarchikus szerkezete

A fehérjék hierarchikus szerkezete Fehérjék felosztása A fehérjék hierarchikus szerkezete Smeller László Semmelweis Egyetem Biofizikai és Sugárbiológiai Intézet Biológiai funkció alapján Enzimek (pl.: tripszin, citokróm-c ) Transzportfehérjék

Részletesebben

Szerkesztette: Vizkievicz András

Szerkesztette: Vizkievicz András Fehérjék A fehérjék - proteinek - az élő szervezetek számára a legfontosabb vegyületek. Az élet bármilyen megnyilvánulási formája fehérjékkel kapcsolatos. A sejtek szárazanyagának minimum 50 %-át adják.

Részletesebben

A sejtek élete. 5. Robotoló törpék és óriások Az aminosavak és fehérjék R C NH 2. C COOH 5.1. A fehérjeépítőaminosavak általános

A sejtek élete. 5. Robotoló törpék és óriások Az aminosavak és fehérjék R C NH 2. C COOH 5.1. A fehérjeépítőaminosavak általános A sejtek élete 5. Robotoló törpék és óriások Az aminosavak és fehérjék e csak nézd! Milyen protonátmenetes reakcióra képes egy aminosav? R 2 5.1. A fehérjeépítőaminosavak általános képlete 5.2. A legegyszerűbb

Részletesebben

A fehérjék hierarchikus szerkezete

A fehérjék hierarchikus szerkezete Fehérjék felosztása A fehérjék hierarchikus szerkezete Smeller László Semmelweis Egyetem Biofizikai és Sugárbiológiai Intézet Biológiai funkció alapján Enzimek (pl.: tripszin, citokróm-c ) Transzportfehérjék

Részletesebben

A fehérjék szerkezete és az azt meghatározó kölcsönhatások

A fehérjék szerkezete és az azt meghatározó kölcsönhatások A fehérjék szerkezete és az azt meghatározó kölcsönhatások 1. A fehérjék szerepe az élõlényekben 2. A fehérjék szerkezetének szintjei 3. A fehérjék konformációs stabilitásáért felelõs kölcsönhatások 4.

Részletesebben

Bioinformatika 2 5.. előad

Bioinformatika 2 5.. előad 5.. előad adás Prof. Poppe László BME Szerves Kémia és Technológia Tsz. Bioinformatika proteomika Előadás és gyakorlat 2009. 03. 21. Fehérje térszerkezet t megjelenítése A fehérjék meglehetősen összetett

Részletesebben

Aminosavak általános képlete NH 2. Csoportosítás: R oldallánc szerkezete alapján: Semleges. Esszenciális aminosavak

Aminosavak általános képlete NH 2. Csoportosítás: R oldallánc szerkezete alapján: Semleges. Esszenciális aminosavak Aminosavak 1 Aminosavak általános képlete N 2 soportosítás: oldallánc szerkezete alapján: Apoláris Poláris Bázikus Savas Semleges Esszenciális aminosavak 2 (apoláris) Glicin Név Gly 3 Alanin Ala 3 3 Valin

Részletesebben

A fehérjék harmadlagos vagy térszerkezete. Még a globuláris fehérjék térszerkezete is sokféle lehet.

A fehérjék harmadlagos vagy térszerkezete. Még a globuláris fehérjék térszerkezete is sokféle lehet. A fehérjék harmadlagos vagy térszerkezete Még a globuláris fehérjék térszerkezete is sokféle lehet. A ribonukleáz redukciója és denaturálódása Chrisian B. Anfinsen A ribonukleáz renaturálódása 1972 obel-díj

Részletesebben

9. Előadás Fehérjék Előzmények Peptidkémia Analitikai kémia Protein kémia 1901 E.Fischer : Gly-Gly 1923 F. Pregl : Mikroanalitika 1952 Stein and Moore : Aminosav analizis 1932 Bergman és Zervas : Benziloxikarbonil

Részletesebben

4. FEHÉRJÉK. 2. Vázanyagok. Az izmok alkotórésze (pl.: a miozin). Inak, izületek, csontok szerves komponensei, az ún. vázfehérjék (szkleroproteinek).

4. FEHÉRJÉK. 2. Vázanyagok. Az izmok alkotórésze (pl.: a miozin). Inak, izületek, csontok szerves komponensei, az ún. vázfehérjék (szkleroproteinek). 4. FEÉRJÉK 4.0. Bevezetés A fehérjék elsısorban α-l-aminosavakból felépülı biopolimerek. A csak α-laminosavakat tartalmazó fehérjék a proteinek. evüket a görög proteios szóból kapták, ami elsırangút jelent.

Részletesebben

Az aminosav anyagcsere orvosi vonatkozásai Csősz Éva

Az aminosav anyagcsere orvosi vonatkozásai Csősz Éva Az aminosav anyagcsere orvosi vonatkozásai Csősz Éva E-mail: cseva@med.unideb.hu Általános reakciók az aminosav anyagcserében 1. Nitrogén eltávolítás: transzaminálás dezaminálás: oxidatív nem oxidatív

Részletesebben

Szerkesztette: Vizkievicz András

Szerkesztette: Vizkievicz András Fehérjék A fehérjék - proteinek - az élő szervezetek számára a legfontosabb vegyületek. Az élet bármilyen megnyilvánulási formája fehérjékkel kapcsolatos. A sejtek szárazanyagának minimum 50 %-át adják.

Részletesebben

Fehérjeszerkezet, és tekeredés

Fehérjeszerkezet, és tekeredés Fehérjeszerkezet, és tekeredés Futó Kinga 2013.10.08. Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983

Részletesebben

FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest,

FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest, FEHÉRJÉK A MÁGNESEKBEN Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium Alkímia Ma, Budapest, 2013.02.28. I. FEHÉRJÉK: L-α aminosavakból felépülő lineáris polimerek α H 2 N CH COOH amino

Részletesebben

1. Tömegszámváltozás nélkül milyen részecskéket bocsáthatnak ki magukból a bomlékony atommagok?

1. Tömegszámváltozás nélkül milyen részecskéket bocsáthatnak ki magukból a bomlékony atommagok? A 2004/2005. tanévi Országos Középiskolai Tanulmányi Verseny első (iskolai) fordulójának feladatlapja KÉMIÁBÓL I-II. kategória I. FELADATSOR Az I. feladatsorban húsz kérdés szerepel. Minden kérdés után

Részletesebben

Az enzimek katalitikus aktivitású fehérjék. Jellemzőik: bonyolult szerkezet, nagy molekulatömeg, kolloidális sajátságok, alakváltozás, polaritás.

Az enzimek katalitikus aktivitású fehérjék. Jellemzőik: bonyolult szerkezet, nagy molekulatömeg, kolloidális sajátságok, alakváltozás, polaritás. Enzimek Az enzimek katalitikus aktivitású fehérjék Jellemzőik: bonyolult szerkezet, nagy molekulatömeg, kolloidális sajátságok, alakváltozás, polaritás. Az enzim lehet: csak fehérje: Ribonukleáz A, lizozim,

Részletesebben

INFORMATIKA EMELT SZINT%

INFORMATIKA EMELT SZINT% Szövegszerkesztés, prezentáció, grafika, weblapkészítés 1. A fényképezés története Táblázatkezelés 2. Maradékos összeadás Adatbázis-kezelés 3. Érettségi Algoritmizálás, adatmodellezés 4. Fehérje Maximális

Részletesebben

A glükóz reszintézise.

A glükóz reszintézise. A glükóz reszintézise. A glükóz reszintézise. A reszintézis nem egyszerű megfordítása a glikolízisnek. A glikolízis 3 irrevezibilis lépése más úton játszódik le. Ennek oka egyrészt energetikai, másrészt

Részletesebben

AMINOSAVAK, FEHÉRJÉK

AMINOSAVAK, FEHÉRJÉK AMINOSAVAK, FEHÉRJÉK Az aminosavak olyan szerves vegyületek, amelyek molekulájában aminocsoport (-NH2) és karboxilcsoport (-COOH) egyaránt előfordul. Felosztás A fehérjéket feloszthatjuk aszerint, hogy

Részletesebben

A Ca 2+ szerepe a tormaperoxidáz enzim aktív szerkezetében. Szigeti Krisztián

A Ca 2+ szerepe a tormaperoxidáz enzim aktív szerkezetében. Szigeti Krisztián A Ca 2+ szerepe a tormaperoxidáz enzim aktív szerkezetében Doktori értekezés Szigeti Krisztián Semmelweis Egyetem Gyógyszertudományok Doktori Iskola Témavezető: Hivatalos Bírálók: Szigorlati Bizottság

Részletesebben

BIOMOLEKULÁK KÉMIÁJA. Novák-Nyitrai-Hazai

BIOMOLEKULÁK KÉMIÁJA. Novák-Nyitrai-Hazai BIOMOLEKULÁK KÉMIÁJA Novák-Nyitrai-Hazai A tankönyv elsısorban szerves kémiai szempontok alapján tárgyalja az élı szervezetek felépítésében és mőködésében kulcsfontosságú szerves vegyületeket. A tárgyalás-

Részletesebben

A felépítő és lebontó folyamatok. Biológiai alapismeretek

A felépítő és lebontó folyamatok. Biológiai alapismeretek A felépítő és lebontó folyamatok Biológiai alapismeretek Anyagforgalom: Lebontó Felépítő Lebontó folyamatok csoportosítása: Biológiai oxidáció Erjedés Lebontó folyamatok összehasonlítása Szénhidrátok

Részletesebben

TAKARMÁNYOZÁSTAN. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010

TAKARMÁNYOZÁSTAN. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 TAKARMÁNYOZÁSTAN Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 Takarmányok fehérjetartalma Az állati szervezet létfontosságú vegyületei fehérje természetűek Az állati termékek

Részletesebben

Élettan. előadás tárgykód: bf1c1b10 ELTE TTK, fizika BSc félév: 2015/2016., I. időpont: csütörtök, 8:15 9:45

Élettan. előadás tárgykód: bf1c1b10 ELTE TTK, fizika BSc félév: 2015/2016., I. időpont: csütörtök, 8:15 9:45 Élettan előadás tárgykód: bf1c1b10 ELTE TTK, fizika BSc félév: 2015/2016., I. időpont: csütörtök, 8:15 9:45 oktató: Dr. Tóth Attila, adjunktus ELTE TTK Biológiai Intézet, Élettani és Neurobiológiai tanszék

Részletesebben

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin.

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin. Myoglobin Fehérje-szerkezetek! MGLSDGEWQLVLNVWGKVEADIPGGQEVLIRLFK GPETLEKFDKFKLKSEDEMKASE DLKKGATVLTALGGILKKKGEAEIKPLAQSA TKKIPVKYLEFISECIIQVLQSK PGDFGADAQGAMNKALELFRKDMASNYKELGFQG Fuxreiter Mónika! Debreceni

Részletesebben

Nemzeti Akkreditáló Testület. SZŰKÍTETT RÉSZLETEZŐ OKIRAT (2) a NAT-1-1560/2012 nyilvántartási számú akkreditált státuszhoz

Nemzeti Akkreditáló Testület. SZŰKÍTETT RÉSZLETEZŐ OKIRAT (2) a NAT-1-1560/2012 nyilvántartási számú akkreditált státuszhoz Nemzeti Akkreditáló Testület SZŰKÍTETT RÉSZLETEZŐ OKIRAT (2) a NAT-1-1560/2012 nyilvántartási számú akkreditált státuszhoz A Bonafarm-Bábolna Takarmány Kft. Vizsgálólaboratórium (2942 Nagyigmánd, Burgert

Részletesebben

Kollokviumi vizsgakérdések biokémiából humánkineziológia levelező (BSc) 2015

Kollokviumi vizsgakérdések biokémiából humánkineziológia levelező (BSc) 2015 Kollokviumi vizsgakérdések biokémiából humánkineziológia levelező (BSc) 2015 A kérdés 1. A sejtről általában, a szervetlen alkotórészeiről, a vízről részletesen. 2. A sejtről általában, a szervetlen alkotórészeiről,

Részletesebben

A piruvát-dehidrogenáz komplex. Csala Miklós

A piruvát-dehidrogenáz komplex. Csala Miklós A piruvát-dehidrogenáz komplex Csala Miklós szénhidrátok fehérjék lipidek glikolízis glukóz aminosavak zsírsavak acil-koa szintetáz e - piruvát acil-koa légz. lánc H + H + H + O 2 ATP szint. piruvát H

Részletesebben

Az élő szervezetek felépítése I. Biogén elemek biomolekulák alkotóelemei a természetben előforduló elemek közül 22 fordul elő az élővilágban O; N; C; H; P; és S; - élő anyag 99%-a Biogén elemek sajátosságai:

Részletesebben

Farmakológus szakasszisztens Farmakológus szakasszisztens 2/34

Farmakológus szakasszisztens Farmakológus szakasszisztens 2/34 -06 Farmakológus szakasszisztens feladatok A 0/007 (II. 7.) SzMM rendelettel módosított /006 (II. 7.) OM rendelet Országos Képzési Jegyzékről és az Országos Képzési Jegyzékbe történő felvétel és törlés

Részletesebben

Fémionok szerepe az élő szervezetben: a bioszervetlen kémia alapjainak megismerése

Fémionok szerepe az élő szervezetben: a bioszervetlen kémia alapjainak megismerése Fémionok szerepe az élő szervezetben: a bioszervetlen kémia alapjainak megismerése Előadó: Lihi Norbert Debreceni Egyetem Szervetlen és Analitikai Kémiai Tanszék Bioszervetlen Kémiai Kutatócsoport A bioszervetlen

Részletesebben

1. Az élő szervezetek felépítése és az életfolyamatok 17

1. Az élő szervezetek felépítése és az életfolyamatok 17 Élődi Pál BIOKÉMIA vomo; Akadémiai Kiadó, Budapest 1980 Tartalom Bevezetés 1. Az élő szervezetek felépítése és az életfolyamatok 17 Mi jellemző az élőre? 17. Biogén elemek 20. Biomolekulák 23. A víz 26.

Részletesebben

1. jelentésük. Nevüket az alkotó szén, hidrogén, oxigén 1 : 2 : 1 arányából hajdan elképzelt képletről [C n (H 2 O) m ] kapták.

1. jelentésük. Nevüket az alkotó szén, hidrogén, oxigén 1 : 2 : 1 arányából hajdan elképzelt képletről [C n (H 2 O) m ] kapták. Összefoglalás II. Szénhidrátok 1. jelentésük Nevüket az alkotó szén, hidrogén, oxigén 1 : 2 : 1 arányából hajdan elképzelt képletről [C n (H 2 O) m ] kapták. Ha ezeket az anyagokat hevítjük vizet vesztenek

Részletesebben

Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete

Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete Polipeptidek térszerkezete Tipikus (rendezett) konformerek em tipikus (rendezetlen) konformerek Periodikus vagy homokonformerek Aperiodikus

Részletesebben

CHO CH 2 H 2 H HO H H O H OH OH OH H

CHO CH 2 H 2 H HO H H O H OH OH OH H 2. Előadás A szénhidrátok kémiai reakciói, szénhidrátszármazékok Áttekintés 1. Redukció 2. xidáció 3. Észter képzés 4. Reakciók a karbonil atomon 4.1. iklusos félacetál képzés 4.2. Reakció N-nukleofillel

Részletesebben

(11) Lajstromszám: E 007 952 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA

(11) Lajstromszám: E 007 952 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU00000792T2! (19) HU (11) Lajstromszám: E 007 92 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 04 73892 (22) A bejelentés napja:

Részletesebben

A tejfehérje és a fehérjeellátás

A tejfehérje és a fehérjeellátás A tejfehérje A tejfehérje és a fehérjeellátás Fejlődő országok: a lakosság 20 30%-a hiányosan ellátott fehérjével. Fejlett ipari országok: fehérje túlfogyasztás. Az emberiség éves fehérjeszükséglete: 60

Részletesebben

3. Aminosavak gyártása

3. Aminosavak gyártása 3. Aminosavak gyártása Előállításuk Fehérje-hidrolizátumokból: cisztein, leucin, aszparaginsav, tirozin, glutaminsav Kémiai szintézissel: metionin, glicin, alanin, triptofán (reszolválás szükséges) Biotechnológiai

Részletesebben

Aminosavak, peptidek, fehérjék. Béres Csilla

Aminosavak, peptidek, fehérjék. Béres Csilla Aminosavak, peptidek, fehérjék Béres Csilla Aminosavak Az aminosavak (más néven aminokarbonsavak) olyan szerves vegyületek, amelyek molekulájában aminocsoport (- NH 2 ) és karboxilcsoport (-COOH) egyaránt

Részletesebben

A bioenergetika a biokémiai folyamatok során lezajló energiaváltozásokkal foglalkozik.

A bioenergetika a biokémiai folyamatok során lezajló energiaváltozásokkal foglalkozik. Modul cím: MEDICINÁLIS ALAPISMERETEK BIOKÉMIA BIOENERGETIKA I. 1. kulcsszó cím: Energia A termodinamika első főtétele kimondja, hogy a különböző energiafajták átalakulhatnak egymásba ez az energia megmaradásának

Részletesebben

Részletes tematika: I. Félév: 1. Hét (4 óra): 2. hét (4 óra): 3. hét (4 óra): 4. hét (4 óra):

Részletes tematika: I. Félév: 1. Hét (4 óra): 2. hét (4 óra): 3. hét (4 óra): 4. hét (4 óra): Részletes tematika: I. Félév: 1. Hét (4 óra): Szerves Vegyületek Szerkezete. Kötéselmélet Lewis kötéselmélet; atompálya, molekulapálya; molekulapálya elmélet; átlapolódás, orbitálok hibridizációja; molekulák

Részletesebben

Az élő anyag szerkezeti egységei: víz, nukleinsavak, fehérjék. elrendeződés, rend, rendszer, periodikus ismétlődés

Az élő anyag szerkezeti egységei: víz, nukleinsavak, fehérjék. elrendeződés, rend, rendszer, periodikus ismétlődés Az élő anyag szerkezeti egységei: víz, nukleinsavak, fehérjék Agócs Gergely 2013. december 3. kedd 10:00 11:40 1. Mit értünk élő anyag alatt? Az élő szervezetet felépítő anyagok. Az anyag azonban nem csupán

Részletesebben

BIOGÉN ELEMEK MÁSODLAGOS BIOGÉN ELEMEK (> 0,005 %)

BIOGÉN ELEMEK MÁSODLAGOS BIOGÉN ELEMEK (> 0,005 %) BIOGÉN ELEMEK ELSŐDLEGES BIOGÉN ELEMEK(kb. 95%) ÁLLANDÓ BIOGÉN ELEMEK MAKROELEMEK MÁSODLAGOS BIOGÉN ELEMEK (> 0,005 %) C, H, O, N P, S, Cl, Na, K, Ca, Mg MIKROELEMEK (NYOMELEMEK) (< 0,005%) I, Fe, Cu,

Részletesebben

Glikolízis. emberi szervezet napi glukózigénye: kb. 160 g

Glikolízis. emberi szervezet napi glukózigénye: kb. 160 g Glikolízis Minden emberi sejt képes glikolízisre. A glukóz a metabolizmus központi tápanyaga, minden sejt képes hasznosítani. glykys = édes, lysis = hasítás emberi szervezet napi glukózigénye: kb. 160

Részletesebben

6. változat. 3. Jelöld meg a nem molekuláris szerkezetű anyagot! A SO 2 ; Б C 6 H 12 O 6 ; В NaBr; Г CO 2.

6. változat. 3. Jelöld meg a nem molekuláris szerkezetű anyagot! A SO 2 ; Б C 6 H 12 O 6 ; В NaBr; Г CO 2. 6. változat Az 1-től 16-ig terjedő feladatokban négy válaszlehetőség van, amelyek közül csak egy helyes. Válaszd ki a helyes választ és jelöld be a válaszlapon! 1. Jelöld meg azt a sort, amely helyesen

Részletesebben

A genetikai lelet értelmezése monogénes betegségekben

A genetikai lelet értelmezése monogénes betegségekben A genetikai lelet értelmezése monogénes betegségekben Tory Kálmán Semmelweis Egyetem, I. sz. Gyermekklinika A ~20 ezer fehérje-kódoló gén a 23 pár kromoszómán A kromoszómán található bázisok száma: 250M

Részletesebben

A METABOLIZMUS ENERGETIKÁJA

A METABOLIZMUS ENERGETIKÁJA A METABOLIZMUS ENERGETIKÁJA Futó Kinga 2014.10.01. Metabolizmus Metabolizmus = reakciók együttese, melyek a sejtekben lejátszódnak. Energia nyerés szempontjából vannak fototrófok ill. kemotrófok. szervesanyag

Részletesebben

Gáspári Zoltán. Élő molekulák az élet molekulái

Gáspári Zoltán. Élő molekulák az élet molekulái Gáspári Zoltán Élő molekulák az élet molekulái Invokáció Kajtár Márton 1929-1991 www.eotvoskiado.hu Élő és élettelen? Élő és élettelen: a kemoton Élő kémiai rendszer, de nem élőlény (Gánti, 1975) Autokatalitikus

Részletesebben

A tananyag felépítése: A BIOLÓGIA ALAPJAI. I. Prokarióták és eukarióták. Az eukarióta sejt. Pécs Miklós: A biológia alapjai

A tananyag felépítése: A BIOLÓGIA ALAPJAI. I. Prokarióták és eukarióták. Az eukarióta sejt. Pécs Miklós: A biológia alapjai A BIOLÓGIA ALAPJAI A tananyag felépítése: Környezetmérnök és műszaki menedzser hallgatók számára Előadó: 2 + 0 + 0 óra, félévközi számonkérés 3 ZH: október 3, november 5, december 5 dr. Pécs Miklós egyetemi

Részletesebben

FEHÉRJESZINTÉZIS: a transzláció mechanizmusa és a polipeptidlánc további sorsa. Bay Péter

FEHÉRJESZINTÉZIS: a transzláció mechanizmusa és a polipeptidlánc további sorsa. Bay Péter FEHÉRJESZINTÉZIS: a transzláció mechanizmusa és a polipeptidlánc további sorsa Bay Péter Fehérjeszintézis és poszttranszlációs módosítások A kódszótár A riboszóma szerkezete A fehérjeszintézis (transzláció)

Részletesebben

IPARI ENZIMEK 2. Proteázok. Alkalikus proteázok. Pécs Miklós: Biotermék technológia 1. 6. fejezet: Ipari enzimek 2.

IPARI ENZIMEK 2. Proteázok. Alkalikus proteázok. Pécs Miklós: Biotermék technológia 1. 6. fejezet: Ipari enzimek 2. IPARI ENZIMEK 2 Proteázok A proteázok az ipari enzimek egyik legfontosabb csoportja (6200 t tiszta E/év) Peptid kötéseket bont (létrehoz) (hidrolízis, szintézis) Fehérje lebontás: élelmiszer, tejalvadás,

Részletesebben

Szerves Kémia II. Dr. Patonay Tamás egyetemi tanár E 405 Tel:

Szerves Kémia II. Dr. Patonay Tamás egyetemi tanár E 405 Tel: Szerves Kémia II. TKBE0312 Előfeltétel: TKBE03 1 Szerves kémia I. Előadás: 2 óra/hét Dr. Patonay Tamás egyetemi tanár E 405 Tel: 22464 tpatonay@puma.unideb.hu A 2010/11. tanév tavaszi félévében az előadás

Részletesebben

Fehérjeszerkezet, fehérjetekeredés

Fehérjeszerkezet, fehérjetekeredés Fehérjeszerkezet, fehérjetekeredés A fehérjeszerkezet szintjei A fehérjetekeredés elmélete: Anfinsen kísérlet Levinthal paradoxon A feltekeredés tölcsér elmélet 2014.11.05. Aminosavak és fehérjeszerkezet

Részletesebben

Nukleinsavak építőkövei

Nukleinsavak építőkövei ukleinsavak Szerkezeti hierarchia ukleinsavak építőkövei Pirimidin Purin Pirimidin Purin Timin (T) Adenin (A) Adenin (A) Citozin (C) Guanin (G) DS bázisai bázis Citozin (C) Guanin (G) RS bázisai bázis

Részletesebben

Szerves kémia III. TERMÉSZETES VEGYÜLETEK KÉMIÁJA. Dr. Juhászné Dr. Tóth Éva Szerves Kémiai Tanszék

Szerves kémia III. TERMÉSZETES VEGYÜLETEK KÉMIÁJA. Dr. Juhászné Dr. Tóth Éva Szerves Kémiai Tanszék Szerves kémia III. TERMÉSZETES VEGYÜLETEK KÉMIÁJA Dr. Juhászné Dr. Tóth Éva Szerves Kémiai Tanszék Fontos információk Előadó: Dr. Juhászné Dr. Tóth Éva Elérhetőség: Iroda: Kémia épület, E-423 vagy E-422

Részletesebben

SZERVES KÉMIAI REAKCIÓEGYENLETEK

SZERVES KÉMIAI REAKCIÓEGYENLETEK SZERVES KÉMIAI REAKCIÓEGYENLETEK Budapesti Reáltanoda Fontos! Sok reakcióegyenlet több témakörhöz is hozzátartozik. Szögletes zárójel jelzi a reakciót, ami más témakörnél található meg. Alkánok, cikloalkánok

Részletesebben

(11) Lajstromszám: E 008 218 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA

(11) Lajstromszám: E 008 218 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000008218T2! (19) HU (11) Lajstromszám: E 008 218 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 03 77992 (22) A bejelentés napja:

Részletesebben

ПРОГРАМА ВСТУПНОГО ВИПРОБУВАННЯ З ХІМІЇ Для вступників на ІІ курс навчання за освітньо-кваліфікаційним рівнем «бакалавр»

ПРОГРАМА ВСТУПНОГО ВИПРОБУВАННЯ З ХІМІЇ Для вступників на ІІ курс навчання за освітньо-кваліфікаційним рівнем «бакалавр» ЗАКАРПАТСЬКИЙ УГОРСЬКИЙ ІНСТИТУТ ІМ. Ф. РАКОЦІ ІІ КАФЕДРА МАТЕМАТИКИ ТА ІНФОРМАТИКИ II. RÁKÓCZI FERENC KÁRPÁTALJAI MAGYAR FŐISKOLA MATEMATIKA ÉS INFORMATIKA TANSZÉK ПРОГРАМА ВСТУПНОГО ВИПРОБУВАННЯ З ХІМІЇ

Részletesebben

Atomszerkezet. Atommag protonok, neutronok + elektronok. atompályák, alhéjak, héjak, atomtörzs ---- vegyérték elektronok

Atomszerkezet. Atommag protonok, neutronok + elektronok. atompályák, alhéjak, héjak, atomtörzs ---- vegyérték elektronok Atomszerkezet Atommag protonok, neutronok + elektronok izotópok atompályák, alhéjak, héjak, atomtörzs ---- vegyérték elektronok periódusos rendszer csoportjai Periódusos rendszer A kémiai kötés Kémiai

Részletesebben

Fehérjeszerkezet, és tekeredés. Futó Kinga

Fehérjeszerkezet, és tekeredés. Futó Kinga Fehérjeszerkezet, és tekeredés Futó Kinga Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983 H 211861 N

Részletesebben

FEHÉRJESZINTÉZIS: a transzláció mechanizmusa és a polipeptidlánc további sorsa. Gergely Pál 2009

FEHÉRJESZINTÉZIS: a transzláció mechanizmusa és a polipeptidlánc további sorsa. Gergely Pál 2009 FEHÉRJESZINTÉZIS: a transzláció mechanizmusa és a polipeptidlánc további sorsa Gergely Pál 2009 Fehérjeszintézis és poszttranszlációs módosítások A kódszótár A riboszóma szerkezete A fehérjeszintézis (transzláció)

Részletesebben

A nukleinsavak polimer vegyületek. Mint polimerek, monomerekből épülnek fel, melyeket nukleotidoknak nevezünk.

A nukleinsavak polimer vegyületek. Mint polimerek, monomerekből épülnek fel, melyeket nukleotidoknak nevezünk. Nukleinsavak Szerkesztette: Vizkievicz András A nukleinsavakat először a sejtek magjából sikerült tiszta állapotban kivonni. Innen a név: nucleus = mag (lat.), a sav a kémhatásukra utal. Azonban nukleinsavak

Részletesebben

Hatékony tumorellenes készítmények előállítása target és drug molekulák kombinációjával (Zárójelentés)

Hatékony tumorellenes készítmények előállítása target és drug molekulák kombinációjával (Zárójelentés) Hatékony tumorellenes készítmények előállítása target és drug molekulák kombinációjával (Zárójelentés) Prof. Dr. Mező Gábor tudományos tanácsadó Kutatásunk célja az volt, hogy olyan biokonjugátumokat készítsünk,

Részletesebben

Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete

Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete Polipeptidek térszerkezete Tipikus (rendezett) konformerek em tipikus (rendezetlen) konformerek Periodikus vagy homokonformerek Aperiodikus

Részletesebben

2. Aminosavak - Treonin

2. Aminosavak - Treonin Az aminosavak felhasználása nátrium-glutamát ízfokozó (Delikát, Vegeta) lizin, metionin, treonin, triptofán takarmány- és élelmiszerkiegészítő aszparaginsav és fenilalanin aszpartám édesítőszer gyártásához

Részletesebben

TRANSZLÁCIÓ és fehérje transzport Hogyan lesz a DNS-ben kódolt információból fehérje? A DNS felszínén az aminosavak sorba állnak?

TRANSZLÁCIÓ és fehérje transzport Hogyan lesz a DNS-ben kódolt információból fehérje? A DNS felszínén az aminosavak sorba állnak? TRANSZLÁCIÓ és fehérje transzport Hogyan lesz a DNS-ben kódolt információból fehérje? A DNS felszínén az aminosavak sorba állnak? mrns, trns, riboszómák felfedezése A GENETIKAI KÓD 20 AS és csak 4 bázis,

Részletesebben

,:/ " \ OH OH OH - 6 - / \ O / H / H HO-CH, O, CH CH - OH ,\ / "CH - ~(H CH,-OH \OH. ,-\ ce/luló z 5zer.~ezere

,:/  \ OH OH OH - 6 - / \ O / H / H HO-CH, O, CH CH - OH ,\ / CH - ~(H CH,-OH \OH. ,-\ ce/luló z 5zer.~ezere - 6 - o / \ \ o / \ / \ () /,-\ ce/luló z 5zer.~ezere " C=,1 -- J - 1 - - ---,:/ " - -,,\ / " - ~( / \ J,-\ ribóz: a) r.yílt 12"('.1, b) gyürus íormája ~.. ~ en;én'. fu5 héli'(ef1e~: egy menete - 7-5.

Részletesebben

Fehérje szintézis 2. TRANSZLÁCIÓ Molekuláris biológia kurzus 7. hét. Kun Lídia Genetikai, Sejt- és immunbiológiai Intézet

Fehérje szintézis 2. TRANSZLÁCIÓ Molekuláris biológia kurzus 7. hét. Kun Lídia Genetikai, Sejt- és immunbiológiai Intézet Fehérje szintézis 2. TRANSZLÁCIÓ Molekuláris biológia kurzus 7. hét Kun Lídia Genetikai, Sejt- és immunbiológiai Intézet Gén mrns Fehérje Transzkripció Transzláció A transzkriptum : mrns Hogyan mutatható

Részletesebben

Doktori értekezés. Kiss András László 2007. Témavezető: Polgár László professzor. 1. oldal

Doktori értekezés. Kiss András László 2007. Témavezető: Polgár László professzor. 1. oldal Doktori értekezés Kiss András László 2007 Témavezető: Polgár László professzor 1. oldal Acylaminoacyl peptidáz enzimek katalízisének vizsgálata A dolgozatot készítette: Biológia Doktori Iskola Szerkezeti

Részletesebben

HŐ (q) és MUNKA (w): energia átmenet közben a rendszer és környezete között. A különböző energiafajták átalakulásukkor végső soron termikus energiává

HŐ (q) és MUNKA (w): energia átmenet közben a rendszer és környezete között. A különböző energiafajták átalakulásukkor végső soron termikus energiává TERMODINAMIKA 1 HŐ (q) és MUNKA (w): energia átmenet közben a rendszer és környezete között. A különböző energiafajták átalakulásukkor végső soron termikus energiává degradálódnak (disszipáció). BELSŐ

Részletesebben

NMR a peptid- és fehérje-kutatásban

NMR a peptid- és fehérje-kutatásban NMR a peptid- és fehérje-kutatásban A PDB adatbázisban megtalálható NMR alapú fehérjeszerkezetek számának alakulása az elmúlt évek során 4000 3500 3000 2500 2000 1500 1000 500 0 1987 1988 1989 1990 1991

Részletesebben

Inzulinutánzó vanádium-, és cinkkomplexek kölcsönhatásának vizsgálata vérszérum fehérjékkel

Inzulinutánzó vanádium-, és cinkkomplexek kölcsönhatásának vizsgálata vérszérum fehérjékkel Inzulinutánzó vanádium-, és cinkkomplexek kölcsönhatásának vizsgálata vérszérum fehérjékkel Mivel a vizsgált komplexek inzulinutánzó hatása összetett és a hatásmechanizmusuk csak részben feltárt az irodalomban,

Részletesebben

Riboszóma. Golgi. Molekuláris sejtbiológia

Riboszóma. Golgi. Molekuláris sejtbiológia Molekuláris sejtbiológia d-er Riboszóma Golgi Dr. habil KŐHIDAI László egyetemi docens Semmelweis Egyetem, Genetikai, Sejt- és Immunbiológiai Intézet 2005. október 27. Endoplamatikus = sejten belüli; retikulum

Részletesebben

Szénhidrátok monoszacharidok formájában szívódnak fel a vékonybélből.

Szénhidrátok monoszacharidok formájában szívódnak fel a vékonybélből. Vércukorszint szabályozása: Szénhidrátok monoszacharidok formájában szívódnak fel a vékonybélből. Szövetekben monoszacharid átalakítás enzimjei: Szénhidrát anyagcserében máj központi szerepű. Szénhidrát

Részletesebben

Aminosavak, peptidek, fehérjék

Aminosavak, peptidek, fehérjék Aminosavak, peptidek, fehérjék Az aminosavak a fehérjék építőkövei. A fehérjék felépítésében mindössze 20- féle aminosav vesz részt. Ezek általános képlete: Az aminosavakban, mint arra nevük is utal van

Részletesebben

Fehérjebiotechnológia Emri, Tamás Csősz, Éva Tőzsér, József Szerkesztette Tőzsér, József, Debreceni Egyetem

Fehérjebiotechnológia Emri, Tamás Csősz, Éva Tőzsér, József Szerkesztette Tőzsér, József, Debreceni Egyetem Fehérjebiotechnológia Emri, Tamás Csősz, Éva Tőzsér, József Szerkesztette Tőzsér, József, Debreceni Egyetem Fehérjebiotechnológia írta Emri, Tamás, Csősz, Éva, Tőzsér, József, Tőzsér, József, és Szerzői

Részletesebben

Aminosav anyagcsere. Dr. Vér Ágota Egyetemi docens 2012

Aminosav anyagcsere. Dr. Vér Ágota Egyetemi docens 2012 Aminosav anyagcsere Dr. Vér Ágota Egyetemi docens 2012 A NITROGÉN EGYENSÚLY Esszenciális és nem esszenciális aminosavak 1. Mennyiségi szükséglet Fehérje bevitel: 0,8 g/ts.kg /nap 1,0-1,1 g/ts.kg /nap :

Részletesebben

GYOMOR. EGYES SZERVEK ÉS SZERVREND- SZEREK BIOKÉMIAI MŰKÖDÉSEI 1. Az emésztés és felszívódás PEPSZIN GYOMOR 2. PATKÓBÉL, DUODENUM

GYOMOR. EGYES SZERVEK ÉS SZERVREND- SZEREK BIOKÉMIAI MŰKÖDÉSEI 1. Az emésztés és felszívódás PEPSZIN GYOMOR 2. PATKÓBÉL, DUODENUM EGYES SZERVEK ÉS SZERVREND- SZEREK BIOKÉMIAI MŰKÖDÉSEI 1. Az emésztés és felszívódás biokémiája Az emésztőcsatorna szakaszai: Szájüreg: - mechanikai aprítás - megfelelő konzisztencia kialakítása (nyál).

Részletesebben

Tartalmi követelmények kémia tantárgyból az érettségin K Ö Z É P S Z I N T

Tartalmi követelmények kémia tantárgyból az érettségin K Ö Z É P S Z I N T 1. Általános kémia Atomok és a belőlük származtatható ionok Molekulák és összetett ionok Halmazok A kémiai reakciók A kémiai reakciók jelölése Termokémia Reakciókinetika Kémiai egyensúly Reakciótípusok

Részletesebben

KÉMIA 9-12. évfolyam (Esti tagozat)

KÉMIA 9-12. évfolyam (Esti tagozat) KÉMIA 9-12. évfolyam (Esti tagozat) A kémiai alapműveltség az anyagi világ megismerésének és megértésének egyik fontos eszköze. A kémia tanulása olyan folyamat, amely tartalmain és tevékenységein keresztül

Részletesebben

folsav, (a pteroil-glutaminsav vagy B 10 vitamin) dihidrofolsav tetrahidrofolsav N CH 2 N H H 2 N COOH

folsav, (a pteroil-glutaminsav vagy B 10 vitamin) dihidrofolsav tetrahidrofolsav N CH 2 N H H 2 N COOH folsav, (a pteroil-glutaminsav vagy B 10 vitamin) 2 2 2 2 pirimidin rész pirazin rész aminobenzoesav rész glutaminsav rész pteridin rész dihidrofolsav 2 2 2 2 tetrahidrofolsav 2 2 2 2 A dihidrofolát-reduktáz

Részletesebben

AJÁNLOTT IRODALOM. A tárgy neve BIOKÉMIA I. Meghirdető tanszék(csoport) SZTE TTK, Biokémiai Tanszék Felelős oktató:

AJÁNLOTT IRODALOM. A tárgy neve BIOKÉMIA I. Meghirdető tanszék(csoport) SZTE TTK, Biokémiai Tanszék Felelős oktató: A tárgy neve BIOKÉMIA I. Meghirdető tanszék(csoport) SZTE TTK, Biokémiai Tanszék Felelős oktató: Dr Lehoczki Endréné Kredit 2 Heti óraszám 2 típus Előadás Számonkérés Kollokvium Teljesíthetőség feltétele

Részletesebben

7. évfolyam kémia osztályozó- és pótvizsga követelményei Témakörök: 1. Anyagok tulajdonságai és változásai (fizikai és kémiai változás) 2.

7. évfolyam kémia osztályozó- és pótvizsga követelményei Témakörök: 1. Anyagok tulajdonságai és változásai (fizikai és kémiai változás) 2. 7. évfolyam kémia osztályozó- és pótvizsga követelményei 1. Anyagok tulajdonságai és változásai (fizikai és kémiai változás) 2. Hőtermelő és hőelnyelő folyamatok, halmazállapot-változások 3. A levegő,

Részletesebben

Ízérzet: az oldatok ingerkeltő hatása az agyközpontban.

Ízérzet: az oldatok ingerkeltő hatása az agyközpontban. Íz- és aromaanyagok Ízérzet: az oldatok ingerkeltő hatása az agyközpontban. Szagérzet: gázállapotú anyagok agyközpontban keletkező tudata; szaglás + ízérzet együttesen = zamat Zamatanyagok Ingerküszöb:

Részletesebben

A polipeptidlánc szabályozott lebontása: mit mondanak a fehérjekristályok? Harmat Veronika ELTE Kémiai Intézet, Szerkezeti Kémia és Biológia Laboratórium MTA-ELTE Fehérjemodellező Kutatócsoport A magyar

Részletesebben

Az anyagi rendszer fogalma, csoportosítása

Az anyagi rendszer fogalma, csoportosítása Az anyagi rendszer fogalma, csoportosítása A bemutatót összeállította: Fogarasi József, Petrik Lajos SZKI, 2011 1 1 A rendszer fogalma A körülöttünk levő anyagi világot atomok, ionok, molekulák építik

Részletesebben

BME Alkalmazott Biotechnológia és Élelmiszertudomány Tanszék 1

BME Alkalmazott Biotechnológia és Élelmiszertudomány Tanszék 1 EC 2. TRANSZFERÁZK: EC 2.4. Transzglikozilálás v. transzglikozilezés Mikrobiális poliszacharidok R 1 - - R 2 + R 3 R 1 - - R 3 + R 2 - Glikozil donor: Akceptor: Termék lehet: Mellék- Aktivált hexóz: alkohol,

Részletesebben

Kémia. Tantárgyi programjai és követelményei A/2. változat

Kémia. Tantárgyi programjai és követelményei A/2. változat 5. sz. melléklet Kémia Tantárgyi programjai és követelményei A/2. változat Az 51/2012. (XII. 21.) számú EMMI rendelethez a 6/2014. (I.29.) EMMI rendelet 3. mellékleteként kiadott és a 34/2014 (IV. 29)

Részletesebben

MEDICINÁLIS ALAPISMERETEK BIOKÉMIA A SZÉNHIDRÁTOK ANYAGCSERÉJE 1. kulcsszó cím: A szénhidrátok anyagcseréje

MEDICINÁLIS ALAPISMERETEK BIOKÉMIA A SZÉNHIDRÁTOK ANYAGCSERÉJE 1. kulcsszó cím: A szénhidrátok anyagcseréje Modul cím: MEDICINÁLIS ALAPISMERETEK BIOKÉMIA A SZÉNHIDRÁTOK ANYAGCSERÉJE 1. kulcsszó cím: A szénhidrátok anyagcseréje A szénhidrátok a szervezet számára fontos, alapvető tápanyagok. Az emberi szervezetben

Részletesebben

I. FARMAKOKINETIKA. F + R hatás (farmakon, (receptor) gyógyszer) F + R FR

I. FARMAKOKINETIKA. F + R hatás (farmakon, (receptor) gyógyszer) F + R FR I. FARMAKOKINETIKA Gyógyszerek felszívódása, eloszlása és kiválasztása. Receptorok: csak az a gyógyszermolekula hat ami kötődik specifikus kötőhelyek (szervek, szövetek, sejtek) F + R hatás (farmakon,

Részletesebben

ENZIMSZINTŰ SZABÁLYOZÁS

ENZIMSZINTŰ SZABÁLYOZÁS ENZIMEK 1833.: Sörfőzés kapcsán kezdtek el vele foglalkozni (csírázó árpa vizsgálata) valamilyen anyag katalizátorként működik (Berzelius, 1835.) 1850. körül: ez valamilyen N-tartalmú szervesanyag 1874.:

Részletesebben

A TRANSZLÁCIÓ Hogyan lesz a DNS-ben kódolt információból fehérje? A DNS felszínén az aminosavak sorba állnak?

A TRANSZLÁCIÓ Hogyan lesz a DNS-ben kódolt információból fehérje? A DNS felszínén az aminosavak sorba állnak? A TRANSZLÁCIÓ Hogyan lesz a DNS-ben kódolt információból fehérje? A DNS felszínén az aminosavak sorba állnak? mrns, trns, riboszómák felfedezése A GENETIKAI KÓD 20 AS és csak 4 bázis, a kódolás hogy lehetséges?

Részletesebben

AZ ÉLET KÉMIÁJA... ÉLŐ ANYAG SZERVEZETI ALAPEGYSÉGE

AZ ÉLET KÉMIÁJA... ÉLŐ ANYAG SZERVEZETI ALAPEGYSÉGE AZ ÉLET KÉMIÁJA... ÉLŐ ANYAG SZERVEZETI ALAPEGYSÉGE A biológia az élet tanulmányozásával foglalkozik, az élő szervezetekre viszont vonatkoznak a fizika és kémia törvényei MI ÉPÍTI FEL AZ ÉLŐ ANYAGOT? HOGYAN

Részletesebben

(11) Lajstromszám: E 008 257 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA

(11) Lajstromszám: E 008 257 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU00000827T2! (19) HU (11) Lajstromszám: E 008 27 (13) T2 MAGYAR KÖZTÁRSASÁG Szellemi Tulajdon Nemzeti Hivatala EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 0 727848 (22) A bejelentés

Részletesebben

Eszközszükséglet: Szükséges anyagok: tojás, NaCl, ammónium-szulfát, réz-szulfát, ólom-acetát, ecetsav, sósav, nátrium-hidroxid, desztillált víz

Eszközszükséglet: Szükséges anyagok: tojás, NaCl, ammónium-szulfát, réz-szulfát, ólom-acetát, ecetsav, sósav, nátrium-hidroxid, desztillált víz A kísérlet, megnevezés, célkitűzései: Fehérjék tulajdonságainak, szerkezetének vizsgálata. Környezeti változások hatásának megfigyelése a fehérjék felépítésében. Eszközszükséglet: Szükséges anyagok: tojás,

Részletesebben

MEDICINÁLIS ALAPISMERETEK AZ ÉLŐ SZERVEZETEK KÉMIAI ÉPÍTŐKÖVEI A LIPIDEK 1. kulcsszó cím: A lipidek szerepe az emberi szervezetben

MEDICINÁLIS ALAPISMERETEK AZ ÉLŐ SZERVEZETEK KÉMIAI ÉPÍTŐKÖVEI A LIPIDEK 1. kulcsszó cím: A lipidek szerepe az emberi szervezetben Modul cím: MEDICINÁLIS ALAPISMERETEK AZ ÉLŐ SZERVEZETEK KÉMIAI ÉPÍTŐKÖVEI A LIPIDEK 1. kulcsszó cím: A lipidek szerepe az emberi szervezetben Tartalék energiaforrás, membránstruktúra alkotása, mechanikai

Részletesebben

Biopolimer 12/7/09. Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. DNS. Polimerek. Kardos Roland DNS elsődleges szerkezete

Biopolimer 12/7/09. Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. DNS. Polimerek. Kardos Roland DNS elsődleges szerkezete Biopolimerek Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. Osztódó sejt magorsófonala Kardos Roland 2009.10.29. Dohány levél epidermális sejtjének aktin hálózat Bakteriofágból kiszabaduló

Részletesebben

(11) Lajstromszám: E 008 419 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA

(11) Lajstromszám: E 008 419 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000008419T2! (19) HU (11) Lajstromszám: E 008 419 (13) T2 MAGYAR KÖZTÁRSASÁG Szellemi Tulajdon Nemzeti Hivatala EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 0 799042 (22) A bejelentés

Részletesebben

Részletes takarmányozástan gyakorlat

Részletes takarmányozástan gyakorlat Részletes takarmányozástan gyakorlat A sertés emésztési sajátosságai Emésztési sajátosságok omnivora monogasztrikus együregű, összetett gyomor (hámjellegű és mirigyes nyálkahártya) rövid emésztőcső, takarmány

Részletesebben