1. jelentésük. Nevüket az alkotó szén, hidrogén, oxigén 1 : 2 : 1 arányából hajdan elképzelt képletről [C n (H 2 O) m ] kapták.

Save this PDF as:
 WORD  PNG  TXT  JPG

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "1. jelentésük. Nevüket az alkotó szén, hidrogén, oxigén 1 : 2 : 1 arányából hajdan elképzelt képletről [C n (H 2 O) m ] kapták."

Átírás

1 Összefoglalás II.

2 Szénhidrátok

3 1. jelentésük Nevüket az alkotó szén, hidrogén, oxigén 1 : 2 : 1 arányából hajdan elképzelt képletről [C n (H 2 O) m ] kapták. Ha ezeket az anyagokat hevítjük vizet vesztenek ( karamellizálódnak ). A hidrát szó a vízre utal.

4 A valóságban a szénatomokhoz hidrogén- és hidroxilcsoport kapcsolódik [(H C OH)n], és emellett oxocsoportot is találhatunk a molekulákban.

5 Szénhidrátok: polihidroxi-oxovegyületek polihidroxi-aldehidek (nevük: aldózok) vagy polihidroxi-ketonok (nevük: ketózok), vagy olyan vegyületek, melyek hidrolízisével ilyen molekulák képződnek

6 A szénhidrátok csoportosítása:

7 A poliszaharidok csoportosítása Tartalék tápanyagok Vázanyagok növényekben állatokban, növényekben gombákban emberben ízeltlábúakban Keményítő glikogén cellulóz kitin

8

9 Aminosavak, fehérjék

10 1. A FEHÉRJÉK: az élőlények legfontosabb anyagai (görög név: protein) a sejtek szárazanyag-tartalmának %-át adják építőegységeik: aminosavak (C, H, O, N, S)

11 2. AZ AMINOSAVAK. aminocsoportot (-NH 2 ) és karboxilcsoportot (-COOH) tartalmazó szerves vegyületek a fehérjék építőanyagai H R α helyzetű C-atom

12 Élőlényekben: mindkét csoport az α C-atomhoz kapcsolódik Az aminósavak az R oldalláncban különböznek egymástól (élőlényekben: 20 féle)

13 ikerionos szerkezet: az amino- és karboxilcsoportok vizes oldatban ionos állapotban vannak jelen

14 amfoter jellegűek: savakkal szemben bázisként, bázisokkal szemben savakként viselkednek a sejtekben szabad állapotban ritkán fordulnak elő egymással peptidkötés kialakítására képesek

15 6. A PEPTIDKÖTÉS -Két aminósav összekapcsolódásakor vízkilépés történik - a keletkezett kötés neve: PEPTIDKÖTÉS N-terminális C-terminális

16 Fehérjék szerkezete 1. Elsődleges szerkezet: az aminosavak kapcsolódási sorrendje 2. Másodlagos szerkezet: a polipeptid lánc alakja 3. Harmadlagos szerkezet: a fehérje háromdimenziós ( térbeli ) szerkezete 4. Negyedleges szerkezet: az összetett fehérjék szerkezete

17 1. Elsődleges szerkezet = az aminósavak kapcsolódási sorrendje -Ha egy aminósav kiesik vagy kettő felcserélődik akkor a fehérje elveszti a szerepét.

18 2. Másodlagos szerkezet = a polipeptidlánc szakasz alakját jelenti α-hélix Spirál alakban helyezkednek el az aminósavak H kötés rögzíti β-redő Lemez alakban helyezkednek el az aminósavak H kötés rögzíti

19 α-hélix β-redő

20 3. Harmadlagos szerkezet : a spirális, redőzött és szabálytalan szakaszok térbeli elrendeződését jelenti a) szálas (fibrilláris) az egész fehérje végig vagy α-hélix vagy β-redő - fibroin - fibrinogén, fibrin - keratin (szaru)

21 b) Gömb alakú (globuláris) fehérjék : - albuminok - globulinok - hemoglobin globuláris fehérje

22 Egy gömb alakú fehérje részei: szabálytalan szakasz A gömb alakot rögzítő kötések α hélix szakasz β réteg szakasz

23 4. Negyedleges szerkezet = több fehérjemolekula (alegység) összekapcsolódásakor óriásmolekula alakul ki A hemoglobin negyedleges szerkezete

24 A FEHÉRJÉK CSOPORTOSÍTÁSA 1. PROTEINEK = egyszerű fehérjék: csak aminósavakból állnak albuminok a tejben kollagén a kötőszövetben inzulin a vérben aktin és miozin az izomban

25 2. PROTEIDEK = összetett fehérjék fehérje-rész + nem fehérje rész lipoproteidek(fehérje + lipid) membránfehérjék glikoproteidek (fehérje + szénhidrát) foszfoproteidek (fehérje + foszforsav)» mucin» kazein nukleoproteidek (fehérje + nukleotidok)» NAD, NADPtartalmú fehérjék metalloproteidek (fehérje + fém)» hemoglobin

26 A FEHÉRJÉK biológiai szerepe: 1. enzimek (biokatalizátorok) emésztőenzimek 2. raktárfehérjék tojás: albumin tej: kazein 3. transzportfehérjék hemoglobin hemocianin sejthártya fehérjéi 4. Izommozgásért felelő fehérjék aktin miozin

27 5. hormonok inzulin oxitocin, vazopresszin 6. ingerület átvivő anyagok acetil-kolin dopamin szerotonin noradrenalin 7. véralvadási faktorok trombin fibrin 8. immunválasz fehérjéi immunglobulinok

28 9. bakteriális toxinok, kígyómérgek 10. vírusfehérjék (burok) 11. receptor fehérjék a membránokon 12. váz- és szerkezeti fehérjék keratin kollagén elasztin rodopszin: receptorfehérje

29 A fehérjék kolloid méretűek Kolloid méret = nm közötti mérettartomány ( 1 nanométer = 10-6 mm ) Ez az óriásmolekulák mérettartománya A kolloidok kétféle halmazállapota:

30 hidrátburok fehérjemolekula A, szól ( folyékony ) állapot: tejben, vérplazmában B, gél (kocsonyaszerű ) állapot: kocsonya, tojásfehérje sejtplazma

31 Ha megváltoznak a környezeti viszonyok a fehérje kicsapódik kicsapódás = koaguláció = a kolloid állapot megszűnése A fehérje kiválik az oldatból

32 KOAGULÁCIÓ : kicsapódás, a fehérjemolekulák kiválnak az oldatból, megszűnik a kolloid állapot. megfordítható kicsapódás megfordíthatatlan kicsapódás

33 A, megfordítható kicsapódás csak a hidrátburok sérül, a biológiai aktivitás megmarad könnyűfémsók hatására: NaCl, (NH 4 ) 2 SO 4, híg alkohololdat hatására Víz hozzáadására visszaáll az eredeti állapot

34 B, megfordíthatatlan kicsapódás másodlagos szerkezet sérül, a biológiai aktivitás elvész = DENATURÁCIÓ történik erős mechanikai hatások, UV sugárzás, hő, savak, lúgok hatására, nehézfémsók (Ag, Pb, Hg, Cu) hatására Víz hozzáadására sem áll vissza az eredeti állapot

35 Fehérje kimutatási reakciók Kísérlet menete Tapasztalat Magyarázat Biurett-próba Fehérje-oldathoz lúgos réz-szulfát-oldatot adunk Lila elszíneződés A peptidkötés lúgos közegben komplexet hoz létre a rézionokkal, amely lila színű. Xantoprotein-próba 1. Fehérje-oldathoz tömény salétromsavat adunk, 2. majd melegítjük 1. Melegítés előtt fehér csapadék (denaturálódás), 2. majd a melegítés követően sárga elszíneződés Az aromás aminosavak nitrálódnak, ez okozza a fényelnyelés megváltozását, a sárga szín kialakulását. Érzékenység Peptid kötések Aromás gyűrűt tartalmazó aminosavakra

36 Esszenciális aminosavak: olyan aminósavak, amiket nem tudunk előállítani szabad formáában Ezért készen kell felvenni őket:10 db! Biológiai szempontból teljesértékű fehérjék: valamennyi esszenciális aminosavat a megfelelő mennyiségben, arányban tartalmazzák: - állati eredetű fehérjék (tojás, tej, hal, húsfélék)

37 A DNS szerkezete és szerepe

38 A nukleinsavaknak két típusa van: A, dezoxiribonukleinsav (DNS) B, ribonukleinsav (RNS)

39 A DNS és az RNS nukleotidokból áll. Egy nukleotid részei: A DNS nukleotid részei: 1. szerves bázisok: adenin (A) guanin (G) citozin (C) timin (T) 2. pentóz: dezoxiribóz 3. foszforsav Az RNS nukleotid részei: 1. szerves bázisok: adenin (A) guanin (G) citozin (C) uracil (U) 2. pentóz: ribóz 3. foszforsav

40 Nukleinsavak szerkezete 1. A nukleinsavakban a nukleotidok polinukleotid lánccá kapcsolódnak össze (akár több millió nukleotid) A nukleotidok a szénatomok közötti foszfátokkal kapcsolódnak egymáshoz.

41 2. A dezoxiribonukleinsav (DNS) sok ezer nukleotid összekapcsolódásával létrejött kettős polinukleotid láncból áll. P P dr A ::::::::::::: T dr P P dr T :::::::::::::: A dr P P.. dr G ::::::::::::: C dr P P... dr C ::::::::::::::: G dr P P dr C ::::::::::::::: G dr P P dr A ::::::::::::::: T dr

42 3. A két láncot a bázisok között kialakuló hidrogénkötések kapcsolják össze. Adeninhez mindig timin, a guaninhoz mindig citozin kapcsolódik hidrogén kötéssel.

43 4. Mivel egy kilencatomos purinvázú molekulával mindig egy hatatomos pirimidinvázú bázis kötődik, így a két lánc párhuzamos lefutású.

44 A bázispárosodás szabálya: A DNS-ben az alábbi bázisok állnak egymással szemben: G C, hidrogénkötések A = T,

45 5. A két polinukleotid szál a térben felcsavarodik. Ezt a szerkezetet nevezzük a kettős hélixnek (= KETTŐS SPIRÁL)

46 A kettős spirál szalag modellje H-hidakkal kapcsolódó komplementer bázispárok A pálcák a bázispárokat képviselik. A szalagok a két lánc cukorfoszfát gerincét képviselik. A méretek angström-ben (1Å = 0,1 nm) mutatják a távolságokat. A spirál 10 bázisonként fordul csaknem pontosan 360 o -ot. Cukor-foszfát lánc

47 DNS a sejtben Sejtmagban (kivéve baktériumok, kékalgák) 2 m hosszú szabályos rend szerint feltekerve, bázikus fehérjék segítsége Szerveződés: Kromatin: DNS + kapcsolódó fehérjék (tömörebb v. lazább, alvó v. átíródó) Kromoszóma: csak osztódáskor, szigorú rendeződésben van a DNS feltekeredve

48 A DNS szerepe: DNS: az élő rendszer örökítő anyaga és a fehérje képzésének közvetett irányítója (feladata az információtárolás és -továbbítás).

49 Az RNS ( ribonukleinsav) szerepe, típusai: RNS: a fehérjék képzését közvetlenül biztosító nukleinsavak (molekulái az örökítő anyag információját továbbítják a fehérje képzéséhez, és részt vesznek a fehérjeszintézisben). Típusai: hírvivő RNS; szállító-rns; riboszóma -RNS;

Szerkesztette: Vizkievicz András

Szerkesztette: Vizkievicz András Fehérjék A fehérjék - proteinek - az élő szervezetek számára a legfontosabb vegyületek. Az élet bármilyen megnyilvánulási formája fehérjékkel kapcsolatos. A sejtek szárazanyagának minimum 50 %-át adják.

Részletesebben

Az élő szervezetek felépítése I. Biogén elemek biomolekulák alkotóelemei a természetben előforduló elemek közül 22 fordul elő az élővilágban O; N; C; H; P; és S; - élő anyag 99%-a Biogén elemek sajátosságai:

Részletesebben

Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek

Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek Hidroxikarbonsavak α-hidroxi karbonsavak -Glikolsav (kézkrémek) - Tejsav (tejtermékek, izomláz, fogszuvasodás) - Citromsav (citrusfélékben,

Részletesebben

TestLine - Biogén elemek, molekulák Minta feladatsor

TestLine - Biogén elemek, molekulák Minta feladatsor TestLine - iogén elemek, molekulák iogén elemek, szervetlen és szerves molekulák az élő szervezetben. gészítsd ki a mondatot! aminocsoportja kondenzáció víz ún. peptidkötés 1. 1:48 Normál fehérjék biológiai

Részletesebben

A szénhidrátok az élet szempontjából rendkívül fontos, nélkülözhetetlen vegyületek. A bioszféra szerves anyagainak fő tömegét adó vegyületek.

A szénhidrátok az élet szempontjából rendkívül fontos, nélkülözhetetlen vegyületek. A bioszféra szerves anyagainak fő tömegét adó vegyületek. Szénhidrátok Szerkesztette: Vizkievicz András A szénhidrátok az élet szempontjából rendkívül fontos, nélkülözhetetlen vegyületek. A bioszféra szerves anyagainak fő tömegét adó vegyületek. A szénhidrátok

Részletesebben

AZ ÉLET KÉMIÁJA... ÉLŐ ANYAG SZERVEZETI ALAPEGYSÉGE

AZ ÉLET KÉMIÁJA... ÉLŐ ANYAG SZERVEZETI ALAPEGYSÉGE AZ ÉLET KÉMIÁJA... ÉLŐ ANYAG SZERVEZETI ALAPEGYSÉGE A biológia az élet tanulmányozásával foglalkozik, az élő szervezetekre viszont vonatkoznak a fizika és kémia törvényei MI ÉPÍTI FEL AZ ÉLŐ ANYAGOT? HOGYAN

Részletesebben

Fehérjeszerkezet, és tekeredés

Fehérjeszerkezet, és tekeredés Fehérjeszerkezet, és tekeredés Futó Kinga 2013.10.08. Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983

Részletesebben

Szerkesztette: Vizkievicz András

Szerkesztette: Vizkievicz András Fehérjék A fehérjék - proteinek - az élő szervezetek számára a legfontosabb vegyületek. Az élet bármilyen megnyilvánulási formája fehérjékkel kapcsolatos. A sejtek szárazanyagának minimum 50 %-át adják.

Részletesebben

Szénhidrátok. Szénhidrátok. Szénhidrátok. Csoportosítás

Szénhidrátok. Szénhidrátok. Szénhidrátok. Csoportosítás Szénhidrátok Definíció: Szénhidrátok Polihidroxi aldehidek vagy ketonok, vagy olyan vegyületek, melyek hidrolízisével polihidroxi aldehidek vagy ketonok keletkeznek. Elemi összetétel: - Mindegyik tartalmaz

Részletesebben

A nukleinsavak polimer vegyületek. Mint polimerek, monomerekből épülnek fel, melyeket nukleotidoknak nevezünk.

A nukleinsavak polimer vegyületek. Mint polimerek, monomerekből épülnek fel, melyeket nukleotidoknak nevezünk. Nukleinsavak Szerkesztette: Vizkievicz András A nukleinsavakat először a sejtek magjából sikerült tiszta állapotban kivonni. Innen a név: nucleus = mag (lat.), a sav a kémhatásukra utal. Azonban nukleinsavak

Részletesebben

A gyakorlat elméleti háttere A DNS molekula a sejt információhordozója. A DNS nemzedékről nemzedékre megőrzi az élőlények genetikai örökségét.

A gyakorlat elméleti háttere A DNS molekula a sejt információhordozója. A DNS nemzedékről nemzedékre megőrzi az élőlények genetikai örökségét. A kísérlet megnevezése, célkitűzései: DNS molekula szerkezetének megismertetése Eszközszükséglet: Szükséges anyagok: színes gyurma, papírsablon Szükséges eszközök: olló, hurkapálcika, fogpiszkáló, cérna,

Részletesebben

Nukleinsavak építőkövei

Nukleinsavak építőkövei ukleinsavak Szerkezeti hierarchia ukleinsavak építőkövei Pirimidin Purin Pirimidin Purin Timin (T) Adenin (A) Adenin (A) Citozin (C) Guanin (G) DS bázisai bázis Citozin (C) Guanin (G) RS bázisai bázis

Részletesebben

SZÉNHIDRÁTOK. Biológiai szempontból legjelentősebb a hat szénatomos szőlőcukor (glükóz) és gyümölcscukor(fruktóz),

SZÉNHIDRÁTOK. Biológiai szempontból legjelentősebb a hat szénatomos szőlőcukor (glükóz) és gyümölcscukor(fruktóz), SZÉNHIDRÁTOK A szénhidrátok döntő többségének felépítésében három elem, a C, a H és az O atomjai vesznek részt. Az egyszerű szénhidrátok (monoszacharidok) részecskéi egyetlen cukormolekulából állnak. Az

Részletesebben

Szerves kémiai és biokémiai alapok:

Szerves kémiai és biokémiai alapok: Szerves kémiai és biokémiai alapok: Másodlagos kémiai kötések: A másodlagos kötések energiája nagyságrenddel kisebb, mint az elsődlegeseké. Energiaközlés hatására a másodlagos kötések bomlanak fel először,

Részletesebben

7. évfolyam kémia osztályozó- és pótvizsga követelményei Témakörök: 1. Anyagok tulajdonságai és változásai (fizikai és kémiai változás) 2.

7. évfolyam kémia osztályozó- és pótvizsga követelményei Témakörök: 1. Anyagok tulajdonságai és változásai (fizikai és kémiai változás) 2. 7. évfolyam kémia osztályozó- és pótvizsga követelményei 1. Anyagok tulajdonságai és változásai (fizikai és kémiai változás) 2. Hőtermelő és hőelnyelő folyamatok, halmazállapot-változások 3. A levegő,

Részletesebben

A sejtek élete. 5. Robotoló törpék és óriások Az aminosavak és fehérjék R C NH 2. C COOH 5.1. A fehérjeépítőaminosavak általános

A sejtek élete. 5. Robotoló törpék és óriások Az aminosavak és fehérjék R C NH 2. C COOH 5.1. A fehérjeépítőaminosavak általános A sejtek élete 5. Robotoló törpék és óriások Az aminosavak és fehérjék e csak nézd! Milyen protonátmenetes reakcióra képes egy aminosav? R 2 5.1. A fehérjeépítőaminosavak általános képlete 5.2. A legegyszerűbb

Részletesebben

BIOLÓGIA VERSENY 10. osztály 2016. február 20.

BIOLÓGIA VERSENY 10. osztály 2016. február 20. BIOLÓGIA VERSENY 10. osztály 2016. február 20. Kód Elérhető pontszám: 100 Elért pontszám: I. Definíció (2x1 = 2 pont): a) Mikroszkopikus méretű szilárd részecskék aktív bekebelezése b) Molekula, a sejt

Részletesebben

DNS, RNS, Fehérjék. makromolekulák biofizikája. Biológiai makromolekulák. A makromolekulák TÖMEG szerinti mennyisége a sejtben NAGY

DNS, RNS, Fehérjék. makromolekulák biofizikája. Biológiai makromolekulák. A makromolekulák TÖMEG szerinti mennyisége a sejtben NAGY makromolekulák biofizikája DNS, RNS, Fehérjék Kellermayer Miklós Tér Méret, alak, lokális és globális szerkezet Idő Fluktuációk, szerkezetváltozások, gombolyodás Kölcsönhatások Belső és külső kölcsöhatások,

Részletesebben

12/4/2014. Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció. 1952 Hershey & Chase 1953!!!

12/4/2014. Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció. 1952 Hershey & Chase 1953!!! Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció 1859 1865 1869 1952 Hershey & Chase 1953!!! 1879 1903 1951 1950 1944 1928 1911 1 1. DNS szerkezete Mi az örökítő anyag? Friedrich Miescher

Részletesebben

A felépítő és lebontó folyamatok. Biológiai alapismeretek

A felépítő és lebontó folyamatok. Biológiai alapismeretek A felépítő és lebontó folyamatok Biológiai alapismeretek Anyagforgalom: Lebontó Felépítő Lebontó folyamatok csoportosítása: Biológiai oxidáció Erjedés Lebontó folyamatok összehasonlítása Szénhidrátok

Részletesebben

A fehérjék hierarchikus szerkezete

A fehérjék hierarchikus szerkezete Fehérjék felosztása A fehérjék hierarchikus szerkezete Smeller László Semmelweis Egyetem Biofizikai és Sugárbiológiai Intézet Biológiai funkció alapján Enzimek (pl.: tripszin, citokróm-c ) Transzportfehérjék

Részletesebben

Aminosavak, peptidek, fehérjék. Béres Csilla

Aminosavak, peptidek, fehérjék. Béres Csilla Aminosavak, peptidek, fehérjék Béres Csilla Aminosavak Az aminosavak (más néven aminokarbonsavak) olyan szerves vegyületek, amelyek molekulájában aminocsoport (- NH 2 ) és karboxilcsoport (-COOH) egyaránt

Részletesebben

Nukleinsavak. Szerkezet, szintézis, funkció

Nukleinsavak. Szerkezet, szintézis, funkció Nukleinsavak Szerkezet, szintézis, funkció Nukleinsavak, nukleotidok, nukleozidok 1869-ben Miescher a sejtmagból egy savas természetű, lúgban oldódó foszfortartalmú anyagot izolált, amit később, eredetére

Részletesebben

BIOGÉN ELEMEK MÁSODLAGOS BIOGÉN ELEMEK (> 0,005 %)

BIOGÉN ELEMEK MÁSODLAGOS BIOGÉN ELEMEK (> 0,005 %) BIOGÉN ELEMEK ELSŐDLEGES BIOGÉN ELEMEK(kb. 95%) ÁLLANDÓ BIOGÉN ELEMEK MAKROELEMEK MÁSODLAGOS BIOGÉN ELEMEK (> 0,005 %) C, H, O, N P, S, Cl, Na, K, Ca, Mg MIKROELEMEK (NYOMELEMEK) (< 0,005%) I, Fe, Cu,

Részletesebben

Az élő anyagot felépítő kémiai elemek

Az élő anyagot felépítő kémiai elemek BIOKÉMIA SZAKMAI INFORMÁCIÓTARTALOM Az élő anyagot felépítő kémiai elemek 1. Elsődleges biogén elemek (a sejtek tömegének 99 %-át adják). Makro elemek Másodlagos biogén elemek (0,005-1%-ban fordulnak elő

Részletesebben

Biogén elemeknek az élő szervezeteket felépítő kémiai elemeket nevezzük. A természetben található 90 elemből ez mindössze kb. 30.

Biogén elemeknek az élő szervezeteket felépítő kémiai elemeket nevezzük. A természetben található 90 elemből ez mindössze kb. 30. A sejtek kémiai felépítése Szerkesztette: Vizkievicz András A biogén elemek Biogén elemeknek az élő szervezeteket felépítő kémiai elemeket nevezzük. A természetben található 90 elemből ez mindössze kb.

Részletesebben

BIOMOLEKULÁK KÉMIÁJA. Novák-Nyitrai-Hazai

BIOMOLEKULÁK KÉMIÁJA. Novák-Nyitrai-Hazai BIOMOLEKULÁK KÉMIÁJA Novák-Nyitrai-Hazai A tankönyv elsısorban szerves kémiai szempontok alapján tárgyalja az élı szervezetek felépítésében és mőködésében kulcsfontosságú szerves vegyületeket. A tárgyalás-

Részletesebben

Eszközszükséglet: Szükséges anyagok: tojás, NaCl, ammónium-szulfát, réz-szulfát, ólom-acetát, ecetsav, sósav, nátrium-hidroxid, desztillált víz

Eszközszükséglet: Szükséges anyagok: tojás, NaCl, ammónium-szulfát, réz-szulfát, ólom-acetát, ecetsav, sósav, nátrium-hidroxid, desztillált víz A kísérlet, megnevezés, célkitűzései: Fehérjék tulajdonságainak, szerkezetének vizsgálata. Környezeti változások hatásának megfigyelése a fehérjék felépítésében. Eszközszükséglet: Szükséges anyagok: tojás,

Részletesebben

Táplálkozási ismeretek. Fehérjék. fehérjéinek és egyéb. amelyeket

Táplálkozási ismeretek. Fehérjék. fehérjéinek és egyéb. amelyeket Táplálkozási ismeretek haladóknak I. Az előző három fejezetben megismerkedtünk az alapokkal (táplálék-piramis, alapanyag-csere, napi energiaszükséglet, tápanyagok energiatartalma, naponta szükséges fehérje,

Részletesebben

1. Bevezetés. Mi az élet, evolúció, információ és energiaáramlás, a szerveződés szintjei

1. Bevezetés. Mi az élet, evolúció, információ és energiaáramlás, a szerveződés szintjei 1. Bevezetés Mi az élet, evolúció, információ és energiaáramlás, a szerveződés szintjei 1.1 Mi az élet? Definíció Alkalmas legyen különbségtételre élő/élettelen közt Ne legyen túl korlátozó (más területen

Részletesebben

Heterociklusos vegyületek

Heterociklusos vegyületek Szerves kémia A gyűrű felépítésében más atom (szénatomon kívül!), ún. HETEROATOM is részt vesz. A gyűrűt alkotó heteroatomként leggyakrabban a nitrogén, oxigén, kén szerepel, (de ismerünk arzént, szilíciumot,

Részletesebben

KÉMIA ÍRÁSBELI ÉRETTSÉGI- FELVÉTELI FELADATOK 2000

KÉMIA ÍRÁSBELI ÉRETTSÉGI- FELVÉTELI FELADATOK 2000 Megoldás 000. oldal KÉMIA ÍRÁSBELI ÉRETTSÉGI- FELVÉTELI FELADATOK 000 JAVÍTÁSI ÚTMUTATÓ I. A NITROGÉN ÉS SZERVES VEGYÜLETEI s s p 3 molekulák között gyenge kölcsönhatás van, ezért alacsony olvadás- és

Részletesebben

,:/ " \ OH OH OH - 6 - / \ O / H / H HO-CH, O, CH CH - OH ,\ / "CH - ~(H CH,-OH \OH. ,-\ ce/luló z 5zer.~ezere

,:/  \ OH OH OH - 6 - / \ O / H / H HO-CH, O, CH CH - OH ,\ / CH - ~(H CH,-OH \OH. ,-\ ce/luló z 5zer.~ezere - 6 - o / \ \ o / \ / \ () /,-\ ce/luló z 5zer.~ezere " C=,1 -- J - 1 - - ---,:/ " - -,,\ / " - ~( / \ J,-\ ribóz: a) r.yílt 12"('.1, b) gyürus íormája ~.. ~ en;én'. fu5 héli'(ef1e~: egy menete - 7-5.

Részletesebben

3. Sejtalkotó molekulák III.

3. Sejtalkotó molekulák III. 3. Sejtalkotó molekulák III. Fehérjék, fehérjeszintézis (transzkripció, transzláció, posztszintetikus módosítások). Enzimműködés 3.1 Fehérjék A genetikai információ egyik fő manifesztálódása Számos funkció

Részletesebben

CHO H H H OH H OH OH H CH2OH HC OH HC OH HC OH CH 2

CHO H H H OH H OH OH H CH2OH HC OH HC OH HC OH CH 2 4. Előadás ukleozidok, nukleotidok, nukleinsavak Történeti háttér Savas karakterű anyagok a sejtmagból 1869-71 DS a sejtmag fő komponense F. Miescher (Svájc) 1882 Flemming: Chromatin elnevezés Waldeyer:

Részletesebben

Fehérjeszerkezet, és tekeredés. Futó Kinga

Fehérjeszerkezet, és tekeredés. Futó Kinga Fehérjeszerkezet, és tekeredés Futó Kinga Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983 H 211861 N

Részletesebben

Az élő anyag szerkezeti egységei: víz, nukleinsavak, fehérjék. elrendeződés, rend, rendszer, periodikus ismétlődés

Az élő anyag szerkezeti egységei: víz, nukleinsavak, fehérjék. elrendeződés, rend, rendszer, periodikus ismétlődés Az élő anyag szerkezeti egységei: víz, nukleinsavak, fehérjék Agócs Gergely 2013. december 3. kedd 10:00 11:40 1. Mit értünk élő anyag alatt? Az élő szervezetet felépítő anyagok. Az anyag azonban nem csupán

Részletesebben

3.6. Szénidrátok szacharidok

3.6. Szénidrátok szacharidok 3.6. Szénidrátok szacharidok általános összegképlet: C n (H 2 O) m > a szén hidrátjai elsődleges szerves anyagok mert az élő sejt minden más szerves anyagot a szénhidrátok további átalakításával állít

Részletesebben

A fehérjék szerkezete és az azt meghatározó kölcsönhatások

A fehérjék szerkezete és az azt meghatározó kölcsönhatások A fehérjék szerkezete és az azt meghatározó kölcsönhatások 1. A fehérjék szerepe az élõlényekben 2. A fehérjék szerkezetének szintjei 3. A fehérjék konformációs stabilitásáért felelõs kölcsönhatások 4.

Részletesebben

A tananyag felépítése: A BIOLÓGIA ALAPJAI. I. Prokarióták és eukarióták. Az eukarióta sejt. Pécs Miklós: A biológia alapjai

A tananyag felépítése: A BIOLÓGIA ALAPJAI. I. Prokarióták és eukarióták. Az eukarióta sejt. Pécs Miklós: A biológia alapjai A BIOLÓGIA ALAPJAI A tananyag felépítése: Környezetmérnök és műszaki menedzser hallgatók számára Előadó: 2 + 0 + 0 óra, félévközi számonkérés 3 ZH: október 3, november 5, december 5 dr. Pécs Miklós egyetemi

Részletesebben

FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest,

FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest, FEHÉRJÉK A MÁGNESEKBEN Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium Alkímia Ma, Budapest, 2013.02.28. I. FEHÉRJÉK: L-α aminosavakból felépülő lineáris polimerek α H 2 N CH COOH amino

Részletesebben

CIÓ A GENETIKAI INFORMÁCI A DNS REPLIKÁCI

CIÓ A GENETIKAI INFORMÁCI A DNS REPLIKÁCI A GENETIKAI INFORMÁCI CIÓ TÁROLÁSA ÉS S KIFEJEZŐDÉSE A DNS SZERKEZETE Két antiparalel (ellentétes lefutású) polinukleotid láncból álló kettős helix A két lánc egy képzeletbeli közös tengely körül van feltekeredve,

Részletesebben

BIOLÓGIA HÁZIVERSENY 1. FORDULÓ BIOKÉMIA, GENETIKA BIOKÉMIA, GENETIKA

BIOLÓGIA HÁZIVERSENY 1. FORDULÓ BIOKÉMIA, GENETIKA BIOKÉMIA, GENETIKA BIOKÉMIA, GENETIKA 1. Nukleinsavak keresztrejtvény (12+1 p) 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 1. A nukleinsavak a.-ok összekapcsolódásával kialakuló polimerek. 2. Purinvázas szerves bázis, amely az

Részletesebben

6. változat. 3. Jelöld meg a nem molekuláris szerkezetű anyagot! A SO 2 ; Б C 6 H 12 O 6 ; В NaBr; Г CO 2.

6. változat. 3. Jelöld meg a nem molekuláris szerkezetű anyagot! A SO 2 ; Б C 6 H 12 O 6 ; В NaBr; Г CO 2. 6. változat Az 1-től 16-ig terjedő feladatokban négy válaszlehetőség van, amelyek közül csak egy helyes. Válaszd ki a helyes választ és jelöld be a válaszlapon! 1. Jelöld meg azt a sort, amely helyesen

Részletesebben

Természetes polimer szerkezeti anyagok: Makromolekulák

Természetes polimer szerkezeti anyagok: Makromolekulák POLIMERTECHNIKA TANSZÉK Dr. Morlin Bálint Dr. Tábi Tamás Természetes polimer szerkezeti anyagok: Makromolekulák 2016. Szeptember 9. Természetes polimer szerkezeti anyagok - Természetes polimer szerkezeti

Részletesebben

A fehérjék hierarchikus szerkezete

A fehérjék hierarchikus szerkezete Fehérjék felosztása A fehérjék hierarchikus szerkezete Smeller László Semmelweis Egyetem Biofizikai és Sugárbiológiai Intézet Biológiai funkció alapján Enzimek (pl.: tripszin, citokróm-c ) Transzportfehérjék

Részletesebben

Biopolimer 12/7/09. Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. DNS. Polimerek. Kardos Roland DNS elsődleges szerkezete

Biopolimer 12/7/09. Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. DNS. Polimerek. Kardos Roland DNS elsődleges szerkezete Biopolimerek Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. Osztódó sejt magorsófonala Kardos Roland 2009.10.29. Dohány levél epidermális sejtjének aktin hálózat Bakteriofágból kiszabaduló

Részletesebben

Aminosavak általános képlete NH 2. Csoportosítás: R oldallánc szerkezete alapján: Semleges. Esszenciális aminosavak

Aminosavak általános képlete NH 2. Csoportosítás: R oldallánc szerkezete alapján: Semleges. Esszenciális aminosavak Aminosavak 1 Aminosavak általános képlete N 2 soportosítás: oldallánc szerkezete alapján: Apoláris Poláris Bázikus Savas Semleges Esszenciális aminosavak 2 (apoláris) Glicin Név Gly 3 Alanin Ala 3 3 Valin

Részletesebben

Makromolekulák. Fehérjetekeredé. rjetekeredés. Biopolimer. Polimerek

Makromolekulák. Fehérjetekeredé. rjetekeredés. Biopolimer. Polimerek Biopolimerek Makromolekulá Makromolekulák. Fehé Fehérjetekeredé rjetekeredés. Osztódó sejt magorsófonala 2011. November 16. Huber Tamá Tamás Dohány levél epidermális sejtjének aktin hálózata Bakteriofágból

Részletesebben

Szerves Kémia II. Dr. Patonay Tamás egyetemi tanár E 405 Tel:

Szerves Kémia II. Dr. Patonay Tamás egyetemi tanár E 405 Tel: Szerves Kémia II. TKBE0312 Előfeltétel: TKBE03 1 Szerves kémia I. Előadás: 2 óra/hét Dr. Patonay Tamás egyetemi tanár E 405 Tel: 22464 tpatonay@puma.unideb.hu A 2010/11. tanév tavaszi félévében az előadás

Részletesebben

Az anyagi rendszer fogalma, csoportosítása

Az anyagi rendszer fogalma, csoportosítása Az anyagi rendszer fogalma, csoportosítása A bemutatót összeállította: Fogarasi József, Petrik Lajos SZKI, 2011 1 1 A rendszer fogalma A körülöttünk levő anyagi világot atomok, ionok, molekulák építik

Részletesebben

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin.

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin. Myoglobin Fehérje-szerkezetek! MGLSDGEWQLVLNVWGKVEADIPGGQEVLIRLFK GPETLEKFDKFKLKSEDEMKASE DLKKGATVLTALGGILKKKGEAEIKPLAQSA TKKIPVKYLEFISECIIQVLQSK PGDFGADAQGAMNKALELFRKDMASNYKELGFQG Fuxreiter Mónika! Debreceni

Részletesebben

MEDICINÁLIS ALAPISMERETEK AZ ÉLŐ SZERVEZETEK KÉMIAI ÉPÍTŐKÖVEI A LIPIDEK 1. kulcsszó cím: A lipidek szerepe az emberi szervezetben

MEDICINÁLIS ALAPISMERETEK AZ ÉLŐ SZERVEZETEK KÉMIAI ÉPÍTŐKÖVEI A LIPIDEK 1. kulcsszó cím: A lipidek szerepe az emberi szervezetben Modul cím: MEDICINÁLIS ALAPISMERETEK AZ ÉLŐ SZERVEZETEK KÉMIAI ÉPÍTŐKÖVEI A LIPIDEK 1. kulcsszó cím: A lipidek szerepe az emberi szervezetben Tartalék energiaforrás, membránstruktúra alkotása, mechanikai

Részletesebben

1. Az élő szervezetek felépítése és az életfolyamatok 17

1. Az élő szervezetek felépítése és az életfolyamatok 17 Élődi Pál BIOKÉMIA vomo; Akadémiai Kiadó, Budapest 1980 Tartalom Bevezetés 1. Az élő szervezetek felépítése és az életfolyamatok 17 Mi jellemző az élőre? 17. Biogén elemek 20. Biomolekulák 23. A víz 26.

Részletesebben

MEDICINÁLIS ALAPISMERETEK AZ ÉLŐ SZERVEZETEK KÉMIAI ÉPÍTŐKÖVEI A SZÉNHIDRÁTOK 1. kulcsszó cím: SZÉNHIDRÁTOK

MEDICINÁLIS ALAPISMERETEK AZ ÉLŐ SZERVEZETEK KÉMIAI ÉPÍTŐKÖVEI A SZÉNHIDRÁTOK 1. kulcsszó cím: SZÉNHIDRÁTOK Modul cím: MEDICINÁLIS ALAPISMERETEK AZ ÉLŐ SZERVEZETEK KÉMIAI ÉPÍTŐKÖVEI A SZÉNHIDRÁTOK 1. kulcsszó cím: SZÉNHIDRÁTOK A szénhidrátok általános képlete (CH 2 O) n. A szénhidrátokat két nagy csoportra oszthatjuk:

Részletesebben

Nanotechnológia. Nukleinsavak. Készítette - Fehérvári Gábor

Nanotechnológia. Nukleinsavak. Készítette - Fehérvári Gábor Nanotechnológia Nukleinsavak Készítette - Fehérvári Gábor Bevezető A nukleinsavak az élő anyag alapvetően fontos komponensei. Meghatározó szerepet töltenek be az átöröklésben, a fehérjék szintézisében

Részletesebben

A bioenergetika a biokémiai folyamatok során lezajló energiaváltozásokkal foglalkozik.

A bioenergetika a biokémiai folyamatok során lezajló energiaváltozásokkal foglalkozik. Modul cím: MEDICINÁLIS ALAPISMERETEK BIOKÉMIA BIOENERGETIKA I. 1. kulcsszó cím: Energia A termodinamika első főtétele kimondja, hogy a különböző energiafajták átalakulhatnak egymásba ez az energia megmaradásának

Részletesebben

Poligénes v. kantitatív öröklődés

Poligénes v. kantitatív öröklődés 1. Öröklődés komplexebb sajátosságai 2. Öröklődés molekuláris alapja Poligénes v. kantitatív öröklődés Azok a tulajdonságokat amelyek mértékegységgel nem, vagy csak nehezen mérhetők, kialakulásuk kevéssé

Részletesebben

Tartalmi követelmények kémia tantárgyból az érettségin K Ö Z É P S Z I N T

Tartalmi követelmények kémia tantárgyból az érettségin K Ö Z É P S Z I N T 1. Általános kémia Atomok és a belőlük származtatható ionok Molekulák és összetett ionok Halmazok A kémiai reakciók A kémiai reakciók jelölése Termokémia Reakciókinetika Kémiai egyensúly Reakciótípusok

Részletesebben

A szénhidrátok az élet szempontjából rendkívül fontos, nélkülözhetetlen vegyületek. A bioszféra szerves anyagainak fő tömegét adó vegyületek.

A szénhidrátok az élet szempontjából rendkívül fontos, nélkülözhetetlen vegyületek. A bioszféra szerves anyagainak fő tömegét adó vegyületek. Szénhidrátok Szerkesztette: Vizkievicz András A szénhidrátok az élet szempontjából rendkívül fontos, nélkülözhetetlen vegyületek. A bioszféra szerves anyagainak fő tömegét adó vegyületek. A szénhidrátok

Részletesebben

AMINOSAVAK, FEHÉRJÉK

AMINOSAVAK, FEHÉRJÉK AMINOSAVAK, FEHÉRJÉK Az aminosavak olyan szerves vegyületek, amelyek molekulájában aminocsoport (-NH2) és karboxilcsoport (-COOH) egyaránt előfordul. Felosztás A fehérjéket feloszthatjuk aszerint, hogy

Részletesebben

BIOKÉMIA. Simonné Prof. Dr. Sarkadi Livia egyetemi tanár.

BIOKÉMIA. Simonné Prof. Dr. Sarkadi Livia egyetemi tanár. BIOKÉMIA Simonné Prof. Dr. Sarkadi Livia egyetemi tanár e-mail: sarkadi@mail.bme.hu Tudományterületi elhelyezés Alaptudományok (pl.: matematika, fizika, kémia, biológia) Alkalmazott tudományok Interdiszciplináris

Részletesebben

Az anyag- és energiaforgalom alapjai

Az anyag- és energiaforgalom alapjai Az anyag- és energiaforgalom alapjai Anyagcsere Tápanyagbevitel a szükségletnek megfelelően - test felépítése - energiaszükséglet fedezete Szénhidrátok, Zsirok, Fehérjék, Nukleinsavak, Munka+hő+raktározás

Részletesebben

A METABOLIZMUS ENERGETIKÁJA

A METABOLIZMUS ENERGETIKÁJA A METABOLIZMUS ENERGETIKÁJA Futó Kinga 2014.10.01. Metabolizmus Metabolizmus = reakciók együttese, melyek a sejtekben lejátszódnak. Energia nyerés szempontjából vannak fototrófok ill. kemotrófok. szervesanyag

Részletesebben

Szénhidrátok monoszacharidok formájában szívódnak fel a vékonybélből.

Szénhidrátok monoszacharidok formájában szívódnak fel a vékonybélből. Vércukorszint szabályozása: Szénhidrátok monoszacharidok formájában szívódnak fel a vékonybélből. Szövetekben monoszacharid átalakítás enzimjei: Szénhidrát anyagcserében máj központi szerepű. Szénhidrát

Részletesebben

CHO H H H OH H OH OH H CH2OH CHO OH H HC OH HC OH HC OH CH 2 OH

CHO H H H OH H OH OH H CH2OH CHO OH H HC OH HC OH HC OH CH 2 OH 4. Előadás ukleozidok, nukleotidok, nukleinsavak Történeti háttér Savas karakterű anyagok a sejtmagból 1869-71 DS a sejtmag fő komponense nuclein Friedrich Miescher (Svájc, 1844-1895) 1970: FM Insitute

Részletesebben

A kémiai energia átalakítása a sejtekben

A kémiai energia átalakítása a sejtekben A kémiai energia átalakítása a sejtekben A sejtek olyan mikroszkópikus képződmények amelyek működése egy vegyi gyárhoz hasonlítható. Tehát a sejtek mikroszkópikus vegyi gyárak. Mi mindenben hasonlítanak

Részletesebben

A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA

A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA 2013.10.09. CITOSZKELETON - DEFINÍCIÓ Fehérjékből felépülő, a sejt vázát alkotó intracelluláris rendszer. Eukarióta és prokarióta sejtekben egyaránt megtalálható.

Részletesebben

Biotechnológiai alapismeretek tantárgy

Biotechnológiai alapismeretek tantárgy Biotechnológiai alapismeretek tantárgy A biotechnológiai alapismeretek tantárgy magába foglalja a kémia, fizikai kémia és a biológia tantárgyak témaköreit. 1. A) Ismertesse az atomok elektronszerkezetét!

Részletesebben

Farmakológus szakasszisztens Farmakológus szakasszisztens 2/34

Farmakológus szakasszisztens Farmakológus szakasszisztens 2/34 -06 Farmakológus szakasszisztens feladatok A 0/007 (II. 7.) SzMM rendelettel módosított /006 (II. 7.) OM rendelet Országos Képzési Jegyzékről és az Országos Képzési Jegyzékbe történő felvétel és törlés

Részletesebben

Táplálék. Szénhidrát Fehérje Zsír Vitamin Ásványi anyagok Víz

Táplálék. Szénhidrát Fehérje Zsír Vitamin Ásványi anyagok Víz Étel/ital Táplálék Táplálék Szénhidrát Fehérje Zsír Vitamin Ásványi anyagok Víz Szénhidrát Vagyis: keményítő, élelmi rostok megemésztve: szőlőcukor, rostok Melyik élelmiszerben? Gabona, és feldolgozási

Részletesebben

Kémiai Intézet Kémiai Laboratórium. F o t o n o k k e r e s z tt ü z é b e n a D N S

Kémiai Intézet Kémiai Laboratórium. F o t o n o k k e r e s z tt ü z é b e n a D N S Szalay SzalayPéter Péter egyetemi egyetemi tanár tanár ELTE, ELTE,Kémiai Kémiai Intézet Intézet Elméleti ElméletiKémiai Kémiai Laboratórium Laboratórium F o t o n o k k e r e s z tt ü z é b e n a D N S

Részletesebben

ELTE BOLYAI JÁNOS GYAKORLÓ ÁLTALÁNOS ISKOLA ÉS GIMNÁZIUM SZÓBELI ÉRETTSÉGI TÉMAKÖRÖK KÉMIÁBÓL

ELTE BOLYAI JÁNOS GYAKORLÓ ÁLTALÁNOS ISKOLA ÉS GIMNÁZIUM SZÓBELI ÉRETTSÉGI TÉMAKÖRÖK KÉMIÁBÓL ELTE BOLYAI JÁNOS GYAKORLÓ ÁLTALÁNOS ISKOLA ÉS GIMNÁZIUM SZÓBELI ÉRETTSÉGI TÉMAKÖRÖK KÉMIÁBÓL 2017 1. Az atom szerkezete Az atomok, az elemek jellemzése. Az elektronszerkezet és a periódusos rendszer.

Részletesebben

SZÉNHIDRÁTOK. 3. Válogasd szét a képleteket aszerint, hogy aldóz, vagy ketózmolekulát ábrázolnak! Írd a fenti táblázat utolsó sorába a betűjeleket!

SZÉNHIDRÁTOK. 3. Válogasd szét a képleteket aszerint, hogy aldóz, vagy ketózmolekulát ábrázolnak! Írd a fenti táblázat utolsó sorába a betűjeleket! funkciós kimutatása molekulák csoport betűjele neve képlete helye 1. Írd a táblázatba a szénhidrátok összegképletét! általános képlet trióz tetróz 2. Mi a különbség az aldózok és a ketózok között? ALDÓZ

Részletesebben

2. Sejtalkotó molekulák II. Az örökítőanyag (DNS, RNS replikáció), és az öröklődés molekuláris alapjai (gén, genetikai kód)

2. Sejtalkotó molekulák II. Az örökítőanyag (DNS, RNS replikáció), és az öröklődés molekuláris alapjai (gén, genetikai kód) 2. Sejtalkotó molekulák II. Az örökítőanyag (DNS, RNS replikáció), és az öröklődés molekuláris alapjai (gén, genetikai kód) 2.1 Nukleotidok, nukleinsavak Információátadás (örökítőanyag) Információs egység

Részletesebben

Biológia vázlatok az első konzultáció tananyagához

Biológia vázlatok az első konzultáció tananyagához Biológia vázlatok az első konzultáció tananyagához A sejt fogalma: A sejt az élőlények legkisebb alaki és működési egysége. Minden élőlény sejtes felépítésű A sejtek kis méretűek, csak mikroszkóppal láthatók,

Részletesebben

Az élő sejt fizikai Biológiája:

Az élő sejt fizikai Biológiája: Az élő sejt fizikai Biológiája: Modellépítés, biológiai rendszerek skálázódása Kellermayer Miklós Fizikai biológia Ma már nem csak kvalitatív megfigyeléseket, hanem kvantitatív méréseket végzünk (biológiai

Részletesebben

SZERVES KÉMIAI REAKCIÓEGYENLETEK

SZERVES KÉMIAI REAKCIÓEGYENLETEK SZERVES KÉMIAI REAKCIÓEGYENLETEK Budapesti Reáltanoda Fontos! Sok reakcióegyenlet több témakörhöz is hozzátartozik. Szögletes zárójel jelzi a reakciót, ami más témakörnél található meg. Alkánok, cikloalkánok

Részletesebben

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Azonosító szám: TÁMOP-4.1.2-08/1/A-2009-0011 Az orvosi

Részletesebben

TANMENET BIOLÓGIA X. ÉVFOLYAM 2012/2013

TANMENET BIOLÓGIA X. ÉVFOLYAM 2012/2013 MISKOLCI MAGISTER GIMNÁZIUM TANMENET BIOLÓGIA X. ÉVFOLYAM 2012/2013 Készítette: ZÁRDAI-CSINTALAN ANITA 1. óra Év eleji ismétlés 2. óra A biogén elemek 3. óra A víz néhány tulajdonsága 4. óra A lipidek

Részletesebben

A replikáció mechanizmusa

A replikáció mechanizmusa Az öröklődés molekuláris alapjai A DNS megkettőződése, a replikáció Szerk.: Vizkievicz András A DNS-molekula az élőlények örökítő anyaga, kódolt formában tartalmazza mindazon információkat, amelyek a sejt,

Részletesebben

Élettan. előadás tárgykód: bf1c1b10 ELTE TTK, fizika BSc félév: 2015/2016., I. időpont: csütörtök, 8:15 9:45

Élettan. előadás tárgykód: bf1c1b10 ELTE TTK, fizika BSc félév: 2015/2016., I. időpont: csütörtök, 8:15 9:45 Élettan előadás tárgykód: bf1c1b10 ELTE TTK, fizika BSc félév: 2015/2016., I. időpont: csütörtök, 8:15 9:45 oktató: Dr. Tóth Attila, adjunktus ELTE TTK Biológiai Intézet, Élettani és Neurobiológiai tanszék

Részletesebben

Új irányok a biomolekuláris felismerés detektálásában

Új irányok a biomolekuláris felismerés detektálásában Magyar Kémiai Folyóirat - Előadások 133 Új irányok a biomolekuláris felismerés detektálásában GYURCSÁNYI E. Róbert a* Budapesti Műszaki és Gazdaságtudományi Egyetem, Általános és Analitikai Kémiai Tanszék,

Részletesebben

BIOLÓGIA TANMENET. XI. évfolyam 2013/2014

BIOLÓGIA TANMENET. XI. évfolyam 2013/2014 MISKOLCI MAGISTER GIMNÁZIUM BIOLÓGIA TANMENET XI. évfolyam 2013/2014 A 110/2012. (VI. 4.) Korm. rendelet és az 51/2012. (XII. 21.) EMMI rendelet alapján készítette Zárdai-Csintalan Anita 1. óra Év eleji

Részletesebben

Biomolekulák nanomechanikája A biomolekuláris rugalmasság alapjai

Biomolekulák nanomechanikája A biomolekuláris rugalmasság alapjai Fogorvosi Anyagtan Fizikai Alapjai Biomolekulák nanomechanikája A biomolekuláris rugalmasság alapjai Mártonfalvi Zsolt Biofizikai és Sugárbiológiai Intézet Semmelweis Egyetem Budapest Biomolekulák mint

Részletesebben

DNS-számítógép. Balló Gábor

DNS-számítógép. Balló Gábor DNS-számítógép Balló Gábor Bevezetés A nukleinsavak az élő szervezetek egyik legfontosabb alkotórészei. Ezekben tárolódnak ugyanis az öröklődéshez, és a fehérjeszintézishez szükséges információk. Bár a

Részletesebben

POSZTTRANSZLÁCIÓS MÓDOSÍTÁSOK: GLIKOZILÁLÁSOK

POSZTTRANSZLÁCIÓS MÓDOSÍTÁSOK: GLIKOZILÁLÁSOK POSZTTRANSZLÁCIÓS MÓDOSÍTÁSOK: GLIKOZILÁLÁSOK Dr. Pécs Miklós Budapesti Műszaki és Gazdaságtudományi Egyetem, Alkalmazott Biotechnológia és Élelmiszertudomány Tanszék 1 Glikozilálás A rekombináns fehérjék

Részletesebben

3. Általános egészségügyi ismeretek az egyes témákhoz kapcsolódóan

3. Általános egészségügyi ismeretek az egyes témákhoz kapcsolódóan 11. évfolyam BIOLÓGIA 1. Az emberi test szabályozása Idegi szabályozás Hormonális szabályozás 2. Az érzékelés Szaglás, tapintás, látás, íz érzéklés, 3. Általános egészségügyi ismeretek az egyes témákhoz

Részletesebben

2. Sejtalkotó molekulák II. Az örökítőanyag (DNS, RNS replikáció), és az öröklődés molekuláris alapjai (gén, genetikai kód)

2. Sejtalkotó molekulák II. Az örökítőanyag (DNS, RNS replikáció), és az öröklődés molekuláris alapjai (gén, genetikai kód) 2. Sejtalkotó molekulák II. Az örökítőanyag (DNS, RNS replikáció), és az öröklődés molekuláris alapjai (gén, genetikai kód) 2.1 Nukleotidok, nukleinsavak Információátadás (örökítőanyag) Információs egység

Részletesebben

TANMENETJAVASLAT. Maróthy Miklósné KÉMIA éveseknek. címû tankönyvéhez

TANMENETJAVASLAT. Maróthy Miklósné KÉMIA éveseknek. címû tankönyvéhez TANMENETJAVASLAT Maróthy Miklósné KÉMIA 14 16 éveseknek címû tankönyvéhez 9. osztály 10.osztály éves órakeret 55 óra 74 óra 55 óra 74 óra (1,5 óra/hét) (2 óra/hét) (1,5 óra/hét) (2 óra/hét) bevezetés 1

Részletesebben

BEVEZETÉS A BIOLÓGIÁBA

BEVEZETÉS A BIOLÓGIÁBA BEVEZETÉS A BIOLÓGIÁBA 1. A BIOLÓGIA TUDOMÁNYA, RENDSZERTANI EGYSÉGEK, VIZSGÁLATI SZEMPONTOK AZ ÉLET JELLEMZŐI: ÉLŐ RENDSZEREK SZERVEZŐDÉSI SZINTJEI FIZIKAI ÉS KÉMIAI ALAPISMERETEK Biológia és rendszertani

Részletesebben

1. feladat Összesen: 8 pont. 2. feladat Összesen: 12 pont. 3. feladat Összesen: 14 pont. 4. feladat Összesen: 15 pont

1. feladat Összesen: 8 pont. 2. feladat Összesen: 12 pont. 3. feladat Összesen: 14 pont. 4. feladat Összesen: 15 pont 1. feladat Összesen: 8 pont Az autók légzsákját ütközéskor a nátrium-azid bomlásakor keletkező nitrogéngáz tölti fel. A folyamat a következő reakcióegyenlet szerint játszódik le: 2 NaN 3(s) 2 Na (s) +

Részletesebben

A kromoszómák kialakulása előtt a DNS állomány megkettőződik. A két azonos információ tartalmú DNS egymás mellé rendeződik és egy kromoszómát alkot.

A kromoszómák kialakulása előtt a DNS állomány megkettőződik. A két azonos információ tartalmú DNS egymás mellé rendeződik és egy kromoszómát alkot. Kromoszómák, Gének A kromoszóma egy hosszú DNS szakasz, amely a sejt életének bizonyos szakaszában (a sejtosztódás előkészítéseként) tömörödik, így fénymikroszkóppal láthatóvá válik. A kromoszómák két

Részletesebben

Biológia fogalma és felosztása

Biológia fogalma és felosztása Corvin köz Oktatási Központ 1082. Budapest, Kisfaludy u. 19. Tel: 786-3952 www.corvinkoz.hu Minden jog fenntartva. Biológia fogalma és felosztása A biológia az élőlények szervezetének, működésének jelenségeit

Részletesebben

3. változat. 2. Melyik megállapítás helyes: Az egyik gáz másikhoz viszonyított sűrűsége nem más,

3. változat. 2. Melyik megállapítás helyes: Az egyik gáz másikhoz viszonyított sűrűsége nem más, 3. változat z 1-től 16-ig terjedő feladatokban négy válaszlehetőség van, amelyek közül csak egy helyes. Válaszd ki a helyes választ és jelöld be a válaszlapon! 1. Jelöld meg az egyszerű anyagok számát

Részletesebben

A glükóz reszintézise.

A glükóz reszintézise. A glükóz reszintézise. A glükóz reszintézise. A reszintézis nem egyszerű megfordítása a glikolízisnek. A glikolízis 3 irrevezibilis lépése más úton játszódik le. Ennek oka egyrészt energetikai, másrészt

Részletesebben

Természetes vizek, keverékek mindig tartalmaznak oldott anyagokat! Írd le milyen természetes vizeket ismersz!

Természetes vizek, keverékek mindig tartalmaznak oldott anyagokat! Írd le milyen természetes vizeket ismersz! Összefoglalás Víz Természetes víz. Melyik anyagcsoportba tartozik? Sorolj fel természetes vizeket. Mitől kemény, mitől lágy a víz? Milyen okokból kell a vizet tisztítani? Kémiailag tiszta víz a... Sorold

Részletesebben

Biológia 3. zh. A gyenge sav típusú molekulák mozgása a szervezetben. Gyengesav transzport. A glükuronsavval konjugált molekulákat a vese kiválasztja.

Biológia 3. zh. A gyenge sav típusú molekulák mozgása a szervezetben. Gyengesav transzport. A glükuronsavval konjugált molekulákat a vese kiválasztja. Biológia 3. zh Az izomösszehúzódás szakaszai, molekuláris mechanizmusa, az izomösszehúzódás során milyen molekula deformálódik és hogyan? Minden izomrosthoz kapcsolódik kegy szinapszis, ez az úgynevezett

Részletesebben

TRANSZPORTFOLYAMATOK A SEJTEKBEN

TRANSZPORTFOLYAMATOK A SEJTEKBEN 16 A sejtek felépítése és mûködése TRANSZPORTFOLYAMATOK A SEJTEKBEN 1. Sejtmembrán elektronmikroszkópos felvétele mitokondrium (energiatermelõ és lebontó folyamatok) citoplazma (fehérjeszintézis, anyag

Részletesebben

KÉMIA ÍRÁSBELI ÉRETTSÉGI FELVÉTELI FELADATOK 2004.

KÉMIA ÍRÁSBELI ÉRETTSÉGI FELVÉTELI FELADATOK 2004. KÉMIA ÍRÁSBELI ÉRETTSÉGI FELVÉTELI FELADATOK 2004. JAVÍTÁSI ÚTMUTATÓ Az írásbeli felvételi vizsgadolgozatra összesen 100 (dolgozat) pont adható, a javítási útmutató részletezése szerint. Minden megítélt

Részletesebben