Lehninger et al.: Principles of Biochemistry 3 rd ed (2000); Worth Publ. Voet et al.: Fundamentals of Biochemistry 1 st ed (1999); John Wiley

Save this PDF as:
 WORD  PNG  TXT  JPG

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "Lehninger et al.: Principles of Biochemistry 3 rd ed (2000); Worth Publ. Voet et al.: Fundamentals of Biochemistry 1 st ed (1999); John Wiley"

Átírás

1 1

2 TANKÖNYVEK Stryer et al.: Biochemistry 5 th ed. (2002); W.H Freeman ISBN: Lehninger et al.: Principles of Biochemistry 3 rd ed (2000); Worth Publ. Garrett & Grisham: Biochemistry 2 nd ed (1998); Saunders Coll. Publ. Voet et al.: Fundamentals of Biochemistry 1 st ed (1999); John Wiley Mathews et al.: Biochemistry 3 rd ed (2000); Benjamin Cummings Bálint Miklós: Molekuláris biológia I.-III. Műszaki kiadó (2000,2002) 2

3 Az élő szervezetek anorganikus ionok, kis szerves molekulák, makromolekulák vizes oldatából és membránokból felépülő nyílt, nemegyensúlyi termodinamikai rendszerek. Az élet rendelkezik az önszerveződés, az önszabályozás, a katalízis, replikáció, a mutabilitás és az evolúció képességével. Az élet dinamikus (steady-state) állapotát a környezetből állandóan elvont, a rendszeren átáramló szabadenergia fluxus tartja fenn (disszipatív rendszer). Az élet bonyolultságát (komplexitás) az információs makromolekulák adják. 3

4 TÖRTÉNETI MÉRFÖLDKÖVEK 1828: F. Wöhler urea szintézis 1836,38: J. Berzelius protein, katalízis 1861,63: L. Pasteur erjedés mikróbákkal 1876: W. Kühne enzim, miozin, tripszin 1894: E. Fischer kulcs-zár hipotézis (1902) 1926: J. Sumner fehérje rjekristály ly (1946) 4

5 : Szent-Györgyi A. (1937), H. Krebs (1953) citrát-ciklus 1941: F. Lipmann (1953) ATP szerepe 1944: O. Avery DNS szerepe 1952: L. Pauling (1954, 63) fehérjeszerk. 1953: J. Watson, F. Crick (1962) DNS 5

6 1953: F. Sanger (1958, 80) inzulin szekvencia 1958,60: J. Kendrew & M. Perutz (1962) mioglobin és hemoglobin térszerkezet 1973: S. Cohen & Boyer (1986) rekombináns ns DNS 6

7 1995: J. Craig Venter első prokarióta genom 1996: konzorcium első eukarióta (élesztő) gen. 2000: HGP (F. Collins) & Celera (Venter) humán genom ( draft ) 7

8 ALAPELVEK DNS mint örökítőanyag (RNS vírusok, prionok) Információáramlás: DNS RNS fehérje ( centrális dogma ) Lineáris információ térbeli szerkezet specifitás, funkció 8

9 DIMENZIÓK A BIOKÉMIÁBAN MÉRETEK ATOMOK MAKROMOLEKULÁK SEJTEK MOLEKULÁK KOMPLEXEK C-C kötés hemoglobin fénymikroszkóp vörösvértest glükóz riboszóma baktérium m 10-9 m 10-8 m 10-7 m 10-6 m 10-5 m 1 Å 1 nm 1 µm kimotripszin glicin 1 nm 9

10 IDŐ fehérjék doménmozgása enzimreakciók baktérium generáció primer látás szignál DNS kitekeredés fehérje szintézis (ps) (ns) (µs) (ms) ENERGIA nem-kovalens kötés zöld fény glükóz hőmozgás ATP C-C kötés kcal/mol 0, kj/mol

11 BIOMOLEKULA Méret (nm) Tömeg * (Dalton) Víz 0,3 18 Alanin 0,5 89 Glicin 0,7 180 Foszfolipid 3,5 750 Ribonukleáz (kis protein) Immunoglobulin G Miozin (nagy protein) Riboszóma ΦX174 bakteriofág Piruvát-dehidrogenáz (multienzim komplex) Dohány mozaikvírus ,7x10-5 Mitokondrium ,5 E. coli sejt Kloroplasztisz Májsejt A molekulatömeg egysége a Dalton (vagy makromolekuláknál kd), definíció szerint a 12C-es szénizotóp tömegének 1/12-ed része. A molekulasúly (Mr) dimenzió nélküli szám, a molekulatömeg és a 12C-es szénizotóp tömege 1/12-ed részének hányadosa. (pg) 11

12 A MOLEKULÁRIS ORGANIZÁCIÓ HIERARCHIÁJA Környezeti prekurzorok, intermedierek víz acetát formamid 12

13 Építőkövek (nukleotidok, aminosavak, monoszacharidok, zsírsavak, glicerin) 13

14 Makromolekulák (>kda) nukleinsavak, fehérjék, poliszacharidok, lipidek hemolizin hemeritrin RNS polimeráz II 520 kd 14

15 Szupramolekuláris komplexek riboszóma, citoszkeleton, multienzim komplexek, vírusok stb. F-aktin Riboszóma 50S alegység 1600 kd Φ29 fág 15

16 E. coli molekuláris összetétele molekula típusa % % szárazanyag fajta Víz 70-1 Fehérje Nukleinsav DNS 1 1 RNS Szénhidrát Lipid Építőkő, Intermedier Szervetlen

17 AZ ÉLET MÁTRIXA: M GYENGE KÖLCSK LCSÖNHATÁSOK VIZES OLDATBAN Kovalens kötések k erőss ssége: : kj/mol C-C: C: 356 kj/mol mol; ; 1,54 Å Gyenge kölcsk lcsönhatás: 0,5-40 kj/mol ionkötés, hidrogén-kötés, van der Waalskötés, hidrofób b effektus Hőmozgás (kt)) 25 o C-on: 2,5 kj/mol 17

18 Ionos kötés (sóhíd, sókötés) 20 kj/mol; távolságfüggés: 1/r; kötéshossz: ~0,25 nm nem direkcionális E=kq 1 q 2 /Dr D:dielektromos konstans (D vakuum =1; D víz =80), q: töltés Hidrogén-híd donor csoport (nagy elektronegativitású atom: pl. OH, =NH) akceptor atom (pl. O, N, S) kj/mol; kötéshossz: 0,25-0,30 nm erősen direkcionális (részben kovalens jelleg) 18

19 Hidrogén donor Hidrogén akceptor Hidrogén donor Hidrogén akceptor 19

20 van der Waals kötések dipól-dipól (1/r 3 ) dipól-indukálta dipól (1/r 5 ) London-féle diszperziós (1/r 6 ) erősség: 0,5-4 kj/mol; kötéshossz: a két vdw-sugár összege (0,2-0,3 nm) sztérikus (szerkezeti) komplementaritás! 20

21 Gyenge kölcsk lcsönhatások 21

22 Hidrofób b effektus A hidrofób b molekulák k a vizes fázisbf zisból mintegy kizáródnak. Ily módon m a víz v termodinamikai szabadsága növekszik, n mivel nem kell a különállk lló hidrofób molekulák k körül k l rendezett, kvázi zi-kristályos klatrát struktúrát t létrehozni. l Tehát t a szabadenergia csökken kkenése (az interakció) ) a víz z entrópi piájának növekedn vekedéséből l adódik. dik. erőss sség: <40 kj/mol (egy CH 2 eltávol volítása vizes fázisbf zisból: -33 kj/mol mol) 22

23 A VÍZ V Z SZEREPE SZERKEZET Polaritás s (dipólus momentum: 1,85 debey) Intermolekuláris ris hidrogén-híd hálózat 23

24 Jég: hatszögű kristály, tetraéderes elrendeződés 4 H-híd / molekula kisebb sűrűségű (0,92 g/ml) mint a víz 24

25 Folyékony víz: 15%-kal kevesebb H-híd ~3,4 H-híd / molekula fluktuáló szerkezet (2x10-11 sec) 25

26 UNIVERZÁLIS OLDÓSZE SZER Hidrofil anyagok: hidrát t burok (2 nsec) Gyengíti az ionos és s H-híd H d kötéseketk (2-4 26

27 Hidrofób anyagok: klatrát szerkezet Amfipatikus (amfifil) molekulák: micellák, kettős hártyák 27

28 IONEGYENSÚLYOK Víz disszociáci ciója: H 2 O H + + OH H + + H 2 O H 3 O + Proton jumping ( ugrálás ): a H-híd hálózat következménye Gyors proton transzfer reakciók Egyensúlyi állandó: K eq = [H + ] [OH ] / [H 2 O] 28

29 Víz ionszorzata: (25 o C) K w = K eq [H 2 O] = [H + ] [OH ] = M 2 Sav-bázis reakciók: (Brønsted & Lowry, 1923) HA + H 2 O H 3 O + + A H 3 O + : konjugált sav (proton donor); A : konjugált bázis (proton akceptor) 29

30 Sav-bázis egyensúly: K a = K eq [H 2 O] = [H + ] [A ] / [HA] K a : savas disszociációs állandó (ionizációs konstans) Henderson-Hasselbalch egyenlet: pk a = lg [H + ] [A ] / [HA] = lg [H + ] lg [A ] / [HA] ph = pk a + lg [A ] / [HA] 30

Fehérjeszerkezet, és tekeredés

Fehérjeszerkezet, és tekeredés Fehérjeszerkezet, és tekeredés Futó Kinga 2013.10.08. Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983

Részletesebben

Fehérjeszerkezet, és tekeredés. Futó Kinga

Fehérjeszerkezet, és tekeredés. Futó Kinga Fehérjeszerkezet, és tekeredés Futó Kinga Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983 H 211861 N

Részletesebben

AZ ÉLET KÉMIÁJA... ÉLŐ ANYAG SZERVEZETI ALAPEGYSÉGE

AZ ÉLET KÉMIÁJA... ÉLŐ ANYAG SZERVEZETI ALAPEGYSÉGE AZ ÉLET KÉMIÁJA... ÉLŐ ANYAG SZERVEZETI ALAPEGYSÉGE A biológia az élet tanulmányozásával foglalkozik, az élő szervezetekre viszont vonatkoznak a fizika és kémia törvényei MI ÉPÍTI FEL AZ ÉLŐ ANYAGOT? HOGYAN

Részletesebben

A kovalens kötés polaritása

A kovalens kötés polaritása Általános és szervetlen kémia 4. hét Kovalens kötés A kovalens kötés kialakulásakor szabad atomokból molekulák jönnek létre. A molekulák létrejötte mindig energia csökkenéssel jár. A kovalens kötés polaritása

Részletesebben

Az élő szervezetek felépítése I. Biogén elemek biomolekulák alkotóelemei a természetben előforduló elemek közül 22 fordul elő az élővilágban O; N; C; H; P; és S; - élő anyag 99%-a Biogén elemek sajátosságai:

Részletesebben

KÉMIA 9-12. évfolyam (Esti tagozat)

KÉMIA 9-12. évfolyam (Esti tagozat) KÉMIA 9-12. évfolyam (Esti tagozat) A kémiai alapműveltség az anyagi világ megismerésének és megértésének egyik fontos eszköze. A kémia tanulása olyan folyamat, amely tartalmain és tevékenységein keresztül

Részletesebben

Kollokviumi vizsgakérdések biokémiából humánkineziológia levelező (BSc) 2015

Kollokviumi vizsgakérdések biokémiából humánkineziológia levelező (BSc) 2015 Kollokviumi vizsgakérdések biokémiából humánkineziológia levelező (BSc) 2015 A kérdés 1. A sejtről általában, a szervetlen alkotórészeiről, a vízről részletesen. 2. A sejtről általában, a szervetlen alkotórészeiről,

Részletesebben

Kémia. Tantárgyi programjai és követelményei A/2. változat

Kémia. Tantárgyi programjai és követelményei A/2. változat 5. sz. melléklet Kémia Tantárgyi programjai és követelményei A/2. változat Az 51/2012. (XII. 21.) számú EMMI rendelethez a 6/2014. (I.29.) EMMI rendelet 3. mellékleteként kiadott és a 34/2014 (IV. 29)

Részletesebben

1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói

1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói 1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói Plazmamembrán Membrán funkciói: sejt integritásának fenntartása állandó hő, energia, és információcsere biztosítása homeosztázis

Részletesebben

A kovalens kötés elmélete. Kovalens kötésű molekulák geometriája. Molekula geometria. Vegyértékelektronpár taszítási elmélet (VSEPR)

A kovalens kötés elmélete. Kovalens kötésű molekulák geometriája. Molekula geometria. Vegyértékelektronpár taszítási elmélet (VSEPR) 4. előadás A kovalens kötés elmélete Vegyértékelektronpár taszítási elmélet (VSEPR) az atomok kötő és nemkötő elektronpárjai úgy helyezkednek el a térben, hogy egymástól minél távolabb legyenek A központi

Részletesebben

Atomszerkezet. Atommag protonok, neutronok + elektronok. atompályák, alhéjak, héjak, atomtörzs ---- vegyérték elektronok

Atomszerkezet. Atommag protonok, neutronok + elektronok. atompályák, alhéjak, héjak, atomtörzs ---- vegyérték elektronok Atomszerkezet Atommag protonok, neutronok + elektronok izotópok atompályák, alhéjak, héjak, atomtörzs ---- vegyérték elektronok periódusos rendszer csoportjai Periódusos rendszer A kémiai kötés Kémiai

Részletesebben

BIOGÉN ELEMEK Azok a kémiai elemek, amelyek az élőlények számára létfontosságúak

BIOGÉN ELEMEK Azok a kémiai elemek, amelyek az élőlények számára létfontosságúak BIOGÉN ELEMEK Azok a kémiai elemek, amelyek az élőlények számára létfontosságúak A több mint száz ismert kémiai elem nagyobbik hányada megtalálható az élőlények testében is, de sokuknak nincsen kimutatható

Részletesebben

Kémiai reakciók. Közös elektronpár létrehozása. Általános és szervetlen kémia 10. hét. Elızı héten elsajátítottuk, hogy.

Kémiai reakciók. Közös elektronpár létrehozása. Általános és szervetlen kémia 10. hét. Elızı héten elsajátítottuk, hogy. Általános és szervetlen kémia 10. hét Elızı héten elsajátítottuk, hogy a kémiai reakciókat hogyan lehet csoportosítani milyen kinetikai összefüggések érvényesek Mai témakörök a közös elektronpár létrehozásával

Részletesebben

A fehérjék harmadlagos vagy térszerkezete. Még a globuláris fehérjék térszerkezete is sokféle lehet.

A fehérjék harmadlagos vagy térszerkezete. Még a globuláris fehérjék térszerkezete is sokféle lehet. A fehérjék harmadlagos vagy térszerkezete Még a globuláris fehérjék térszerkezete is sokféle lehet. A ribonukleáz redukciója és denaturálódása Chrisian B. Anfinsen A ribonukleáz renaturálódása 1972 obel-díj

Részletesebben

Az élő anyag szerkezeti egységei: víz, nukleinsavak, fehérjék. elrendeződés, rend, rendszer, periodikus ismétlődés

Az élő anyag szerkezeti egységei: víz, nukleinsavak, fehérjék. elrendeződés, rend, rendszer, periodikus ismétlődés Az élő anyag szerkezeti egységei: víz, nukleinsavak, fehérjék Agócs Gergely 2013. december 3. kedd 10:00 11:40 1. Mit értünk élő anyag alatt? Az élő szervezetet felépítő anyagok. Az anyag azonban nem csupán

Részletesebben

BIOKÉMIA. Simonné Prof. Dr. Sarkadi Livia egyetemi tanár.

BIOKÉMIA. Simonné Prof. Dr. Sarkadi Livia egyetemi tanár. BIOKÉMIA Simonné Prof. Dr. Sarkadi Livia egyetemi tanár e-mail: sarkadi@mail.bme.hu Tudományterületi elhelyezés Alaptudományok (pl.: matematika, fizika, kémia, biológia) Alkalmazott tudományok Interdiszciplináris

Részletesebben

Biopolimer 12/7/09. Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. DNS. Polimerek. Kardos Roland DNS elsődleges szerkezete

Biopolimer 12/7/09. Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. DNS. Polimerek. Kardos Roland DNS elsődleges szerkezete Biopolimerek Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. Osztódó sejt magorsófonala Kardos Roland 2009.10.29. Dohány levél epidermális sejtjének aktin hálózat Bakteriofágból kiszabaduló

Részletesebben

Általános kémia képletgyűjtemény. Atomszerkezet Tömegszám (A) A = Z + N Rendszám (Z) Neutronok száma (N) Mólok száma (n)

Általános kémia képletgyűjtemény. Atomszerkezet Tömegszám (A) A = Z + N Rendszám (Z) Neutronok száma (N) Mólok száma (n) Általános kémia képletgyűjtemény (Vizsgára megkövetelt egyenletek a szimbólumok értelmezésével, illetve az egyenletek megfelelő alkalmazása is követelmény) Atomszerkezet Tömegszám (A) A = Z + N Rendszám

Részletesebben

A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA

A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA 2013.10.09. CITOSZKELETON - DEFINÍCIÓ Fehérjékből felépülő, a sejt vázát alkotó intracelluláris rendszer. Eukarióta és prokarióta sejtekben egyaránt megtalálható.

Részletesebben

9. Előadás Fehérjék Előzmények Peptidkémia Analitikai kémia Protein kémia 1901 E.Fischer : Gly-Gly 1923 F. Pregl : Mikroanalitika 1952 Stein and Moore : Aminosav analizis 1932 Bergman és Zervas : Benziloxikarbonil

Részletesebben

Kémiai kötések. Kémiai kötések kj / mol 0,8 40 kj / mol

Kémiai kötések. Kémiai kötések kj / mol 0,8 40 kj / mol Kémiai kötések A természetben az anyagokat felépítő atomok nem önmagukban, hanem gyakran egymáshoz kapcsolódva léteznek. Ezeket a kötéseket összefoglaló néven kémiai kötéseknek nevezzük. Kémiai kötések

Részletesebben

Szerkesztette: Vizkievicz András

Szerkesztette: Vizkievicz András Fehérjék A fehérjék - proteinek - az élő szervezetek számára a legfontosabb vegyületek. Az élet bármilyen megnyilvánulási formája fehérjékkel kapcsolatos. A sejtek szárazanyagának minimum 50 %-át adják.

Részletesebben

MEDICINÁLIS ALAPISMERETEK AZ ÉLŐ SZERVEZETEK KÉMIAI ÉPÍTŐKÖVEI AZ AMINOSAVAK ÉS FEHÉRJÉK 1. kulcsszó cím: Aminosavak

MEDICINÁLIS ALAPISMERETEK AZ ÉLŐ SZERVEZETEK KÉMIAI ÉPÍTŐKÖVEI AZ AMINOSAVAK ÉS FEHÉRJÉK 1. kulcsszó cím: Aminosavak Modul cím: MEDICINÁLIS ALAPISMERETEK AZ ÉLŐ SZERVEZETEK KÉMIAI ÉPÍTŐKÖVEI AZ AMINOSAVAK ÉS FEHÉRJÉK 1. kulcsszó cím: Aminosavak Egy átlagos emberben 10-12 kg fehérje van, mely elsősorban a vázizomban található.

Részletesebben

A szénhidrátok lebomlása

A szénhidrátok lebomlása A disszimiláció Szerk.: Vizkievicz András A disszimiláció, vagy lebontás az autotróf, ill. a heterotróf élőlényekben lényegében azonos módon zajlik. A disszimilációs - katabolikus - folyamatok mindig valamilyen

Részletesebben

12/4/2014. Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció. 1952 Hershey & Chase 1953!!!

12/4/2014. Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció. 1952 Hershey & Chase 1953!!! Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció 1859 1865 1869 1952 Hershey & Chase 1953!!! 1879 1903 1951 1950 1944 1928 1911 1 1. DNS szerkezete Mi az örökítő anyag? Friedrich Miescher

Részletesebben

1. Bevezetés. Mi az élet, evolúció, információ és energiaáramlás, a szerveződés szintjei

1. Bevezetés. Mi az élet, evolúció, információ és energiaáramlás, a szerveződés szintjei 1. Bevezetés Mi az élet, evolúció, információ és energiaáramlás, a szerveződés szintjei 1.1 Mi az élet? Definíció Alkalmas legyen különbségtételre élő/élettelen közt Ne legyen túl korlátozó (más területen

Részletesebben

Oldódás, mint egyensúly

Oldódás, mint egyensúly Oldódás, mint egyensúly Szilárd (A) anyag oldódása: K = [A] oldott [A] szilárd állandó K [A] szilárd = [A] oldott S = telített oldat conc. Folyadék oldódása: analóg módon Gázok oldódása: [gáz] oldott K

Részletesebben

Kolloid állapotjelzők. Molekuláris kölcsönhatások. Határfelületi jelenségek: fluid határfelületek

Kolloid állapotjelzők. Molekuláris kölcsönhatások. Határfelületi jelenségek: fluid határfelületek Kolloid állapotjelzők. Molekuláris kölcsönhatások. Határfelületi jelenségek: fluid határfelületek Dr. Berka Márta Debreceni Egyetem TEK Kolloid- és Környezetkémiai Tanszék http://dragon.unideb.hu/~kolloid/

Részletesebben

Oldódás, mint egyensúly

Oldódás, mint egyensúly Oldódás, mint egyensúly Szilárd (A) anyag oldódása: K = [A] oldott [A] szilárd állandó K [A] szilárd = [A] oldott S = telített oldat conc. Folyadék oldódása: analóg módon Gázok oldódása: [gáz] oldott =

Részletesebben

A sejtek élete. 5. Robotoló törpék és óriások Az aminosavak és fehérjék R C NH 2. C COOH 5.1. A fehérjeépítőaminosavak általános

A sejtek élete. 5. Robotoló törpék és óriások Az aminosavak és fehérjék R C NH 2. C COOH 5.1. A fehérjeépítőaminosavak általános A sejtek élete 5. Robotoló törpék és óriások Az aminosavak és fehérjék e csak nézd! Milyen protonátmenetes reakcióra képes egy aminosav? R 2 5.1. A fehérjeépítőaminosavak általános képlete 5.2. A legegyszerűbb

Részletesebben

Farmakológus szakasszisztens Farmakológus szakasszisztens 2/34

Farmakológus szakasszisztens Farmakológus szakasszisztens 2/34 -06 Farmakológus szakasszisztens feladatok A 0/007 (II. 7.) SzMM rendelettel módosított /006 (II. 7.) OM rendelet Országos Képzési Jegyzékről és az Országos Képzési Jegyzékbe történő felvétel és törlés

Részletesebben

Poligénes v. kantitatív öröklődés

Poligénes v. kantitatív öröklődés 1. Öröklődés komplexebb sajátosságai 2. Öröklődés molekuláris alapja Poligénes v. kantitatív öröklődés Azok a tulajdonságokat amelyek mértékegységgel nem, vagy csak nehezen mérhetők, kialakulásuk kevéssé

Részletesebben

BIOMOLEKULÁK KÉMIÁJA. Novák-Nyitrai-Hazai

BIOMOLEKULÁK KÉMIÁJA. Novák-Nyitrai-Hazai BIOMOLEKULÁK KÉMIÁJA Novák-Nyitrai-Hazai A tankönyv elsısorban szerves kémiai szempontok alapján tárgyalja az élı szervezetek felépítésében és mőködésében kulcsfontosságú szerves vegyületeket. A tárgyalás-

Részletesebben

Sav bázis egyensúlyok vizes oldatban

Sav bázis egyensúlyok vizes oldatban Sav bázis egyensúlyok vizes oldatban Disszociációs egyensúlyi állandó HAc H + + Ac - ecetsav disszociációja [H + ] [Ac - ] K sav = [HAc] NH 4 OH NH 4 + + OH - [NH + 4 ] [OH - ] K bázis = [ NH 4 OH] Ammóniumhidroxid

Részletesebben

3. Sejtalkotó molekulák III.

3. Sejtalkotó molekulák III. 3. Sejtalkotó molekulák III. Fehérjék, fehérjeszintézis (transzkripció, transzláció, posztszintetikus módosítások). Enzimműködés 3.1 Fehérjék A genetikai információ egyik fő manifesztálódása Számos funkció

Részletesebben

Makromolekulák. Fehérjetekeredé. rjetekeredés. Biopolimer. Polimerek

Makromolekulák. Fehérjetekeredé. rjetekeredés. Biopolimer. Polimerek Biopolimerek Makromolekulá Makromolekulák. Fehé Fehérjetekeredé rjetekeredés. Osztódó sejt magorsófonala 2011. November 16. Huber Tamá Tamás Dohány levél epidermális sejtjének aktin hálózata Bakteriofágból

Részletesebben

Gáspári Zoltán. Élő molekulák az élet molekulái

Gáspári Zoltán. Élő molekulák az élet molekulái Gáspári Zoltán Élő molekulák az élet molekulái Invokáció Kajtár Márton 1929-1991 www.eotvoskiado.hu Élő és élettelen? Élő és élettelen: a kemoton Élő kémiai rendszer, de nem élőlény (Gánti, 1975) Autokatalitikus

Részletesebben

Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek

Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek Hidroxikarbonsavak α-hidroxi karbonsavak -Glikolsav (kézkrémek) - Tejsav (tejtermékek, izomláz, fogszuvasodás) - Citromsav (citrusfélékben,

Részletesebben

Genetika. Tartárgyi adatlap: tantárgy adatai

Genetika. Tartárgyi adatlap: tantárgy adatai Genetika Előadás a I. éves Génsebészet szakos hallgatók számára Tartárgyi adatlap: tantárgy adatai 2.1. Tantárgy címe Genetika 2.2. Előadás felelőse Dr. Mara Gyöngyvér, docens 2.3. Egyéb oktatási tevékenységek

Részletesebben

A piruvát-dehidrogenáz komplex. Csala Miklós

A piruvát-dehidrogenáz komplex. Csala Miklós A piruvát-dehidrogenáz komplex Csala Miklós szénhidrátok fehérjék lipidek glikolízis glukóz aminosavak zsírsavak acil-koa szintetáz e - piruvát acil-koa légz. lánc H + H + H + O 2 ATP szint. piruvát H

Részletesebben

Atomszerkezet. Atommag protonok, neutronok + elektronok. atompályák, alhéjak, héjak, atomtörzs ---- vegyérték elektronok

Atomszerkezet. Atommag protonok, neutronok + elektronok. atompályák, alhéjak, héjak, atomtörzs ---- vegyérték elektronok Atomszerkezet Atommag protonok, neutronok + elektronok izotópok atompályák, alhéjak, héjak, atomtörzs ---- vegyérték elektronok periódusos rendszer csoportjai Periódusos rendszer energia szintek atomokban

Részletesebben

FELKÉSZÍTÉS AZ EMELTSZINTŰ KÉMIA ÉRETTSÉGIRE 11. ÉVFOLYAM ÉVES ÓRASZÁM: 72 HETI ÓRASZÁM: 2

FELKÉSZÍTÉS AZ EMELTSZINTŰ KÉMIA ÉRETTSÉGIRE 11. ÉVFOLYAM ÉVES ÓRASZÁM: 72 HETI ÓRASZÁM: 2 FELKÉSZÍTÉS AZ EMELTSZINTŰ KÉMIA ÉRETTSÉGIRE 11. ÉVFOLYAM ÉVES ÓRASZÁM: 72 HETI ÓRASZÁM: 2 Tematikai egység Órakeret 1. Anyagszerkezeti ismeretek 10 2. Anyagi halmazok 10 3. Kémiai reakciótípusok 15 4.

Részletesebben

1. Az élő szervezetek felépítése és az életfolyamatok 17

1. Az élő szervezetek felépítése és az életfolyamatok 17 Élődi Pál BIOKÉMIA vomo; Akadémiai Kiadó, Budapest 1980 Tartalom Bevezetés 1. Az élő szervezetek felépítése és az életfolyamatok 17 Mi jellemző az élőre? 17. Biogén elemek 20. Biomolekulák 23. A víz 26.

Részletesebben

Kémiai reakciók Műszaki kémia, Anyagtan I. 11. előadás

Kémiai reakciók Műszaki kémia, Anyagtan I. 11. előadás Kémiai reakciók Műszaki kémia, Anyagtan I. 11. előadás Dolgosné dr. Kovács Anita egy.doc. PTE MIK Környezetmérnöki Tanszék Kémiai reakció Kémiai reakció: különböző anyagok kémiai összetételének, ill. szerkezetének

Részletesebben

A fehérjék szerkezete és az azt meghatározó kölcsönhatások

A fehérjék szerkezete és az azt meghatározó kölcsönhatások A fehérjék szerkezete és az azt meghatározó kölcsönhatások 1. A fehérjék szerepe az élõlényekben 2. A fehérjék szerkezetének szintjei 3. A fehérjék konformációs stabilitásáért felelõs kölcsönhatások 4.

Részletesebben

Az élő sejt fizikai Biológiája:

Az élő sejt fizikai Biológiája: Az élő sejt fizikai Biológiája: Modellépítés, biológiai rendszerek skálázódása Kellermayer Miklós Fizikai biológia Ma már nem csak kvalitatív megfigyeléseket, hanem kvantitatív méréseket végzünk (biológiai

Részletesebben

Kötések kialakítása - oktett elmélet

Kötések kialakítása - oktett elmélet Kémiai kötések Az elemek és vegyületek halmazai az atomok kapcsolódásával - kémiai kötések kialakításával - jönnek létre szabad atomként csak a nemesgázatomok léteznek elsődleges kémiai kötések Kötések

Részletesebben

Atomi, illetve molekuláris kölcsönhatások és alkalmazásaik

Atomi, illetve molekuláris kölcsönhatások és alkalmazásaik Atomi, illetve molekuláris kölcsönhatások és alkalmazásaik Bozó Tamás 2012. október 16. Atomi kölcsönhatások Nemesgázok: atomi előfordulás (He, Ne, Ar, Kr, Xe, Rn) Többi elem: molekulákat alkot (pl. H

Részletesebben

A felépítő és lebontó folyamatok. Biológiai alapismeretek

A felépítő és lebontó folyamatok. Biológiai alapismeretek A felépítő és lebontó folyamatok Biológiai alapismeretek Anyagforgalom: Lebontó Felépítő Lebontó folyamatok csoportosítása: Biológiai oxidáció Erjedés Lebontó folyamatok összehasonlítása Szénhidrátok

Részletesebben

Szalai István. ELTE Kémiai Intézet 1/74

Szalai István. ELTE Kémiai Intézet 1/74 Elsőrendű kötések Szalai István ELTE Kémiai Intézet 1/74 Az előadás vázlata ˆ Ismétlés ˆ Ionos vegyületek képződése ˆ Ionok típusai ˆ Kovalens kötés ˆ Fémes kötés ˆ VSEPR elmélet ˆ VB elmélet 2/74 Periodikus

Részletesebben

Human genome project

Human genome project Human genome project Pataki Bálint Ármin 2017.03.14. Pataki Bálint Ármin Human genome project 2017.03.14. 1 / 14 Agenda 1 Biológiai bevezető 2 A human genome project lefolyása 3 Alkalmazások, kitekintés

Részletesebben

Röntgen sugárzás. Wilhelm Röntgen. Röntgen feleségének keze

Röntgen sugárzás. Wilhelm Röntgen. Röntgen feleségének keze Röntgendiffrakció Kardos Roland 2010.03.08. Előadás vázlata Röntgen sugárzás Interferencia Huygens teória Diffrakció Diffrakciós eljárások Alkalmazás Röntgen sugárzás 1895 röntgen sugárzás felfedezés (1901

Részletesebben

Szakközépiskola 9-10. évfolyam Kémia. 9-10. évfolyam

Szakközépiskola 9-10. évfolyam Kémia. 9-10. évfolyam 9-10. évfolyam A szakközépiskolában a kémia tantárgy keretében folyó személyiségfejlesztés a természettudományos nevelés egyik színtereként a hétköznapi életben hasznosulni képes tudás épülését szolgálja.

Részletesebben

A biokémia alapjai. Typotex Kiadó. Wunderlich Lívius Szarka András

A biokémia alapjai. Typotex Kiadó. Wunderlich Lívius Szarka András A biokémia alapjai Wunderlich Lívius Szarka András Összefoglaló: A jegyzet elsősorban egészségügyi mérnök MSc. hallgatók részére íródott, de hasznos segítség lehet biomérnök és vegyészmérnök hallgatók

Részletesebben

CHO H H H OH H OH OH H CH2OH HC OH HC OH HC OH CH 2

CHO H H H OH H OH OH H CH2OH HC OH HC OH HC OH CH 2 4. Előadás ukleozidok, nukleotidok, nukleinsavak Történeti háttér Savas karakterű anyagok a sejtmagból 1869-71 DS a sejtmag fő komponense F. Miescher (Svájc) 1882 Flemming: Chromatin elnevezés Waldeyer:

Részletesebben

Az anyagi rendszer fogalma, csoportosítása

Az anyagi rendszer fogalma, csoportosítása Az anyagi rendszer fogalma, csoportosítása A bemutatót összeállította: Fogarasi József, Petrik Lajos SZKI, 2011 1 1 A rendszer fogalma A körülöttünk levő anyagi világot atomok, ionok, molekulák építik

Részletesebben

A fehérjék hierarchikus szerkezete

A fehérjék hierarchikus szerkezete Fehérjék felosztása A fehérjék hierarchikus szerkezete Smeller László Semmelweis Egyetem Biofizikai és Sugárbiológiai Intézet Biológiai funkció alapján Enzimek (pl.: tripszin, citokróm-c ) Transzportfehérjék

Részletesebben

KÉMIA. 10. évfolyamos vizsga

KÉMIA. 10. évfolyamos vizsga 10. évfolyamos vizsga A vizsga leírása: A vizsga csak szóbeli részből áll. A vizsgán két tételt kell húzni. Az A tétel a 9. évfolyam ismeretanyagára, a B tétel a 10. évfolyam ismeretanyagának a vizsga

Részletesebben

A BIOLÓGIAI JELENSÉGEK FIZIKAI HÁTTERE Zimányi László

A BIOLÓGIAI JELENSÉGEK FIZIKAI HÁTTERE Zimányi László A BIOLÓGIAI JELENSÉGEK FIZIKAI HÁTTERE Zimányi László Összefoglalás A négy alapvető fizikai kölcsönhatás közül az elektromágneses kölcsönhatásnak van fontos szerepe a biológiában. Atomi és molekuláris

Részletesebben

A szénhidrátok lebomlása

A szénhidrátok lebomlása A disszimiláció Szerk.: Vizkievicz András A disszimiláció, vagy lebontás az autotróf, ill. a heterotróf élőlényekben lényegében azonos módon zajlik. A disszimilációs - katabolikus - folyamatok mindig valamilyen

Részletesebben

Kémiai alapismeretek 6. hét

Kémiai alapismeretek 6. hét Kémiai alapismeretek 6. hét Horváth Attila Pécsi Tudományegyetem, Természettudományi Kar, Kémia Intézet, Szervetlen Kémiai Tanszék biner 2013. október 7-11. 1/15 2013/2014 I. félév, Horváth Attila c Egyensúly:

Részletesebben

A bioenergetika a biokémiai folyamatok során lezajló energiaváltozásokkal foglalkozik.

A bioenergetika a biokémiai folyamatok során lezajló energiaváltozásokkal foglalkozik. Modul cím: MEDICINÁLIS ALAPISMERETEK BIOKÉMIA BIOENERGETIKA I. 1. kulcsszó cím: Energia A termodinamika első főtétele kimondja, hogy a különböző energiafajták átalakulhatnak egymásba ez az energia megmaradásának

Részletesebben

Az átlagok jelentése és haszna

Az átlagok jelentése és haszna Az átlagok jelentése és haszna A különféle átlagok iránti szükséglet azért alakult ki, mert a különböző kísérleti módszerek eltérő módon érzékelik a polidiszperz rendszereket.a frakciók más-más tulajdonságaira

Részletesebben

BIOKÉMIA. levelezõ MSc számára A TANTÁRGY KÖVETELMÉNYRENDSZERE

BIOKÉMIA. levelezõ MSc számára A TANTÁRGY KÖVETELMÉNYRENDSZERE levelezõ MSc számára A TANTÁRGY KÖVETELMÉNYRENDSZERE MKK 2009/2010. tanév, 1. félév KÖVETELMÉNYRENDSZER A TÁRGY KÖVETELMÉNYRENDSZERE ÉS VIZSGARENDJE 1. A félév elismerésének feltétele S Az összes gyakorlat

Részletesebben

OZMÓZIS, MEMBRÁNTRANSZPORT

OZMÓZIS, MEMBRÁNTRANSZPORT OZMÓZIS, MEMBRÁNTRANSZPORT Vig Andrea PTE ÁOK Biofizikai Intézet 2014.10.28. ÁTTEKINTÉS DIFFÚZIÓ BROWN-MOZGÁS a részecskék rendezetlen hőmozgása DIFFÚZIÓ a részecskék egyenletlen (inhomogén) eloszlásának

Részletesebben

A MITOKONDRIUMOK SZEREPE A SEJT MŰKÖDÉSÉBEN. Somogyi János -- Vér Ágota Első rész

A MITOKONDRIUMOK SZEREPE A SEJT MŰKÖDÉSÉBEN. Somogyi János -- Vér Ágota Első rész A MITOKONDRIUMOK SZEREPE A SEJT MŰKÖDÉSÉBEN Somogyi János -- Vér Ágota Első rész Már több mint 200 éve ismert, hogy szöveteink és sejtjeink zöme oxigént fogyaszt. Hosszú ideig azt hitték azonban, hogy

Részletesebben

KÉMIA ÍRÁSBELI ÉRETTSÉGI- FELVÉTELI FELADATOK 1995 JAVÍTÁSI ÚTMUTATÓ

KÉMIA ÍRÁSBELI ÉRETTSÉGI- FELVÉTELI FELADATOK 1995 JAVÍTÁSI ÚTMUTATÓ 1 oldal KÉMIA ÍRÁSBELI ÉRETTSÉGI- FELVÉTELI FELADATOK 1995 JAVÍTÁSI ÚTMUTATÓ I A VÍZ - A víz molekulája V-alakú, kötésszöge 109,5 fok, poláris kovalens kötések; - a jég molekularácsos, tetraéderes elrendeződés,

Részletesebben

Energiatermelés a sejtekben, katabolizmus. Az energiaközvetítő molekula: ATP

Energiatermelés a sejtekben, katabolizmus. Az energiaközvetítő molekula: ATP Energiatermelés a sejtekben, katabolizmus Az energiaközvetítő molekula: ATP Elektrontranszfer, a fontosabb elektronszállító molekulák NAD: nikotinamid adenin-dinukleotid FAD: flavin adenin-dinukleotid

Részletesebben

Általános Kémia. Sav-bázis egyensúlyok. Ecetsav és sósav elegye. Gyenge sav és erős sav keveréke. Példa8-1. Példa 8-1

Általános Kémia. Sav-bázis egyensúlyok. Ecetsav és sósav elegye. Gyenge sav és erős sav keveréke. Példa8-1. Példa 8-1 Sav-bázis egyensúlyok 8-1 A közös ion effektus 8-1 A közös ion effektus 8-2 ek 8-3 Indikátorok 8- Semlegesítési reakció, titrálási görbe 8-5 Poliprotikus savak oldatai 8-6 Sav-bázis egyensúlyi számítások,

Részletesebben

RNS-ek. 1. Az ősi RNS Világ: - az élet hajnalán. 2. Egy már ismert RNS Világ: - a fehérjeszintézis ben résztvevő RNS-ek

RNS-ek. 1. Az ősi RNS Világ: - az élet hajnalán. 2. Egy már ismert RNS Világ: - a fehérjeszintézis ben résztvevő RNS-ek RNS-ek RNS-ek 1. Az ősi RNS Világ: - az élet hajnalán 2. Egy már ismert RNS Világ: - a fehérjeszintézis ben résztvevő RNS-ek 3. Egy újonnan felfedezett RNS Világ: - szabályozó RNS-ek 4. Transzkripció Ősi

Részletesebben

TRANSZPORTFOLYAMATOK 1b. Fehérjék. 1b. FEHÉRJÉK TRANSZPORTJA A MEMBRÁNONOKBA ÉS A SEJTSZERVECSKÉK BELSEJÉBE ÁLTALÁNOS

TRANSZPORTFOLYAMATOK 1b. Fehérjék. 1b. FEHÉRJÉK TRANSZPORTJA A MEMBRÁNONOKBA ÉS A SEJTSZERVECSKÉK BELSEJÉBE ÁLTALÁNOS 1b. FEHÉRJÉK TRANSZPORTJA A MEMBRÁNONOKBA ÉS A SEJTSZERVECSKÉK BELSEJÉBE ÁLTALÁNOS DIA 1 Fő fehérje transzport útvonalak Egy tipikus emlős sejt közel 10,000 féle fehérjét tartalmaz (a test pedig összesen

Részletesebben

TestLine - Biogén elemek, molekulák Minta feladatsor

TestLine - Biogén elemek, molekulák Minta feladatsor TestLine - iogén elemek, molekulák iogén elemek, szervetlen és szerves molekulák az élő szervezetben. gészítsd ki a mondatot! aminocsoportja kondenzáció víz ún. peptidkötés 1. 1:48 Normál fehérjék biológiai

Részletesebben

A kémiai energia átalakítása a sejtekben

A kémiai energia átalakítása a sejtekben A kémiai energia átalakítása a sejtekben A sejtek olyan mikroszkópikus képződmények amelyek működése egy vegyi gyárhoz hasonlítható. Tehát a sejtek mikroszkópikus vegyi gyárak. Mi mindenben hasonlítanak

Részletesebben

ZÁRÓJELENTÉS. Fény hatására végbemenő folyamatok önszerveződő rendszerekben

ZÁRÓJELENTÉS. Fény hatására végbemenő folyamatok önszerveződő rendszerekben ZÁRÓJELENTÉS Fény hatására végbemenő folyamatok önszerveződő rendszerekben Jól megválasztott anyagok elegyítésekor, megfelelő körülmények között másodlagos kötésekkel összetartott szupramolekuláris rendszerek

Részletesebben

Agrármérnök MSc KÖVETELMÉNYRENDSZER Alkalmazott biokémia SMKKB4011AN ALKALMAZOTT BIOKÉMIA A TÁRGY KÖVETELMÉNYRENDSZERE ÉS VIZSGARENDJE

Agrármérnök MSc KÖVETELMÉNYRENDSZER Alkalmazott biokémia SMKKB4011AN ALKALMAZOTT BIOKÉMIA A TÁRGY KÖVETELMÉNYRENDSZERE ÉS VIZSGARENDJE Agrármérnök MSc KÖVETELMÉNYRENDSZER Alkalmazott biokémia SMKKB4011AN A TÁRGY KÖVETELMÉNYRENDSZERE ÉS VIZSGARENDJE 1. Előadás Az előadások látogatását nem ellenőrizzük, de mindenki számára ajánlott! Az

Részletesebben

Biokémiai kutatások ma

Biokémiai kutatások ma Nyitray László Biokémiai Tanszék Hb Biokémiai kutatások ma Makromolekulák szerkezet-funkció kutatása Molekuláris biológia minden szinten Redukcionista molekuláris biológia vs. holisztikus rendszerbiológia

Részletesebben

BIOKÉMIA A TÁRGY KÖVETELMÉNYRENDSZERE ÉS VIZSGARENDJE

BIOKÉMIA A TÁRGY KÖVETELMÉNYRENDSZERE ÉS VIZSGARENDJE Biokémia (SMKKB4011XN) KÖVETELMÉNYRENDSZER Biotechnológus MSc A TÁRGY KÖVETELMÉNYRENDSZERE ÉS VIZSGARENDJE 1. Előadás Az előadások való részvétel ajánlott! Az előadásokon és a gyakorlatokon elhangzottak

Részletesebben

Fehérjeszerkezet, fehérjetekeredés

Fehérjeszerkezet, fehérjetekeredés Fehérjeszerkezet, fehérjetekeredés A fehérjeszerkezet szintjei A fehérjetekeredés elmélete: Anfinsen kísérlet Levinthal paradoxon A feltekeredés tölcsér elmélet 2014.11.05. Aminosavak és fehérjeszerkezet

Részletesebben

KÉMIA I. RÉSZLETES ÉRETTSÉGI VIZSGAKÖVETELMÉNY A) KOMPETENCIÁK

KÉMIA I. RÉSZLETES ÉRETTSÉGI VIZSGAKÖVETELMÉNY A) KOMPETENCIÁK KÉMIA Elvárt kompetenciák: I. RÉSZLETES ÉRETTSÉGI VIZSGAKÖVETELMÉNY A) KOMPETENCIÁK induktív következtetés (egyedi tényekből az általános törvényszerűségekre) deduktív következtetés (az általános törvényszerűségekből

Részletesebben

A tananyag felépítése: A BIOLÓGIA ALAPJAI. I. Prokarióták és eukarióták. Az eukarióta sejt. Pécs Miklós: A biológia alapjai

A tananyag felépítése: A BIOLÓGIA ALAPJAI. I. Prokarióták és eukarióták. Az eukarióta sejt. Pécs Miklós: A biológia alapjai A BIOLÓGIA ALAPJAI A tananyag felépítése: Környezetmérnök és műszaki menedzser hallgatók számára Előadó: 2 + 0 + 0 óra, félévközi számonkérés 3 ZH: október 3, november 5, december 5 dr. Pécs Miklós egyetemi

Részletesebben

Osztály: 9 L. Tantárgy: Biológia Tanár: Filipszki Zsuzsa Időszak: III. negyedév Tananyag:

Osztály: 9 L. Tantárgy: Biológia Tanár: Filipszki Zsuzsa Időszak: III. negyedév Tananyag: Osztály: 9 L. Tantárgy: Biológia Tanár: Filipszki Zsuzsa Időszak: III. A harasztok, a nyitvatermők, a zárvatermők jellemzői (rendszer, felépítés, szaporodás) A növényi sejtek és szövetek, a gyökér : felépítése,

Részletesebben

KÉMIA Kiss Árpád Országos Közoktatási Szolgáltató Intézmény Vizsgafejlesztő Központ 2003

KÉMIA Kiss Árpád Országos Közoktatási Szolgáltató Intézmény Vizsgafejlesztő Központ 2003 KÉMIA Kiss Árpád Országos Közoktatási Szolgáltató Intézmény Vizsgafejlesztő Központ 2003 I. RÉSZLETES ÉRETTSÉGI VIZSGAKÖVETELMÉNY A) KOMPETENCIÁK A vizsgázónak a követelményrendszerben és a vizsgaleírásban

Részletesebben

MEDICINÁLIS ALAPISMERETEK BIOKÉMIA A BIOLÓGIAI MEMBRÁNOK 1. kulcsszó cím: MEMBRÁNOK

MEDICINÁLIS ALAPISMERETEK BIOKÉMIA A BIOLÓGIAI MEMBRÁNOK 1. kulcsszó cím: MEMBRÁNOK Modul cím: MEDICINÁLIS ALAPISMERETEK BIOKÉMIA A BIOLÓGIAI MEMBRÁNOK 1. kulcsszó cím: MEMBRÁNOK A membránok minden sejtnek lényeges alkotórészei. Egyrészt magát a sejtet határolják - ez a sejtmembrán vagy

Részletesebben

KÉMIA ÍRÁSBELI ÉRETTSÉGI-FELVÉTELI FELADATOK 2003.

KÉMIA ÍRÁSBELI ÉRETTSÉGI-FELVÉTELI FELADATOK 2003. KÉMIA ÍRÁSBELI ÉRETTSÉGI-FELVÉTELI FELADATK 2003. JAVÍTÁSI ÚTMUTATÓ Az írásbeli felvételi vizsgadolgozatra összesen 100 (dolgozat) pont adható, a javítási útmutató részletezése szerint. Minden megítélt

Részletesebben

a. 35-ös tömegszámú izotópjában 18 neutron található. b. A 3. elektronhéján két vegyértékelektront tartalmaz. c. 2 mól atomjának tömege 32 g.

a. 35-ös tömegszámú izotópjában 18 neutron található. b. A 3. elektronhéján két vegyértékelektront tartalmaz. c. 2 mól atomjának tömege 32 g. MAGYAR TANNYELVŰ KÖZÉPISKOLÁK IX. ORSZÁGOS VETÉLKEDŐJE AL IX.-LEA CONCURS PE ŢARĂ AL LICEELOR CU LIMBĂ DE PREDARE MAGHIARĂ FABINYI RUDOLF KÉMIA VERSENY - SZERVETLEN KÉMIA Marosvásárhely, Bolyai Farkas

Részletesebben

Nukleinsavak. Szerkezet, szintézis, funkció

Nukleinsavak. Szerkezet, szintézis, funkció Nukleinsavak Szerkezet, szintézis, funkció Nukleinsavak, nukleotidok, nukleozidok 1869-ben Miescher a sejtmagból egy savas természetű, lúgban oldódó foszfortartalmú anyagot izolált, amit később, eredetére

Részletesebben

Tantárgyi követelmény gimnázium 10. évfolyam

Tantárgyi követelmény gimnázium 10. évfolyam Tantárgyi követelmény gimnázium 10. évfolyam 2015/2016 TARTALOMJEGYZÉK 1. Irodalom és művészetek... 3 2. Anyanyelv és kommunikáció... 4 3. földrajz... 5 4. Történelem és állampolgári ismeretek... 6 5.

Részletesebben

KÉMIA. Kiss Árpád Országos Közoktatási Szolgáltató Intézmény Vizsgafejlesztő Központ 2003

KÉMIA. Kiss Árpád Országos Közoktatási Szolgáltató Intézmény Vizsgafejlesztő Központ 2003 KÉMIA Kiss Árpád Országos Közoktatási Szolgáltató Intézmény Vizsgafejlesztő Központ 2003 ű érettségire felkészítő tananyag tanterve /11-12. ill. 12-13. évfolyam/ Elérendő célok: a természettudományos gondolkodás

Részletesebben

A glükóz reszintézise.

A glükóz reszintézise. A glükóz reszintézise. A glükóz reszintézise. A reszintézis nem egyszerű megfordítása a glikolízisnek. A glikolízis 3 irrevezibilis lépése más úton játszódik le. Ennek oka egyrészt energetikai, másrészt

Részletesebben

KÉMIA HELYI TANTERV A 10. ÉVFOLYAM

KÉMIA HELYI TANTERV A 10. ÉVFOLYAM KÉMIA HELYI TANTERV A 10. ÉVFOLYAM KÉTTANNYELVŰ ÉS NYELVI ELŐKÉSZÍTŐ OSZTÁLY SZÁMÁRA Károlyi Mihály Fővárosi Gyakorló Kéttannyelvű Közgazdasági Szakközépiskola 1 KÉMIA A nevelőtestület határozata alapján

Részletesebben

A fehérjék hierarchikus szerkezete

A fehérjék hierarchikus szerkezete Fehérjék felosztása A fehérjék hierarchikus szerkezete Smeller László Semmelweis Egyetem Biofizikai és Sugárbiológiai Intézet Biológiai funkció alapján Enzimek (pl.: tripszin, citokróm-c ) Transzportfehérjék

Részletesebben

AJÁNLOTT IRODALOM. A tárgy neve BIOKÉMIA I. Meghirdető tanszék(csoport) SZTE TTK, Biokémiai Tanszék Felelős oktató:

AJÁNLOTT IRODALOM. A tárgy neve BIOKÉMIA I. Meghirdető tanszék(csoport) SZTE TTK, Biokémiai Tanszék Felelős oktató: A tárgy neve BIOKÉMIA I. Meghirdető tanszék(csoport) SZTE TTK, Biokémiai Tanszék Felelős oktató: Dr Lehoczki Endréné Kredit 2 Heti óraszám 2 típus Előadás Számonkérés Kollokvium Teljesíthetőség feltétele

Részletesebben

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin.

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin. Myoglobin Fehérje-szerkezetek! MGLSDGEWQLVLNVWGKVEADIPGGQEVLIRLFK GPETLEKFDKFKLKSEDEMKASE DLKKGATVLTALGGILKKKGEAEIKPLAQSA TKKIPVKYLEFISECIIQVLQSK PGDFGADAQGAMNKALELFRKDMASNYKELGFQG Fuxreiter Mónika! Debreceni

Részletesebben

1. feladat Összesen: 10 pont. 2. feladat Összesen: 6 pont. 3. feladat Összesen: 18 pont

1. feladat Összesen: 10 pont. 2. feladat Összesen: 6 pont. 3. feladat Összesen: 18 pont 1. feladat Összesen: 10 pont Etil-acetátot állítunk elő 1 mol ecetsav és 1 mol etil-alkohol felhasználásával. Az egyensúlyi helyzet beálltakor a reakciót leállítjuk, és az elegyet 1 dm 3 -re töltjük fel.

Részletesebben

Hamar Péter. RNS világ. Lánczos Kornél Gimnázium, Székesfehérvár, 2014. október 21. www.meetthescientist.hu 1 26

Hamar Péter. RNS világ. Lánczos Kornél Gimnázium, Székesfehérvár, 2014. október 21. www.meetthescientist.hu 1 26 Hamar Péter RNS világ Lánczos Kornél Gimnázium, Székesfehérvár, 2014. október 21. 1 26 Főszereplők: DNS -> RNS -> fehérje A kód lefordítása Dezoxy-ribo-Nuklein-Sav: DNS az élet kódja megkettőződés (replikáció)

Részletesebben

KÉMIA FELVÉTELI DOLGOZAT

KÉMIA FELVÉTELI DOLGOZAT KÉMIA FELVÉTELI DOLGOZAT I. Egyszerű választásos teszt Karikázza be az egyetlen helyes, vagy egyetlen helytelen választ! 1. Hány neutront tartalmaz a 127-es tömegszámú, 53-as rendszámú jód izotóp? A) 74

Részletesebben

ZSÍRSAVAK OXIDÁCIÓJA. FRANZ KNOOP német biokémikus írta le először a mechanizmusát. R C ~S KoA. a, R-COOH + ATP + KoA R C ~S KoA + AMP + PP i

ZSÍRSAVAK OXIDÁCIÓJA. FRANZ KNOOP német biokémikus írta le először a mechanizmusát. R C ~S KoA. a, R-COOH + ATP + KoA R C ~S KoA + AMP + PP i máj, vese, szív, vázizom ZSÍRSAVAK XIDÁCIÓJA FRANZ KNP német biokémikus írta le először a mechanizmusát 1 lépés: a zsírsavak aktivációja ( a sejt citoplazmájában, rövid zsírsavak < C12 nem aktiválódnak)

Részletesebben

7. A SEJT A SEJT 1. ÁLTALÁNOS TUDNIVALÓK

7. A SEJT A SEJT 1. ÁLTALÁNOS TUDNIVALÓK A SEJT 1. ÁLTALÁNOS TUDNIVALÓK DIA 1 DIA 2 DIA 3 DIA 4 A sejtbiológia a biológiának az a tudományterülete, amely a sejt szerkezeti felépítésével, a különféle sejtfolyamatokkal (sejtlégzés, anyagtranszport,

Részletesebben

Röntgendiffrakció, tömegspektrometria, infravörös spektrometria.

Röntgendiffrakció, tömegspektrometria, infravörös spektrometria. A biomolekuláris szerkezet és dinamika vizsgálómódszerei: Röntgendiffrakció, tömegspektrometria, infravörös spektrometria. Smeller László A molekuláris szerkezet és dinamika vizsgáló módszereinek áttekintése

Részletesebben

Sillabusz orvosi kémia szemináriumokhoz 1. Kémiai kötések

Sillabusz orvosi kémia szemináriumokhoz 1. Kémiai kötések Sillabusz orvosi kémia szemináriumokhoz 1. Kémiai kötések Pécsi Tudományegyetem Általános Orvostudományi Kar 2010-2011. 1 A vegyületekben az atomokat kémiai kötésnek nevezett erők tartják össze. Az elektronok

Részletesebben