Prológus helyett polimorfizmus kapcsolodó-mutációk

Save this PDF as:
 WORD  PNG  TXT  JPG

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "Prológus helyett polimorfizmus kapcsolodó-mutációk"

Átírás

1 Prológus helyett polimorfizmus kapcsolodó-mutációk egy vesebetegség öröklésének vizsgálata során rámutattak, hogy hogyan okozhatnak gyakori genetikai variánsok ritka betegséget. Jó hír ez, mivel segíthet megérteni a genetikai variánsok és a betegségek kapcsolatát. Vizsgálati eredményüknek köszönhetően sok eddig veszélyeztettnek gondolt mutáció-hordozó pár mentesül beteg gyermek születésének félelmétől.

2 A fehérjék Janus-arca: végzetes változások Perczel András és munkatársai MTA_ELTE Fehérjemodellező Kutatócsoport és ELTE Szerkezeti Kémia és Biológia Laboratóriuma Budapest, 2015, február 19. alkimia ma jubileumi 100. előadás 2

3 Janus-arc Kezdet és a vég istene (római mitológia) Nem szimmetrikus: történetiséget kódol Kezdetben az istenek apjának tartották. A január hónap róla kapta nevét.

4 Janus-arc: végzetes változások Kezdet és a vég istene (római mitológia) Ellentétre, ellentmondásra, a végzetre is utalhat A Janus-arcú megnevezést gyakran használják a kettősségre, a kétszínűségre.

5 A fehérjék Janus-arca: végzetes változások Prion Protein (PrP) egy Janus-arcú fehérje, melynek van nem-fertőző és fertőző (izo)formája. Stanley B. Prusiner (orvosi Nobel-díj 1997) a fertőzés egy új formájának, a prion felfedezésért. A kuru (nevető halál) felfedezésért Gajdusek és Blumberggel megkapja 1976-ban a fiziológiai és orvostudományi Nobel-díjat.

6 A Janus-arcú fehérje fertőző prion fertőzés egyedi mechanizmusú, mert nem tartalmaz: - örökítőanyagot (nukleinsavat), - nem baktérium, - nem vírus, - nem parazita, - nem gomba, Prusiner szerint a prion: - térszerkezete változik, - változásait átörökíti, - nukleinsav nélkül szaporodik

7 A fehérjék Janus-arca: a fertőző térszerkezet váltás prion okozza: - a szarvasmarhák agyvelőelfajulását (BSE) - a nyércek aleuti betegségét, - a juhok surlókórját, - az emberi CJ.-szindrómát - kurut (nevető halált)

8 A fehérjék Janus-arca: a fertőző térszerkezet váltás - A prion normális változata az emlős sejtek sokaságában megtalálható (főként az idegrendszer sejtjeiben). - A kóros prionfehérjék az idegsejtek felszínén található egészséges prionfehérjéket elrontják, saját képükre formálják azok térszerkezetét! Proteáz rezisztens fertőző fehérjék, amely az idegrendszer sajátos degeneratív megbetegedését hozza létre.

9 A férjék az élet hordozó molekulái Az első önreprodukcióra, önfenntartásra, önszabályozásra képes anyagi rendszerek kialakulása mintegy 4 milliárd évvel ezelőttre tehető. átmérő: 0,1-15 μm archeák (Archaebacteria), (görög αρχαία, ősi eredetű ) sejtmag nélküli, azaz prokarióta szervezetek.

10 A férjék az élet hordozói Az első önreprodukcióra, önfenntartásra, önszabályozásra képes anyagi rendszerek kialakulása mintegy 4 milliárd évvel ezelőttre tehető. átmérő: 0,1-15 μm archeák (Archaebacteria), (görög αρχαία, ősi eredetű ) sejtmag nélküli, azaz prokarióta szervezetek.

11 A férjék az élet hordozói a fehérjék sokrétű biopolimerek - katalizáló és szabályozó funkció (enzimek és hormonok) - jelző és jelátviteli funkció - szerkezeti funkciók (aktin, tubulin, kollagén, elasztin, keratin, stb.) - szállító funkció (hemoglobin/o 2, kazein/ca 2+, ioncsatornák,...) - motor-funkció (miozin, kinezin, ). Az élő rendszerekben a víz után a fehérje a legelterjedtebb molekulatípus.

12 A sokaság nem esetlegesség A Humán Genom Projekt (2006) keretében meghatározták és leírták nukleotidok szintjén az emberi DNS teljes könyvtárát. A 23 emberi kromoszóma mintegy 3 milliárd DNS bázispárból áll, ami körülbelül ún. gént kódol, amelyek később fehérjévé íródhatnak át

13 A fehérjék lineáris polimerek Bármely fehérje mindössze 20 aminosavból felépülő lineáris polimer.

14 A feltekeredett fehérjeszerkezet David Phillips 1965-ben meghatározta a lizozim térszerkezetét

15 A hatásért a feltekeredett szerkezet felelős Sok fehérje önmagától tekeredik fel és globuláris struktúrát hoznak létre, amely téralkat összefügg annak biológiai funkcióival. (C.B.Anfinsen 1972). Ha tehát egy fehérje letekeredik (denaturálodik), akkor nem csak a térszerkezete, de biológiai funkciója is elvész!

16 A fehérjék végzetes amiloiddá alakulása A nyíltabb konformerek relatív gyakoriságának megnövekedése a fehérje amiloid-szerű aggregációjához majd csapadékképzéshez vezethet. Booth et al., Nature 385, 787 (1997) Példa: a lizozim egyes pont-mutációi kiválthatnak ilyen hatást.

17 Intermedierek és nyílt formák felderítése NMR spektroszkópiával P. Rovó, Chemistry a European Journal 2013, 19, G 11 -P 12 trans G 11 -P 12 cis G 11 -G 15 a-helix G 11 -G helix 17 17

18 Feltekeredés vagy aggregáció? natív forma felvétele (kódolt info.) A fehérjék egyedi globuláris téralkatuk mellett, jól strukturált, fibrilláris formává is alakulhatnak hibás feltekeredés, aggregáció (nem-kódolt info.) Az aggregáció amiloid -szerű szerkezetet eredményez, amely az Alzheimer-kórt kísérő struktúrákhoz hasonlít

19 Amiloid-szerű aggregátumok szerkezete Az amiloidstruktúrák ismétlődő -redőkből állnak, melyeket a főtengelyre merőleges -szálak építenek fel. Jimenez et al PNAS 2002 Nelson et al. Nature 2005 Sawaya et al. Nature 2007 D.Eisenberg & M.Jucker Cell 2012 Sunde & Blake, Adv. Prot. Chem Az amiloid-szerű -redők kialakulása nincs a fehérje szekvenciába kódolva, független attól!

20 Amiloid struktúrák topológiája Két ortogonális sík, két betöltendő szerepkör: (a,c):= (a,b):= H-hidakkal stabilizált -rétegek az amiloid struktúrák ismertetőjegyei. Molekuláris ragasztó?

21 Ahogy ma látjuk Vajon az aggregáció természetes vagy abnormális folyamat? Lehetséges-e, hogy az amiloid -szerű fehérje aggregáció általánosan előforduló, a polimerlánc kémiai természetéből fakadó szükségszerű szerkezeti módosulat? Dobson, Trends Biochem. Sci. 1999

22 Ha az amiloidfibrillumok kialakulása nem az aminosav szekvencia szintjén kódolt, a kialakulásukat nem befolyásolhatják az aminosav oldalláncok. Tehát az aggregációt a gerincszerkezetet felépítő atomok kölcsönhatásai hozzák létre! H-hidas -réteg modellek (-Ala-Ala-Ala-Ala-Ala-Ala-) 2 Létezhetnek-e a -rétegeknél stabilabb téralkatok?

23 A β-redők moduláris felépülése - a -rétegek -szálakból épülnek fel, - két tipikus szerkezeti modul ismétlődik rendre. Pohl et al. JACS 2006

24 Modellezhetők-e a fehérjék QM szinten? 24

25 A β-redő építőelemek stabilitása S14 S10 A két építőelemet eltérő H-hidas motívum stabilizálja Natural Bond Orbitals

26 (kcal/mol) A β-redő építőelemek stabilitása Perczel et al. J.Comp.Chem Perczel et al. JACS 2007 Pohl et al. PCCP de dh dg 0 1,5 2,1 2,7 3,3 3,9 4,5 5,1 5,7 6,3 6,9 7,5-2 H-bond distance (A) RHF(B3Lyp)/ G(d,p) = ~10 4 kcal/mol /BSSE korrigált RHF(B3Lyp)/ G(d,p) = ~0 2 kcal/mol /BSSE korrigált

27 A β-redő építőelemek stabilitása polipeptid lánc hossza DE (kcal/mol)

28 DE (kcal/mol) polipeptid lánc hossza G T S H E -redő stabilitás G + T S = H G folyamat hajtóereje S - információ felhalmozódás vagy információvesztés Előfordulhat-e az antiparallel -redőzött rétegnél stabilabb dimer struktúra?

29 -redő visz mindent! 0 -szál 20% destab. 21% 40 % ab initio számítások (vízben) PCM-B3LYP/6-31G(d) (e =78.39) 57 % 25 E (%) % % 10% 47 % 59 % 20 % 11% 38 % 22 % 29 % 23 % A számításokat hosszabb láncokkal megismételve hasonló képet kaphatunk.

30 E (kcal/mol) Number of strands (j) Dimerizációtól az oligomerizációig A szupramolekuláris komplex stabilitása nő a -láncolatok hosszúságával, és a kölcsönhatásban részt vevő láncok számával is Number of residues (i) S14 S10 S10 S14 S10 S14 S10 S14 S10 S14 S10 S14 Beke et al. JACS 2006 Pohl et al. JACS 2006 ab initio számítások B3LYP/6-31G(d) Perczel et al. JACS 2007

31 Dimerizációtól az oligomerizációig

32 A fehérjék Janus-arca: a fertőző térszerkezet váltás Fehérjék a konformációs betegségek hátterében: - Prion - Aβ, - a-szinuklein, - Tau, - amiloid polipeptide (IAPP) - kalcitonin, - β2-mikroglobulin, - transztiretin - szuperoxid diszmutáz, -

33 A legkedvezőbb szuper-struktúra Az amiloid-szerű szupramolekuláris mátrix kialakulása -redőkből energetikailag kedvező folyamat. Tehát az aggregáció valóban egy természetes és normális, energiavezérelt folyamat. A globuláris fehérjék ideig óráig nem veszik fel a legstabilabb amiloid téralkatukat, ám ami késik nem múlik!

34 A fehérje feltekeredés zsákutcája? A fehérjék Janus-arca: végzetes változások amyloid DG<0

35 Következtetések: - A polipeptid asszociátumok között komplexebb igen, de stabilabb nincs mint a -szál. -Az oldószer és a környezet figyelembevételén nem okoz jelentős különbséget! - A -szálak optimális pakolódása a selyemben, az amiloid-aggregátumokban igazán evidens. Minden vagyok, amit vártál, Minden vagyok, amit nem sejtsz, Minden vagyok, mi lehetnék. S minden vagy, mi lehetséges, Minden lehetsz, mire vágyok, Talán semmi, talán Minden. (VAJON MILYENNEK LÁTTÁL? ADY ENDRE)

36 Természetes védekező mechanizmusok Richardson and Richardson PNAS, 2002, 99, 2754 A magas β redő tartalmú fehérjékben, a szabad β éleik aggregáció elleni aktív védelemmel vannak ellátva: ellen-tervezés - β-hordó: zárt profil -β-hélix: a szabad β-élek védelme egy a-helix vagy egy hurok régió által

37 Természetes védekező mechanizmusok β-propeller: - töltött aminosavak gyakoriságának megnövelése alacsony-görbületű élekben (Lys), Richardson and Richardson PNAS, 2002, 99, kitüremkedések beszúrása (β-bulge), - éles csavarodások beszúrása insertion (pl. Pro ahol φ~70 o ).

38 Természetes védekező mechanizmusok β-szendvics: - töltés (Lys, Arg, Glu, Asp), -kitüremkedés (β-bulge), - éles csavarulat (Pro [φ~70 o ] - másfajta csavar ( twist ) : Gly ahol φ~+150 Richardson and Richardson PNAS, 2002, 99, 2754

39 Epilógus helyett: kísérleti evidenciáink

40 Köszönetnyilvánítás

Fehérjeszerkezet, és tekeredés

Fehérjeszerkezet, és tekeredés Fehérjeszerkezet, és tekeredés Futó Kinga 2013.10.08. Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983

Részletesebben

Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete

Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete Polipeptidek térszerkezete Tipikus (rendezett) konformerek em tipikus (rendezetlen) konformerek Periodikus vagy homokonformerek Aperiodikus

Részletesebben

Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete

Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete Polipeptidek térszerkezete Tipikus (rendezett) konformerek em tipikus (rendezetlen) konformerek Periodikus vagy homokonformerek Aperiodikus

Részletesebben

Fehérjeszerkezet, és tekeredés. Futó Kinga

Fehérjeszerkezet, és tekeredés. Futó Kinga Fehérjeszerkezet, és tekeredés Futó Kinga Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983 H 211861 N

Részletesebben

A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA

A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA 2013.10.09. CITOSZKELETON - DEFINÍCIÓ Fehérjékből felépülő, a sejt vázát alkotó intracelluláris rendszer. Eukarióta és prokarióta sejtekben egyaránt megtalálható.

Részletesebben

Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek

Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek Hidroxikarbonsavak α-hidroxi karbonsavak -Glikolsav (kézkrémek) - Tejsav (tejtermékek, izomláz, fogszuvasodás) - Citromsav (citrusfélékben,

Részletesebben

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin.

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin. Myoglobin Fehérje-szerkezetek! MGLSDGEWQLVLNVWGKVEADIPGGQEVLIRLFK GPETLEKFDKFKLKSEDEMKASE DLKKGATVLTALGGILKKKGEAEIKPLAQSA TKKIPVKYLEFISECIIQVLQSK PGDFGADAQGAMNKALELFRKDMASNYKELGFQG Fuxreiter Mónika! Debreceni

Részletesebben

Fehérjék szerkezetének kialakulása II

Fehérjék szerkezetének kialakulása II Egy kis fehérje gombolyodása több párhuzamos úton Fehérjék szerkezetének kialakulása II Osváth Szabolcs Semmelweis Egyetem hélix kialakulás és kollapszus több párhuzamos úton további kollapszus és hélix

Részletesebben

Nukleinsavak építőkövei

Nukleinsavak építőkövei ukleinsavak Szerkezeti hierarchia ukleinsavak építőkövei Pirimidin Purin Pirimidin Purin Timin (T) Adenin (A) Adenin (A) Citozin (C) Guanin (G) DS bázisai bázis Citozin (C) Guanin (G) RS bázisai bázis

Részletesebben

Fehérjék szerkezetének kialakulása II. Semmelweis Egyetem. Osváth Szabolcs

Fehérjék szerkezetének kialakulása II. Semmelweis Egyetem. Osváth Szabolcs Fehérjék szerkezetének kialakulása II Osváth Szabolcs Semmelweis Egyetem szabolcs.osvath@eok.sote.hu Egy kis fehérje gombolyodása több párhuzamos úton hélix kialakulás és kollapszus több párhuzamos úton

Részletesebben

A fehérjék hierarchikus szerkezete

A fehérjék hierarchikus szerkezete Fehérjék felosztása A fehérjék hierarchikus szerkezete Smeller László Semmelweis Egyetem Biofizikai és Sugárbiológiai Intézet Biológiai funkció alapján Enzimek (pl.: tripszin, citokróm-c ) Transzportfehérjék

Részletesebben

Biopolimer 12/7/09. Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. DNS. Polimerek. Kardos Roland DNS elsődleges szerkezete

Biopolimer 12/7/09. Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. DNS. Polimerek. Kardos Roland DNS elsődleges szerkezete Biopolimerek Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. Osztódó sejt magorsófonala Kardos Roland 2009.10.29. Dohány levél epidermális sejtjének aktin hálózat Bakteriofágból kiszabaduló

Részletesebben

FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest,

FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest, FEHÉRJÉK A MÁGNESEKBEN Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium Alkímia Ma, Budapest, 2013.02.28. I. FEHÉRJÉK: L-α aminosavakból felépülő lineáris polimerek α H 2 N CH COOH amino

Részletesebben

Makromolekulák. Fehérjetekeredé. rjetekeredés. Biopolimer. Polimerek

Makromolekulák. Fehérjetekeredé. rjetekeredés. Biopolimer. Polimerek Biopolimerek Makromolekulá Makromolekulák. Fehé Fehérjetekeredé rjetekeredés. Osztódó sejt magorsófonala 2011. November 16. Huber Tamá Tamás Dohány levél epidermális sejtjének aktin hálózata Bakteriofágból

Részletesebben

A fehérjék hierarchikus szerkezete

A fehérjék hierarchikus szerkezete Fehérjék felosztása A fehérjék hierarchikus szerkezete Smeller László Semmelweis Egyetem Biofizikai és Sugárbiológiai Intézet Biológiai funkció alapján Enzimek (pl.: tripszin, citokróm-c ) Transzportfehérjék

Részletesebben

3. Sejtalkotó molekulák III.

3. Sejtalkotó molekulák III. 3. Sejtalkotó molekulák III. Fehérjék, fehérjeszintézis (transzkripció, transzláció, posztszintetikus módosítások). Enzimműködés 3.1 Fehérjék A genetikai információ egyik fő manifesztálódása Számos funkció

Részletesebben

TDK lehetőségek az MTA TTK Enzimológiai Intézetben

TDK lehetőségek az MTA TTK Enzimológiai Intézetben TDK lehetőségek az MTA TTK Enzimológiai Intézetben Vértessy G. Beáta egyetemi tanár TDK mind 1-3 helyezettek OTDK Pro Scientia különdíj 1 második díj Diákjaink Eredményei Zsűri különdíj 2 első díj OTDK

Részletesebben

A biológiai mozgás molekuláris mechanizmusai

A biológiai mozgás molekuláris mechanizmusai BIOLÓGIAI MOZGÁSOK A biológiai mozgás molekuláris mechanizmusai Kollektív mozgás Szervezet mozgása ( Az évszázad ugrása ) Szerv mozgás BIOLÓGIAI MOZGÁSOK BIOLÓGIAI MOZGÁSOK Ritmusosan összehúzódó szívizomsejt

Részletesebben

Szerkesztette: Vizkievicz András

Szerkesztette: Vizkievicz András Fehérjék A fehérjék - proteinek - az élő szervezetek számára a legfontosabb vegyületek. Az élet bármilyen megnyilvánulási formája fehérjékkel kapcsolatos. A sejtek szárazanyagának minimum 50 %-át adják.

Részletesebben

MedInProt Szinergia IV. program. Szerkezetvizsgáló módszer a rendezetlen fehérjék szerkezetének és kölcsönhatásainak jellemzésére

MedInProt Szinergia IV. program. Szerkezetvizsgáló módszer a rendezetlen fehérjék szerkezetének és kölcsönhatásainak jellemzésére MedInProt Szinergia IV. program Szerkezetvizsgáló módszer a rendezetlen fehérjék szerkezetének és kölcsönhatásainak jellemzésére Tantos Ágnes MTA TTK Enzimológiai Intézet, Rendezetlen fehérje kutatócsoport

Részletesebben

12/4/2014. Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció. 1952 Hershey & Chase 1953!!!

12/4/2014. Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció. 1952 Hershey & Chase 1953!!! Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció 1859 1865 1869 1952 Hershey & Chase 1953!!! 1879 1903 1951 1950 1944 1928 1911 1 1. DNS szerkezete Mi az örökítő anyag? Friedrich Miescher

Részletesebben

Poligénes v. kantitatív öröklődés

Poligénes v. kantitatív öröklődés 1. Öröklődés komplexebb sajátosságai 2. Öröklődés molekuláris alapja Poligénes v. kantitatív öröklődés Azok a tulajdonságokat amelyek mértékegységgel nem, vagy csak nehezen mérhetők, kialakulásuk kevéssé

Részletesebben

A fehérjék szerkezete és az azt meghatározó kölcsönhatások

A fehérjék szerkezete és az azt meghatározó kölcsönhatások A fehérjék szerkezete és az azt meghatározó kölcsönhatások 1. A fehérjék szerepe az élõlényekben 2. A fehérjék szerkezetének szintjei 3. A fehérjék konformációs stabilitásáért felelõs kölcsönhatások 4.

Részletesebben

Az agy betegségeinek molekuláris biológiája. 1. Prion betegség 2. Trinukleotid ripít betegségek 3. ALS 4. Parkinson kór 5.

Az agy betegségeinek molekuláris biológiája. 1. Prion betegség 2. Trinukleotid ripít betegségek 3. ALS 4. Parkinson kór 5. Az agy betegségeinek molekuláris biológiája 1. Prion betegség 2. Trinukleotid ripít betegségek 3. ALS 4. Parkinson kór 5. Alzheimer kór 28 Prion betegség A prion betegség fertőző formáját nem egy genetikai

Részletesebben

A citoszkeleton Eukarióta sejtváz

A citoszkeleton Eukarióta sejtváz A citoszkeleton Eukarióta sejtváz - Alak és belső szerkezet - Rugalmas struktúra sejt izomzat - Fehérjékből épül fel A citoszkeleton háromféle filamentumból épül fel Intermedier filamentum mikrotubulus

Részletesebben

A polipeptidlánc szabályozott lebontása: mit mondanak a fehérjekristályok? Harmat Veronika ELTE Kémiai Intézet, Szerkezeti Kémia és Biológia Laboratórium MTA-ELTE Fehérjemodellező Kutatócsoport A magyar

Részletesebben

A genetikai lelet értelmezése monogénes betegségekben

A genetikai lelet értelmezése monogénes betegségekben A genetikai lelet értelmezése monogénes betegségekben Tory Kálmán Semmelweis Egyetem, I. sz. Gyermekklinika A ~20 ezer fehérje-kódoló gén a 23 pár kromoszómán A kromoszómán található bázisok száma: 250M

Részletesebben

Nanotechnológia. Vonderviszt Ferenc. Veszprémi Egyetem Nanotechnológia Tanszék

Nanotechnológia. Vonderviszt Ferenc. Veszprémi Egyetem Nanotechnológia Tanszék Nanotechnológia Vonderviszt Ferenc Veszprémi Egyetem Nanotechnológia Tanszék Ősi technológiák Mikroelektronika Technológia: képesség az anyag szerkezetének, az anyagot felépítő részecskék elrendeződésének

Részletesebben

Citoszkeleton. Sejtek rugalmassága. Polimer mechanika: Hooke-rugalmasság. A citoszkeleton filamentumai. Fogászati anyagtan fizikai alapjai 12.

Citoszkeleton. Sejtek rugalmassága. Polimer mechanika: Hooke-rugalmasság. A citoszkeleton filamentumai. Fogászati anyagtan fizikai alapjai 12. Fogászati anyagtan fizikai alapjai 12. Sejtek rugalmassága Citoszkeleton Eukariota sejtek dinamikus vázrendszere Három fő filamentum-osztály: A. Vékony (aktin) B. Intermedier C. Mikrotubulus Polimerizáció:

Részletesebben

3. Általános egészségügyi ismeretek az egyes témákhoz kapcsolódóan

3. Általános egészségügyi ismeretek az egyes témákhoz kapcsolódóan 11. évfolyam BIOLÓGIA 1. Az emberi test szabályozása Idegi szabályozás Hormonális szabályozás 2. Az érzékelés Szaglás, tapintás, látás, íz érzéklés, 3. Általános egészségügyi ismeretek az egyes témákhoz

Részletesebben

A sejtek élete. 5. Robotoló törpék és óriások Az aminosavak és fehérjék R C NH 2. C COOH 5.1. A fehérjeépítőaminosavak általános

A sejtek élete. 5. Robotoló törpék és óriások Az aminosavak és fehérjék R C NH 2. C COOH 5.1. A fehérjeépítőaminosavak általános A sejtek élete 5. Robotoló törpék és óriások Az aminosavak és fehérjék e csak nézd! Milyen protonátmenetes reakcióra képes egy aminosav? R 2 5.1. A fehérjeépítőaminosavak általános képlete 5.2. A legegyszerűbb

Részletesebben

Fehérjeszerkezet, fehérjetekeredés

Fehérjeszerkezet, fehérjetekeredés Fehérjeszerkezet, fehérjetekeredés A fehérjeszerkezet szintjei A fehérjetekeredés elmélete: Anfinsen kísérlet Levinthal paradoxon A feltekeredés tölcsér elmélet 2014.11.05. Aminosavak és fehérjeszerkezet

Részletesebben

Biokémiai kutatások ma

Biokémiai kutatások ma Nyitray László Biokémiai Tanszék Hb Biokémiai kutatások ma Makromolekulák szerkezet-funkció kutatása Molekuláris biológia minden szinten Redukcionista molekuláris biológia vs. holisztikus rendszerbiológia

Részletesebben

Bio-nanorendszerek. Vonderviszt Ferenc. Pannon Egyetem Nanotechnológia Tanszék

Bio-nanorendszerek. Vonderviszt Ferenc. Pannon Egyetem Nanotechnológia Tanszék Bio-nanorendszerek Vonderviszt Ferenc Pannon Egyetem Nanotechnológia Tanszék Technológia: képesség az anyag szerkezetének, az anyagot felépítő részecskék elrendeződésének befolyásolására. A technológiai

Részletesebben

AZ ÉLET KÉMIÁJA... ÉLŐ ANYAG SZERVEZETI ALAPEGYSÉGE

AZ ÉLET KÉMIÁJA... ÉLŐ ANYAG SZERVEZETI ALAPEGYSÉGE AZ ÉLET KÉMIÁJA... ÉLŐ ANYAG SZERVEZETI ALAPEGYSÉGE A biológia az élet tanulmányozásával foglalkozik, az élő szervezetekre viszont vonatkoznak a fizika és kémia törvényei MI ÉPÍTI FEL AZ ÉLŐ ANYAGOT? HOGYAN

Részletesebben

ALKÍMIA MA Az anyagról mai szemmel, a régiek megszállottságával.

ALKÍMIA MA Az anyagról mai szemmel, a régiek megszállottságával. ALKÍMIA MA Az anyagról mai szemmel, a régiek megszállottságával www.chem.elte.hu/pr ALKÍMIA MA Az előadásokról 17:00 17:15 Akadémiai negyed Hírek, aktualitások, programajánlat, kvíz kitöltése 17:15 18:00

Részletesebben

A fehérjéket felépítő húsz standard aminosav Fehérjék szerkezetének kialakulása

A fehérjéket felépítő húsz standard aminosav Fehérjék szerkezetének kialakulása A fehérjéket felépítő húsz standard aminosav Fehérjék szerkezetének kialakulása Osváth Szabolcs Semmelweis Egyetem szabolcs.osvath@eok.sote.hu reakció t 1/2 25 ºC-on t 1/2 100 ºC-on DNS hidrolízis Biopolimerek

Részletesebben

Immunológia alapjai előadás. Az immunológiai felismerés molekuláris összetevői.

Immunológia alapjai előadás. Az immunológiai felismerés molekuláris összetevői. Immunológia alapjai 3 4. előadás Az immunológiai felismerés molekuláris összetevői. Az antigén fogalma. Antitestek, T- és B- sejt receptorok: molekuláris szerkezet, funkciók, alcsoportok Az antigén meghatározása

Részletesebben

Bioinformatika 2 5.. előad

Bioinformatika 2 5.. előad 5.. előad adás Prof. Poppe László BME Szerves Kémia és Technológia Tsz. Bioinformatika proteomika Előadás és gyakorlat 2009. 03. 21. Fehérje térszerkezet t megjelenítése A fehérjék meglehetősen összetett

Részletesebben

Gáspári Zoltán. Élő molekulák az élet molekulái

Gáspári Zoltán. Élő molekulák az élet molekulái Gáspári Zoltán Élő molekulák az élet molekulái Invokáció Kajtár Márton 1929-1991 www.eotvoskiado.hu Élő és élettelen? Élő és élettelen: a kemoton Élő kémiai rendszer, de nem élőlény (Gánti, 1975) Autokatalitikus

Részletesebben

Evolúcióelmélet és az evolúció mechanizmusai

Evolúcióelmélet és az evolúció mechanizmusai Evolúcióelmélet és az evolúció mechanizmusai Az élet Darwini szemlélete Melyek az evolúció bizonyítékai a világban? EVOLÚCIÓ: VÁLTOZATOSSÁG Mutáció Horizontális géntranszfer Genetikai rekombináció Rekombináció

Részletesebben

1. jelentésük. Nevüket az alkotó szén, hidrogén, oxigén 1 : 2 : 1 arányából hajdan elképzelt képletről [C n (H 2 O) m ] kapták.

1. jelentésük. Nevüket az alkotó szén, hidrogén, oxigén 1 : 2 : 1 arányából hajdan elképzelt képletről [C n (H 2 O) m ] kapták. Összefoglalás II. Szénhidrátok 1. jelentésük Nevüket az alkotó szén, hidrogén, oxigén 1 : 2 : 1 arányából hajdan elképzelt képletről [C n (H 2 O) m ] kapták. Ha ezeket az anyagokat hevítjük vizet vesztenek

Részletesebben

Biofizika I 2013-2014 2014.12.02.

Biofizika I 2013-2014 2014.12.02. ÁTTEKINTÉS AZ IZOM TÍPUSAI: SZERKEZET és FUNKCIÓ A HARÁNTCSÍKOLT IZOM SZERKEZETE MŰKÖDÉSÉNEK MOLEKULÁRIS MECHANIZMUSA IZOM MECHANIKA Biofizika I. -2014. 12. 02. 03. Dr. Bugyi Beáta PTE ÁOK Biofizikai Intézet

Részletesebben

11. Dr. House. Biokémiai és sejtbiológiai módszerek alkalmazása az orvoslásban

11. Dr. House. Biokémiai és sejtbiológiai módszerek alkalmazása az orvoslásban 11. Dr. House. Biokémiai és sejtbiológiai módszerek alkalmazása az orvoslásban HIV fertőzés kimutatása (fiktív) esettanulmány 35 éves nő, HIV fertőzöttség gyanúja. Két partner az elmúlt időszakban. Fertőzött-e

Részletesebben

12. évfolyam esti, levelező

12. évfolyam esti, levelező 12. évfolyam esti, levelező I. ÖKOLÓGIA EGYED FELETTI SZERVEZŐDÉSI SZINTEK 1. A populációk jellemzése, növekedése 2. A populációk környezete, tűrőképesség 3. Az élettelen környezeti tényezők: fény hőmérséklet,

Részletesebben

PAPP DÓRA. Amiloid szerkezetek stabilitásvizsgálata fehérjékben

PAPP DÓRA. Amiloid szerkezetek stabilitásvizsgálata fehérjékben Tudományos Diákköri Dolgozat PAPP DÓRA Amiloid szerkezetek stabilitásvizsgálata fehérjékben Témavezetők: Prof. Dr. Perczel András Pohl Gábor Szerkezeti Kémia és Biológia Laboratórium Eötvös Loránd Tudományegyetem

Részletesebben

Natív antigének felismerése. B sejt receptorok, immunglobulinok

Natív antigének felismerése. B sejt receptorok, immunglobulinok Natív antigének felismerése B sejt receptorok, immunglobulinok B és T sejt receptorok A B és T sejt receptorok is az immunglobulin fehérje család tagjai A TCR nem ismeri fel az antigéneket, kizárólag az

Részletesebben

VILÁGÍTÓ GYÓGYHATÁSÚ ALKALOIDOK

VILÁGÍTÓ GYÓGYHATÁSÚ ALKALOIDOK VILÁGÍTÓ GYÓGYHATÁSÚ ALKALIDK Biczók László, Miskolczy Zsombor, Megyesi Mónika, Harangozó József Gábor MTA Természettudományi Kutatóközpont Anyag- és Környezetkémiai Intézet Hordozóanyaghoz kötődés fluoreszcenciás

Részletesebben

BIOMOLEKULÁK KÉMIÁJA. Novák-Nyitrai-Hazai

BIOMOLEKULÁK KÉMIÁJA. Novák-Nyitrai-Hazai BIOMOLEKULÁK KÉMIÁJA Novák-Nyitrai-Hazai A tankönyv elsısorban szerves kémiai szempontok alapján tárgyalja az élı szervezetek felépítésében és mőködésében kulcsfontosságú szerves vegyületeket. A tárgyalás-

Részletesebben

3. Kombinált, amelynek van helikális és kubikális szakasza, pl. a bakteriofágok és egyes rákkeltő RNS vírusok.

3. Kombinált, amelynek van helikális és kubikális szakasza, pl. a bakteriofágok és egyes rákkeltő RNS vírusok. Vírusok Szerkesztette: Vizkievicz András A XIX. sz. végén Dmitrij Ivanovszkij orosz biológus a dohány mozaikosodásának kórokozóját próbálta kimutatni. A mozaikosodás a levél foltokban jelentkező sárgulása.

Részletesebben

A fehérjék harmadlagos vagy térszerkezete. Még a globuláris fehérjék térszerkezete is sokféle lehet.

A fehérjék harmadlagos vagy térszerkezete. Még a globuláris fehérjék térszerkezete is sokféle lehet. A fehérjék harmadlagos vagy térszerkezete Még a globuláris fehérjék térszerkezete is sokféle lehet. A ribonukleáz redukciója és denaturálódása Chrisian B. Anfinsen A ribonukleáz renaturálódása 1972 obel-díj

Részletesebben

A citoszkeletális rendszer, a harántcsíkolt izom biofizikája.

A citoszkeletális rendszer, a harántcsíkolt izom biofizikája. A citoszkeletális rendszer, a harántcsíkolt izom biofizikája. SCIENCE PHOTO LIBRARY Kupi Tünde 2010. 10. 19. Citoszkeleton: eukarióta sejtek dinamikus fehérjevázrendszere Három fı filamentum-osztály: A.

Részletesebben

ALKÍMIA MA Az anyagról mai szemmel, a régiek megszállottságával. www.chem.elte.hu/pr

ALKÍMIA MA Az anyagról mai szemmel, a régiek megszállottságával. www.chem.elte.hu/pr ALKÍMIA MA Az anyagról mai szemmel, a régiek megszállottságával www.chem.elte.hu/pr Kvíz az előző előadáshoz 1) Mikor kapott Paul Ehrlich orvosi Nobel-díjat? A) Idén. B) Pont 100 éve, 1908-ban. C) Nem

Részletesebben

Biomolekulák nanomechanikája A biomolekuláris rugalmasság alapjai

Biomolekulák nanomechanikája A biomolekuláris rugalmasság alapjai Fogorvosi Anyagtan Fizikai Alapjai Biomolekulák nanomechanikája A biomolekuláris rugalmasság alapjai Mártonfalvi Zsolt Biofizikai és Sugárbiológiai Intézet Semmelweis Egyetem Budapest Biomolekulák mint

Részletesebben

4. A humorális immunválasz október 12.

4. A humorális immunválasz október 12. 4. A humorális immunválasz 2016. október 12. A klónszelekciós elmélet sarokpontjai: Monospecifictás: 1 sejt 1-féle specificitású receptor Az antigén receptorhoz kötődése aktiválja a limfocitát A keletkező

Részletesebben

Elektrosztatikus számítások. Elektrosztatikus számítások. Elektrosztatikus számítások. Elektrosztatikus számítások Definíciók

Elektrosztatikus számítások. Elektrosztatikus számítások. Elektrosztatikus számítások. Elektrosztatikus számítások Definíciók Jelentősége szubsztrát kötődés szolvatáció ionizációs állapotok (pka) mechanizmus katalízis ioncsatornák szimulációk (szerkezet) all-atom dipolar fluid dipolar lattice continuum Definíciók töltéseloszlás

Részletesebben

Sejtmozgás és adhézió Molekuláris biológia kurzus 8. hét. Kun Lídia Genetikai, Sejt és Immunbiológiai Intézet

Sejtmozgás és adhézió Molekuláris biológia kurzus 8. hét. Kun Lídia Genetikai, Sejt és Immunbiológiai Intézet Sejtmozgás és adhézió Molekuláris biológia kurzus 8. hét Kun Lídia Genetikai, Sejt és Immunbiológiai Intézet Sejtmozgás -amőboid - csillós - kontrakció Sejt adhézió -sejt-ecm -sejt-sejt MOZGÁS A sejtmozgás

Részletesebben

Egy antifungális diszulfid fehérje szerkezeti dinamikája és hideg/meleg kitekeredése (avagy PAF, a hűvös sárkány)

Egy antifungális diszulfid fehérje szerkezeti dinamikája és hideg/meleg kitekeredése (avagy PAF, a hűvös sárkány) Egy antifungális diszulfid fehérje szerkezeti dinamikája és hideg/meleg kitekeredése (avagy PAF, a hűvös sárkány) Batta Gyula Debreceni Egyetem Szerkezeti Biológiai és Molekuláris Felismerési Műhely structbiol.unideb.hu

Részletesebben

A gyakorlat elméleti háttere A DNS molekula a sejt információhordozója. A DNS nemzedékről nemzedékre megőrzi az élőlények genetikai örökségét.

A gyakorlat elméleti háttere A DNS molekula a sejt információhordozója. A DNS nemzedékről nemzedékre megőrzi az élőlények genetikai örökségét. A kísérlet megnevezése, célkitűzései: DNS molekula szerkezetének megismertetése Eszközszükséglet: Szükséges anyagok: színes gyurma, papírsablon Szükséges eszközök: olló, hurkapálcika, fogpiszkáló, cérna,

Részletesebben

11. évfolyam esti, levelező

11. évfolyam esti, levelező 11. évfolyam esti, levelező I. AZ EMBER ÉLETMŰKÖDÉSEI II. ÖNSZABÁLYOZÁS, ÖNREPRODUKCIÓ 1. A szabályozás információelméleti vonatkozásai és a sejtszintű folyamatok (szabályozás és vezérlés, az idegsejt

Részletesebben

A nukleinsavak polimer vegyületek. Mint polimerek, monomerekből épülnek fel, melyeket nukleotidoknak nevezünk.

A nukleinsavak polimer vegyületek. Mint polimerek, monomerekből épülnek fel, melyeket nukleotidoknak nevezünk. Nukleinsavak Szerkesztette: Vizkievicz András A nukleinsavakat először a sejtek magjából sikerült tiszta állapotban kivonni. Innen a név: nucleus = mag (lat.), a sav a kémhatásukra utal. Azonban nukleinsavak

Részletesebben

CHO H H H OH H OH OH H CH2OH HC OH HC OH HC OH CH 2

CHO H H H OH H OH OH H CH2OH HC OH HC OH HC OH CH 2 4. Előadás ukleozidok, nukleotidok, nukleinsavak Történeti háttér Savas karakterű anyagok a sejtmagból 1869-71 DS a sejtmag fő komponense F. Miescher (Svájc) 1882 Flemming: Chromatin elnevezés Waldeyer:

Részletesebben

Prenatalis diagnosztika lehetőségei mikor, hogyan, miért? Dr. Almássy Zsuzsanna Heim Pál Kórház, Budapest Toxikológia és Anyagcsere Osztály

Prenatalis diagnosztika lehetőségei mikor, hogyan, miért? Dr. Almássy Zsuzsanna Heim Pál Kórház, Budapest Toxikológia és Anyagcsere Osztály Prenatalis diagnosztika lehetőségei mikor, hogyan, miért? Dr. Almássy Zsuzsanna Heim Pál Kórház, Budapest Toxikológia és Anyagcsere Osztály Definíció A prenatális diagnosztika a klinikai genetika azon

Részletesebben

Aminosavak általános képlete NH 2. Csoportosítás: R oldallánc szerkezete alapján: Semleges. Esszenciális aminosavak

Aminosavak általános képlete NH 2. Csoportosítás: R oldallánc szerkezete alapján: Semleges. Esszenciális aminosavak Aminosavak 1 Aminosavak általános képlete N 2 soportosítás: oldallánc szerkezete alapján: Apoláris Poláris Bázikus Savas Semleges Esszenciális aminosavak 2 (apoláris) Glicin Név Gly 3 Alanin Ala 3 3 Valin

Részletesebben

Az élő sejt fizikai Biológiája:

Az élő sejt fizikai Biológiája: Az élő sejt fizikai Biológiája: Modellépítés, biológiai rendszerek skálázódása Kellermayer Miklós Fizikai biológia Ma már nem csak kvalitatív megfigyeléseket, hanem kvantitatív méréseket végzünk (biológiai

Részletesebben

1. Az élő szervezetek felépítése és az életfolyamatok 17

1. Az élő szervezetek felépítése és az életfolyamatok 17 Élődi Pál BIOKÉMIA vomo; Akadémiai Kiadó, Budapest 1980 Tartalom Bevezetés 1. Az élő szervezetek felépítése és az életfolyamatok 17 Mi jellemző az élőre? 17. Biogén elemek 20. Biomolekulák 23. A víz 26.

Részletesebben

Rh VÉRCSOPORT RENDSZER GENETIKÁJA. Rh ANTIGÉNEK ÉS ANTITESTEK. EGYÉB VÉRCSOPORTRENDSZEREK

Rh VÉRCSOPORT RENDSZER GENETIKÁJA. Rh ANTIGÉNEK ÉS ANTITESTEK. EGYÉB VÉRCSOPORTRENDSZEREK Rh VÉRCSOPORT RENDSZER GENETIKÁJA. Rh ANTIGÉNEK ÉS ANTITESTEK. EGYÉB VÉRCSOPORTRENDSZEREK HISTORY Antitestet találtak egy koraszülött gyermek anyjának szérumában; ez lenne felelős a gyermek haláláért?

Részletesebben

BIOLÓGIA HÁZIVERSENY 1. FORDULÓ BIOKÉMIA, GENETIKA BIOKÉMIA, GENETIKA

BIOLÓGIA HÁZIVERSENY 1. FORDULÓ BIOKÉMIA, GENETIKA BIOKÉMIA, GENETIKA BIOKÉMIA, GENETIKA 1. Nukleinsavak keresztrejtvény (12+1 p) 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 1. A nukleinsavak a.-ok összekapcsolódásával kialakuló polimerek. 2. Purinvázas szerves bázis, amely az

Részletesebben

BIOLÓGIA VERSENY 10. osztály 2016. február 20.

BIOLÓGIA VERSENY 10. osztály 2016. február 20. BIOLÓGIA VERSENY 10. osztály 2016. február 20. Kód Elérhető pontszám: 100 Elért pontszám: I. Definíció (2x1 = 2 pont): a) Mikroszkopikus méretű szilárd részecskék aktív bekebelezése b) Molekula, a sejt

Részletesebben

Klónozás: tökéletesen egyforma szervezetek csoportjának előállítása, vagyis több genetikailag azonos egyed létrehozása.

Klónozás: tökéletesen egyforma szervezetek csoportjának előállítása, vagyis több genetikailag azonos egyed létrehozása. Növények klónozása Klónozás Klónozás: tökéletesen egyforma szervezetek csoportjának előállítása, vagyis több genetikailag azonos egyed létrehozása. Görög szó: klon, jelentése: gally, hajtás, vessző. Ami

Részletesebben

Sejtmag, magvacska magmembrán

Sejtmag, magvacska magmembrán Sejtmag, magvacska magmembrán Láng Orsolya Semmelweis Egyetem, Genetikai, Sejt- és Immunbiológiai Intézet Kompartmentalizáció Prokaryóta Cytoplazma Eukaryóta Endomembrán Kromatin Plazma membrán Eredménye

Részletesebben

A citoszol szolubilis fehérjéi. A citoplazma matrix (citoszol) Caspase /Kaszpáz/ 1. Enzimek. - Organellumok nélküli citoplazma

A citoszol szolubilis fehérjéi. A citoplazma matrix (citoszol) Caspase /Kaszpáz/ 1. Enzimek. - Organellumok nélküli citoplazma A citoplazma matrix (citoszol) A citoszol szolubilis fehérjéi 1. Enzimek - Organellumok nélküli citoplazma -A sejt fejlődéstani szempontból legősibb része (a sejthártyával együtt) Glikolízis teljes enzimrendszere

Részletesebben

TAKARMÁNYOZÁSTAN. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010

TAKARMÁNYOZÁSTAN. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 TAKARMÁNYOZÁSTAN Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 Takarmányok fehérjetartalma Az állati szervezet létfontosságú vegyületei fehérje természetűek Az állati termékek

Részletesebben

Sejtciklus. Sejtciklus. Centriólum ciklus (centroszóma ciklus) A sejtosztódás mechanizmusa. Mikrotubulusok és motor fehérjék szerepe a mitózisban

Sejtciklus. Sejtciklus. Centriólum ciklus (centroszóma ciklus) A sejtosztódás mechanizmusa. Mikrotubulusok és motor fehérjék szerepe a mitózisban A sejtosztódás mechanizmusa Mikrotubulusok és motor fehérjék szerepe a mitózisban 2010.03.23. Az M fázis alatti események: mag osztódása (mitózis) mitotikus orsó: MT + MAP (pl. motorfehérjék) citoplazma

Részletesebben

HŐ (q) és MUNKA (w): energia átmenet közben a rendszer és környezete között. A különböző energiafajták átalakulásukkor végső soron termikus energiává

HŐ (q) és MUNKA (w): energia átmenet közben a rendszer és környezete között. A különböző energiafajták átalakulásukkor végső soron termikus energiává TERMODINAMIKA 1 HŐ (q) és MUNKA (w): energia átmenet közben a rendszer és környezete között. A különböző energiafajták átalakulásukkor végső soron termikus energiává degradálódnak (disszipáció). BELSŐ

Részletesebben

Kémiai Intézet Kémiai Laboratórium. F o t o n o k k e r e s z tt ü z é b e n a D N S

Kémiai Intézet Kémiai Laboratórium. F o t o n o k k e r e s z tt ü z é b e n a D N S Szalay SzalayPéter Péter egyetemi egyetemi tanár tanár ELTE, ELTE,Kémiai Kémiai Intézet Intézet Elméleti ElméletiKémiai Kémiai Laboratórium Laboratórium F o t o n o k k e r e s z tt ü z é b e n a D N S

Részletesebben

A génterápia genetikai anyag bejuttatatása diszfunkcionálisan működő sejtekbe abból a célból, hogy a hibát kijavítsuk.

A génterápia genetikai anyag bejuttatatása diszfunkcionálisan működő sejtekbe abból a célból, hogy a hibát kijavítsuk. A génterápia genetikai anyag bejuttatatása diszfunkcionálisan működő sejtekbe abból a célból, hogy a hibát kijavítsuk. A genetikai betegségek mellett, génterápia alkalmazható szerzett betegségek, mint

Részletesebben

Élettan. előadás tárgykód: bf1c1b10 ELTE TTK, fizika BSc félév: 2015/2016., I. időpont: csütörtök, 8:15 9:45

Élettan. előadás tárgykód: bf1c1b10 ELTE TTK, fizika BSc félév: 2015/2016., I. időpont: csütörtök, 8:15 9:45 Élettan előadás tárgykód: bf1c1b10 ELTE TTK, fizika BSc félév: 2015/2016., I. időpont: csütörtök, 8:15 9:45 oktató: Dr. Tóth Attila, adjunktus ELTE TTK Biológiai Intézet, Élettani és Neurobiológiai tanszék

Részletesebben

Flagellin alapú filamentáris nanoszerkezetek létrehozása

Flagellin alapú filamentáris nanoszerkezetek létrehozása Flagellin alapú filamentáris nanoszerkezetek létrehozása Vonderviszt Ferenc PE MÜKKI Bio-Nanorendszerek Laboratórium MTA Enzimológiai Intézete MTA MFA Bakteriális flagellumok Flagelláris filamentum: ~10

Részletesebben

RNS-ek. 1. Az ősi RNS Világ: - az élet hajnalán. 2. Egy már ismert RNS Világ: - a fehérjeszintézis ben résztvevő RNS-ek

RNS-ek. 1. Az ősi RNS Világ: - az élet hajnalán. 2. Egy már ismert RNS Világ: - a fehérjeszintézis ben résztvevő RNS-ek RNS-ek RNS-ek 1. Az ősi RNS Világ: - az élet hajnalán 2. Egy már ismert RNS Világ: - a fehérjeszintézis ben résztvevő RNS-ek 3. Egy újonnan felfedezett RNS Világ: - szabályozó RNS-ek 4. Transzkripció Ősi

Részletesebben

NMR a peptid- és fehérje-kutatásban

NMR a peptid- és fehérje-kutatásban NMR a peptid- és fehérje-kutatásban A PDB adatbázisban megtalálható NMR alapú fehérjeszerkezetek számának alakulása az elmúlt évek során 4000 3500 3000 2500 2000 1500 1000 500 0 1987 1988 1989 1990 1991

Részletesebben

DR. IMMUN Egészségportál. A haj számára nélkülözhetetlen vitaminok, ásványi anyagok és nyomelemek

DR. IMMUN Egészségportál. A haj számára nélkülözhetetlen vitaminok, ásványi anyagok és nyomelemek A haj és a vitaminok A haj számára nélkülözhetetlen vitaminok, ásványi anyagok és nyomelemek Hajunk állapotát nagyban befolyásolja, hogy milyen ételeket fogyasztunk. A hajhagymák vitamin vagy nyomelemhiánya

Részletesebben

Mi lenne ha az MPS is része lenne az újszülöttkori tömegszűrésnek?

Mi lenne ha az MPS is része lenne az újszülöttkori tömegszűrésnek? Mi lenne ha az MPS is része lenne az újszülöttkori tömegszűrésnek? Dr. Jávorszky Eszter, Kánnai Piroska Dr. Szőnyi László Semmelweis Egyetem, I. Gyermekklinika, Budapest Anyagcsere szűrőközpont 2 Ritka

Részletesebben

Tudjunk Egymásról Bugyi Beáta 22/11/2012

Tudjunk Egymásról Bugyi Beáta 22/11/2012 Listeria monocytogenes Loisel, Boujemaa et al. Nature 1999 Összetett aktin hálózatok Spire/formin szinergia Reymann et al. Nature Materials 1 ADF/aktin Bosch, Bugyi B et al. Molecular Cell 7 Reymann et

Részletesebben

Béta-redők stabilitásvizsgálata párkorrelációk statisztikai és kvantumkémiai modellezésével

Béta-redők stabilitásvizsgálata párkorrelációk statisztikai és kvantumkémiai modellezésével Tudományos Diákköri Dolgozat KOVÁCS BERTALAN Béta-redők stabilitásvizsgálata párkorrelációk statisztikai és kvantumkémiai modellezésével Dr. Jákli Imre, tudományos főmunkatárs Dr. Perczel András, egyetemi

Részletesebben

A Hsp27 neuroprotektív szerepének tanulmányozása transzgenikus egerekben

A Hsp27 neuroprotektív szerepének tanulmányozása transzgenikus egerekben A DOKTORI ÉRTEKEZÉS TÉZISEI A Hsp27 neuroprotektív szerepének tanulmányozása transzgenikus egerekben TÓTH ERZSÉBET MELINDA Témavezető: Dr. Sántha Miklós MTA Szegedi Biológiai Kutatóközpont Biokémiai Intézet

Részletesebben

A citoszkeleton. A citoszkeleton, a motorfehérjék, az izom és működésének szabályozása. A citoszkeleton. A citoszkeleton.

A citoszkeleton. A citoszkeleton, a motorfehérjék, az izom és működésének szabályozása. A citoszkeleton. A citoszkeleton. , a motorfehérjék, az izom és működésének szabályozása PTE ÁOK Biofizikai Intézet Ujfalusi Zoltán 2012. január-február Eukarióta sejtek dinamikus vázrendszere Három fő filamentum-osztály: 1. Intermedier

Részletesebben

Konferencia a tapasztalatok jegyében

Konferencia a tapasztalatok jegyében Konferencia a tapasztalatok jegyében 2010. november Dornbach Ildikó szakmai igazgató Új biológia, új fizika, régi beidegzések Edzőink felbecsülhetetlen értékű tevékenysége Köztársasági Érdemrendet minden

Részletesebben

2. Ismert térszerkezetű transzmembrán fehérjék adatbázisa: a PDBTM adatbázis. 3. A transzmembrán fehérje topológiai adatbázis, a TOPDB szerver

2. Ismert térszerkezetű transzmembrán fehérjék adatbázisa: a PDBTM adatbázis. 3. A transzmembrán fehérje topológiai adatbázis, a TOPDB szerver A 2005 és 2007 között megvalósított project célja transzmembrán fehérjék vizsgálata és az ehhez szükséges eljárások kifejlesztése volt. Ez utóbbi magába foglalta új adatbázisok és szerkezet becslő módszerek

Részletesebben

Több szubsztrátos enzim-reakciókról beszélve két teljesen különbözõ rekció típust kell megismernünk.

Több szubsztrátos enzim-reakciókról beszélve két teljesen különbözõ rekció típust kell megismernünk. .5.Több szubsztrátos reakciók Több szubsztrátos enzim-reakciókról beszélve két teljesen különbözõ rekció típust kell megismernünk. A.) Egy enzim, ahhoz, hogy terméket képezzen, egyszerre több különbözõ

Részletesebben

A replikáció mechanizmusa

A replikáció mechanizmusa Az öröklődés molekuláris alapjai A DNS megkettőződése, a replikáció Szerk.: Vizkievicz András A DNS-molekula az élőlények örökítő anyaga, kódolt formában tartalmazza mindazon információkat, amelyek a sejt,

Részletesebben

Enzimek. Enzimek! IUBMB: szisztematikus nevek. Enzimek jellemzése! acetilkolin-észteráz! legalább 10 nagyságrend gyorsulás. szubsztrát-specificitás

Enzimek. Enzimek! IUBMB: szisztematikus nevek. Enzimek jellemzése! acetilkolin-észteráz! legalább 10 nagyságrend gyorsulás. szubsztrát-specificitás Enzimek acetilkolin-észteráz! Enzimek! [s -1 ] enzim víz carbonic anhydrase 6x10 5 10-9 karbonikus anhidráz acetylcholine esterase 2x10 4 8x10-10 acetilkolin észteráz staphylococcal nuclease 10 2 2x10-14

Részletesebben

Fehérjeaggregátumok termodinamikai és szerkezeti vizsgálata

Fehérjeaggregátumok termodinamikai és szerkezeti vizsgálata Fehérjeaggregátumok termodinamikai és szerkezeti vizsgálata MICSONAI ANDRÁS DOKTORI ÉRTEKEZÉS TÉZISEI Témavezető: DR. KARDOS JÓZSEF adjunktus ELTE TTK Biológiai Intézet, Biokémiai Tanszék Eötvös Loránd

Részletesebben

TRANSZPORTFOLYAMATOK 1b. Fehérjék. 1b. FEHÉRJÉK TRANSZPORTJA A MEMBRÁNONOKBA ÉS A SEJTSZERVECSKÉK BELSEJÉBE ÁLTALÁNOS

TRANSZPORTFOLYAMATOK 1b. Fehérjék. 1b. FEHÉRJÉK TRANSZPORTJA A MEMBRÁNONOKBA ÉS A SEJTSZERVECSKÉK BELSEJÉBE ÁLTALÁNOS 1b. FEHÉRJÉK TRANSZPORTJA A MEMBRÁNONOKBA ÉS A SEJTSZERVECSKÉK BELSEJÉBE ÁLTALÁNOS DIA 1 Fő fehérje transzport útvonalak Egy tipikus emlős sejt közel 10,000 féle fehérjét tartalmaz (a test pedig összesen

Részletesebben

MAGYAR TUDOMÁNY ÜNNEPE. Penke Botond, Szegedi Tudományegyetem, Orvosi Vegytani Intézet. 2012. november 8.

MAGYAR TUDOMÁNY ÜNNEPE. Penke Botond, Szegedi Tudományegyetem, Orvosi Vegytani Intézet. 2012. november 8. NAGY STABILITÁSÚ TOXIKUS FEHÉRJESZERKEZETEK A NEURODEGENERATÍV BETEGSÉGEKBEN: PRIONOK ÉS AMILOIDOK MAGYAR TUDOMÁNY ÜNNEPE Penke Botond, Szegedi Tudományegyetem, Orvosi Vegytani Intézet 2012. november 8.

Részletesebben

Johann Gregor Mendel Az olmüci (Olomouc) és bécsi egyetem diákja Brünni ágostonrendi apát (nem szovjet tudós) Tudatos és nagyon alapos kutat

Johann Gregor Mendel Az olmüci (Olomouc) és bécsi egyetem diákja Brünni ágostonrendi apát (nem szovjet tudós) Tudatos és nagyon alapos kutat 10.2.2010 genmisk1 1 Áttekintés Mendel és a mendeli törvények Mendel előtt és körül A genetika törvényeinek újbóli felfedezése és a kromoszómák Watson és Crick a molekuláris biológoa központi dogmája 10.2.2010

Részletesebben

Receptorok és szignalizációs mechanizmusok

Receptorok és szignalizációs mechanizmusok Molekuláris sejtbiológia: Receptorok és szignalizációs mechanizmusok Dr. habil Kőhidai László Semmelweis Egyetem Genetikai, Sejt- és Immunbiológiai Intézet Sejtek szignalizációs kapcsolatai Sejtek szignalizációs

Részletesebben

K68464 OTKA pályázat szakmai zárójelentés

K68464 OTKA pályázat szakmai zárójelentés K68464 OTKA pályázat szakmai zárójelentés A fehérjeaggregáció és amiloidképződés szerkezeti alapjai; a különféle morfológiájú aggregátumok kialakulásának körülményei és in vivo hatásuk vizsgálata Vezető

Részletesebben

Bakteriális identifikáció 16S rrns gén szekvencia alapján

Bakteriális identifikáció 16S rrns gén szekvencia alapján Bakteriális identifikáció 16S rrns gén szekvencia alapján MOHR ANITA SIPOS RITA, SZÁNTÓ-EGÉSZ RÉKA, MICSINAI ADRIENN 2100 Gödöllő, Szent-Györgyi Albert út 4. info@biomi.hu, www.biomi.hu TÖRZS AZONOSÍTÁS

Részletesebben

Genetika. Tartárgyi adatlap: tantárgy adatai

Genetika. Tartárgyi adatlap: tantárgy adatai Genetika Előadás a I. éves Génsebészet szakos hallgatók számára Tartárgyi adatlap: tantárgy adatai 2.1. Tantárgy címe Genetika 2.2. Előadás felelőse Dr. Mara Gyöngyvér, docens 2.3. Egyéb oktatási tevékenységek

Részletesebben