Bio-nanorendszerek. Vonderviszt Ferenc. Pannon Egyetem Nanotechnológia Tanszék

Save this PDF as:
 WORD  PNG  TXT  JPG

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "Bio-nanorendszerek. Vonderviszt Ferenc. Pannon Egyetem Nanotechnológia Tanszék"

Átírás

1 Bio-nanorendszerek Vonderviszt Ferenc Pannon Egyetem Nanotechnológia Tanszék

2 Technológia: képesség az anyag szerkezetének, az anyagot felépítő részecskék elrendeződésének befolyásolására. A technológiai fejlődés irányvonalai: - meglévő technológiák miniatürizálása nanotechnológia - molekuláris nanotechnológia: atomokból és molekulákból építkező, molekuláris rendszereket létrehozó technológia

3 A molekuláris nanotechnológia előnyei Kis nyersanyag és energiaigény Minimális környezetszennyezés Adott térfogatban sok aktív elem A kis méretből adódó különleges tulajdonságok (kvantumhatások) Jól tervezhető, előnyös mechanikai, termikus és elektromos tulajdonságok

4 Nanotechnológiai próbálkozások: STM technológiák Grafitfelület

5 STM objektumok

6 Fullerének és szén nanocsövek

7 A szén nanocsövek tulajdonságai: Szakítószilárdság ~ Pa Sűrűség ~1.4 g/cm 3 Tökéletes rugalmasság Elektromos vezetőképesség ~10 9 A/cm 2 Hőstabilitás 2800/750 ºC Kiváló hővezetés

8 Szén nanocsövek növesztése

9 CNT képcsövek

10

11

12 Molekuláris nanotechnológia: A XXI. század technológiája!? Az élő rendszerek molekuláris nanotechnológiát alkalmaznak! Fehérje/nukleinsav alapú molekuláris gépezetek

13 Fehérjék - 20-féle aminosavból felépülő lineáris polimerek - kompakt szerkezet - változatos kölcsönhatási mintázatok

14 A PGK fehérje szerkezete

15 Molekuláris gépezetek az élő szervezetekben - molekuláris vegyiüzemek - energiaátalakítók - motorok - jelérzékelők és jelfeldolgozók - multifunkciós gépezetek - programvezérelt összeszerelők

16 Kinezin motorfehérje

17 A kinezin mozgása

18 A baktériumok mozgásszervei a flagellumok

19 A flagelláris motor működése

20 A bakteriális flagellumok önszerveződése

21 3 RNS lánc + 55 fehérje Riboszóma önszerveződő képesség programvezérelt működés

22 Molekuláris gépezetek az élő szervezetekben Legfontosabb jellemzők: önszerveződőképesség irányított molekuláris dinamika

23 Az élő szervezetek példája azt mutatja, hogy a fehérjék és nukleinsavak kiválóan alkalmasak önszerveződő molekuláris gépezetek építésére! Miként használhatnánk fel őket a saját céljainkra?

24 Lehet-e még jobb fehérjéket csinálni? Mit remélhetünk a fehérjetervezéstől? Átlagos fehérje polipeptidláncának hossza: 300 aminosav lehetséges szekvenciák száma: db Univerzum mérete: 15 milliárd fényév 3*10 35 nm térfogata: nm 3 A lehetséges szekvenciáknak csak egy elenyésző töredékét lehetett kipróbálni az evolúció során!!!

25 Miként találja meg egy fehérje a natív szerkezetét? Átlagos fehérje polipeptidláncának hossza: 300 aminosav lehetséges konformációk száma >> db az Univerzum kora: ps Egy fehérjének esélye sincs megtalálnia a natív térszerkezetét (Levinthal paradoxon)!

26 A fehérjealapú nanotechnológia fejlődésének lehetséges forgatókönyve: az élő rendszerekben található molekuláris gépezetek szerkezetének, működési mechanizmusának felderítése meglévő fehérjék tulajdonságainak célzott módosítása fehérjetervezés fehérjékből álló komplex rendszerek tervezése másodgenerációs eszközök kifejlesztése programvezérelt összeszerelő rendszerek létrehozása

27 Fehérjék átformálása - stabilitás fokozása - specifikus kötőhelyek kialakítása - szubsztrátspecificitás megváltoztatása - felületi tulajdonságok módosítása - optikai és elektromos tulajdonságok megváltoztatása - mesterséges enzimek - fúziós fehérjék Eszköztár: - molekulamodellezés - génsebészet - irányított evolúció

28 CdSe Kvantumpötty Au Különböző méretű arany nanogömböket tartalmazó oldatok.

29 Ferritin

30 Ferritin

31 Fehérje-alapú rendezett kvantumpötty mintázat (Yamashita és mts., Panasonic Co.)

32 BNP Floating Nanodots Gate Memory (FLGM) Gate Electrode S S G Channel Electrode D D Electron/hole storage e Electron (hole) confinement in the nanodot array is controlled by the gate electrode voltage. Key structure 1Monolayer of homogenous nanodots with 2high density (10 12 /cm 2 or higher)

33 Floating Nanodots Gate Memory made by BioNanoProcess G BNP S channel D Al-electrode ~φ6nm nano-dot(ferritin core) 12nm e - Si-oxide layer 2.5~3.0nm Thermally-oxide layer TEM Image : Nano dot array burried in the SiO 2 layer by BioNanoProcess. e - Si substrate

34 Zárszó A fehérjék és nukleinsavak olyan kivételes tulajdonságokkal rendelkező anyagok, amelyek kiválóan alkalmasak önszerveződő molekuláris rendszerek építésére. Érdemes ellesnünk az élő szervezetektől a bennük működő molekuláris gépezetek szerveződési elveit, megfejteni működésük mechanizmusát, hogy a magunk kedve szerint építhessünk talán még a természetben megfigyelhetőknél is lenyűgözőbb képességű nanoméretű eszközöket.

35 Köszönöm a figyelmet!

Biomolekuláris nanotechnológia. Vonderviszt Ferenc PE MÜKKI Bio-Nanorendszerek Laboratórium

Biomolekuláris nanotechnológia. Vonderviszt Ferenc PE MÜKKI Bio-Nanorendszerek Laboratórium Biomolekuláris nanotechnológia Vonderviszt Ferenc PE MÜKKI Bio-Nanorendszerek Laboratórium Az élő szervezetek példája azt mutatja, hogy a fehérjék és nukleinsavak kiválóan alkalmasak önszerveződő molekuláris

Részletesebben

Nanotechnológia. Vonderviszt Ferenc. Veszprémi Egyetem Nanotechnológia Tanszék

Nanotechnológia. Vonderviszt Ferenc. Veszprémi Egyetem Nanotechnológia Tanszék Nanotechnológia Vonderviszt Ferenc Veszprémi Egyetem Nanotechnológia Tanszék Ősi technológiák Mikroelektronika Technológia: képesség az anyag szerkezetének, az anyagot felépítő részecskék elrendeződésének

Részletesebben

Flagellin alapú filamentáris nanoszerkezetek létrehozása

Flagellin alapú filamentáris nanoszerkezetek létrehozása Flagellin alapú filamentáris nanoszerkezetek létrehozása Vonderviszt Ferenc PE MÜKKI Bio-Nanorendszerek Laboratórium MTA Enzimológiai Intézete MTA MFA Bakteriális flagellumok Flagelláris filamentum: ~10

Részletesebben

Fehérjeszerkezet, és tekeredés

Fehérjeszerkezet, és tekeredés Fehérjeszerkezet, és tekeredés Futó Kinga 2013.10.08. Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983

Részletesebben

Nanotudományok vívmányai a mindennapokban Lagzi István László Eötvös Loránd Tudományegyetem Meteorológiai Tanszék

Nanotudományok vívmányai a mindennapokban Lagzi István László Eötvös Loránd Tudományegyetem Meteorológiai Tanszék Nanotudományok vívmányai a mindennapokban Lagzi István László Eötvös Loránd Tudományegyetem Meteorológiai Tanszék 2011. szeptember 22. Mi az a nano? 1 nm = 10 9 m = 0.000000001 m Nanotudományok: 1-100

Részletesebben

Szén nanoszerkezetek grafén nanolitográfiai szimulációja

Szén nanoszerkezetek grafén nanolitográfiai szimulációja GYŐR Szén nanoszerkezetek grafén nanolitográfiai szimulációja Dr. László István, Dr. Zsoldos Ibolya BMGE Elméleti Fizika Tanszék, SZE Anyagtudomány és Technológia Tanszék GYŐR Motiváció, előzmény: Grafén

Részletesebben

Villamosipari anyagismeret. Program, követelmények ősz

Villamosipari anyagismeret. Program, követelmények ősz Villamosipari anyagismeret Program, követelmények 2015. ősz I. félév: 2 óra előadás, vizsga II. félév: 1 óra labor, évközi jegy* Követelmények: Előadás látogatása kötelező; ellenőrzése (katalógus) minimum

Részletesebben

TDK lehetőségek az MTA TTK Enzimológiai Intézetben

TDK lehetőségek az MTA TTK Enzimológiai Intézetben TDK lehetőségek az MTA TTK Enzimológiai Intézetben Vértessy G. Beáta egyetemi tanár TDK mind 1-3 helyezettek OTDK Pro Scientia különdíj 1 második díj Diákjaink Eredményei Zsűri különdíj 2 első díj OTDK

Részletesebben

Az élő sejt fizikai Biológiája:

Az élő sejt fizikai Biológiája: Az élő sejt fizikai Biológiája: Modellépítés, biológiai rendszerek skálázódása Kellermayer Miklós Fizikai biológia Ma már nem csak kvalitatív megfigyeléseket, hanem kvantitatív méréseket végzünk (biológiai

Részletesebben

FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest,

FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest, FEHÉRJÉK A MÁGNESEKBEN Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium Alkímia Ma, Budapest, 2013.02.28. I. FEHÉRJÉK: L-α aminosavakból felépülő lineáris polimerek α H 2 N CH COOH amino

Részletesebben

FLAGELLINALAPÚ MOLEKULÁRIS OBJEKTUMOK LÉTREHOZÁSA. Sebestyén Anett

FLAGELLINALAPÚ MOLEKULÁRIS OBJEKTUMOK LÉTREHOZÁSA. Sebestyén Anett Pannon Egyetem Műszaki Informatikai Kar Nanotechnológia Tanszék FLAGELLINALAPÚ MOLEKULÁRIS OBJEKTUMOK LÉTREHOZÁSA Doktori (PhD) értekezés tézisei Sebestyén Anett Környezettudományok Doktori Iskola Témavezető:

Részletesebben

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin.

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin. Myoglobin Fehérje-szerkezetek! MGLSDGEWQLVLNVWGKVEADIPGGQEVLIRLFK GPETLEKFDKFKLKSEDEMKASE DLKKGATVLTALGGILKKKGEAEIKPLAQSA TKKIPVKYLEFISECIIQVLQSK PGDFGADAQGAMNKALELFRKDMASNYKELGFQG Fuxreiter Mónika! Debreceni

Részletesebben

A biológiai mozgások. A biológiai mozgás molekuláris mechanizmusai. Motorfehérjék. Motorfehérjék közös tulajdonságai

A biológiai mozgások. A biológiai mozgás molekuláris mechanizmusai. Motorfehérjék. Motorfehérjék közös tulajdonságai A biológiai mozgások Molekuláris mozgás A biológiai mozgás molekuláris mechanizmusai Celluláris mozgás Mártonfalvi Zsolt Bakteriális flagellum Szervezet mozgása Keratocita mozgása felületen 1 Motorfehérjék

Részletesebben

A tanári mesterszak pedagógiai - pszichológiai egysége

A tanári mesterszak pedagógiai - pszichológiai egysége A tanári mesterszak pedagógiai - pszichológiai egysége (Tanári záróvizsga témakörök szakmódszertanból) 1. A tanár szerepe a hatékony kémiatanításban. Kémia szakkörök, fakultációs foglalkozások vezetésének

Részletesebben

Hosszú szénszállal ersített manyagkompozitok mechanikai tulajdonságainak vizsgálata

Hosszú szénszállal ersített manyagkompozitok mechanikai tulajdonságainak vizsgálata Hosszú szénszállal ersített manyagkompozitok mechanikai tulajdonságainak vizsgálata Varga Csilla*, Miskolczi Norbert*, Bartha László*, Falussy Lajos** *Pannon Egyetem Vegyészmérnöki és Folyamatmérnöki

Részletesebben

MŰANYAGOK ÉGÉSGÁTLÁSA. Garas Sándor

MŰANYAGOK ÉGÉSGÁTLÁSA. Garas Sándor MŰANYAGOK ÉGÉSGÁTLÁSA 1 Az égésgátlás szükségessége Az égés Elvárások az égésgátlással kapcsolatban Az égésgátlás vizsgálatai Az égésgátló adalékanyagok 2 Az égésgátlás szükségessége A műanyagok, ezen

Részletesebben

FORD FOCUS FOCUS_2016_V8_MASTER_240x185 Cover.indd 1-3 10/10/2015 12:52:23

FORD FOCUS FOCUS_2016_V8_MASTER_240x185 Cover.indd 1-3 10/10/2015 12:52:23 FORD FOCUS 6 7 Powered by FORD EcoBoost 8 9 10 11 14 15 16 17 18 250 PS. 345 Nm 0-100km/h 6.5s 20 21 22 23 24 25 26 27 28 29 30 32 33 1 5 2 6 3 7 4 34 35 37 39 41 42 46 48 51 52 53 54 56 57 58 59

Részletesebben

FORD FIESTA FIESTA_2014_240x185 Cover_V3.indd 1-3 04/10/2013 15:49:22

FORD FIESTA FIESTA_2014_240x185 Cover_V3.indd 1-3 04/10/2013 15:49:22 FORD FIESTA 6 8 9 10 16 17 Powered by FORD EcoBoost 18 19 22 26 182 PS. 240 Nm (290 Nm*). 0-100 km/h 6,9 s. 28 30 31 32 33 34 35 37 39 41 43 44 45 1 2 3 4 5 6 7 x 87 49 53 55 56 59 1 4 3 2 5 5

Részletesebben

Nanofizika, nanotechnológia és anyagtudomány

Nanofizika, nanotechnológia és anyagtudomány Nanofizika, nanotechnológia és anyagtudomány Magyarázó feliratok Nanofizika, nanotechnológia és anyagtudomány Növekvő ütemű fejlődés Helyzetelemzés Technológia és minősítés Nanoszekezetek fabrikált építkező

Részletesebben

Kolloidstabilitás. Berka Márta 2010/2011/II

Kolloidstabilitás. Berka Márta 2010/2011/II Kolloidstabilitás Berka Márta 2010/2011/II Kolloid stabilitáshoz taszítás kell. Sztérikus stabilizálás V R V S sztérikus stabilizálás: liofil kolloidok alkalmazása védőhatás adszorpció révén (természetes

Részletesebben

Lótuszvirág effektuson alapuló öntisztuló felületek képzésére alkalmas vízbázisú bevonat

Lótuszvirág effektuson alapuló öntisztuló felületek képzésére alkalmas vízbázisú bevonat Lótuszvirág effektuson alapuló öntisztuló felületek képzésére alkalmas vízbázisú bevonat Nanocolltech Kft. Jól ismert, hogy a lótuszvirág levelét és virágát a víz és más folyadékok nem nedvesítik, olyan

Részletesebben

Havancsák Károly, ELTE TTK Fizikai Intézet. A nanovilág. tudománya és technológiája

Havancsák Károly, ELTE TTK Fizikai Intézet. A nanovilág. tudománya és technológiája Havancsák Károly, ELTE TTK Fizikai Intézet 1 A nanovilág tudománya és technológiája Miről lesz szó 2 - Mi a manó az a nano? - Fontos-e a méret? - Miért akarunk egyre kisebb eszközöket gyártani? - Mikor

Részletesebben

Makromolekulák. Fehérjetekeredé. rjetekeredés. Biopolimer. Polimerek

Makromolekulák. Fehérjetekeredé. rjetekeredés. Biopolimer. Polimerek Biopolimerek Makromolekulá Makromolekulák. Fehé Fehérjetekeredé rjetekeredés. Osztódó sejt magorsófonala 2011. November 16. Huber Tamá Tamás Dohány levél epidermális sejtjének aktin hálózata Bakteriofágból

Részletesebben

Evolúcióelmélet és az evolúció mechanizmusai

Evolúcióelmélet és az evolúció mechanizmusai Evolúcióelmélet és az evolúció mechanizmusai Az élet Darwini szemlélete Melyek az evolúció bizonyítékai a világban? EVOLÚCIÓ: VÁLTOZATOSSÁG Mutáció Horizontális géntranszfer Genetikai rekombináció Rekombináció

Részletesebben

DNS, RNS, Fehérjék. makromolekulák biofizikája. Biológiai makromolekulák. A makromolekulák TÖMEG szerinti mennyisége a sejtben NAGY

DNS, RNS, Fehérjék. makromolekulák biofizikája. Biológiai makromolekulák. A makromolekulák TÖMEG szerinti mennyisége a sejtben NAGY makromolekulák biofizikája DNS, RNS, Fehérjék Kellermayer Miklós Tér Méret, alak, lokális és globális szerkezet Idő Fluktuációk, szerkezetváltozások, gombolyodás Kölcsönhatások Belső és külső kölcsöhatások,

Részletesebben

POSZTTRANSZLÁCIÓS MÓDOSÍTÁSOK: GLIKOZILÁLÁSOK

POSZTTRANSZLÁCIÓS MÓDOSÍTÁSOK: GLIKOZILÁLÁSOK POSZTTRANSZLÁCIÓS MÓDOSÍTÁSOK: GLIKOZILÁLÁSOK Dr. Pécs Miklós Budapesti Műszaki és Gazdaságtudományi Egyetem, Alkalmazott Biotechnológia és Élelmiszertudomány Tanszék 1 Glikozilálás A rekombináns fehérjék

Részletesebben

1 2 3 4 5 6 7 A B 8 9 10 11 [Nm] 370 [kw] [PS] 110 150 350 330 310 100 136 90 122 290 270 80 109 250 70 95 230 210 60 82 190 50 68 170 150 40 54 130 110 90 140 PS 125 PS 100 PS 30 20 41 27 70 1000 1500

Részletesebben

2 3 4 5 6 7 8 9 A B A B 11 12 13 [Nm] 370 350 330 310 290 270 250 230 210 190 [kw] [PS] 110 150 100 136 90 122 80 109 70 95 60 82 50 68 170 150 40 54 130 110 90 140 PS 85 PS 110 PS 70 1000 1500 2000 2500

Részletesebben

Fehérjeszerkezet, és tekeredés. Futó Kinga

Fehérjeszerkezet, és tekeredés. Futó Kinga Fehérjeszerkezet, és tekeredés Futó Kinga Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983 H 211861 N

Részletesebben

Biofizika I 2013-2014 2014.12.02.

Biofizika I 2013-2014 2014.12.02. ÁTTEKINTÉS AZ IZOM TÍPUSAI: SZERKEZET és FUNKCIÓ A HARÁNTCSÍKOLT IZOM SZERKEZETE MŰKÖDÉSÉNEK MOLEKULÁRIS MECHANIZMUSA IZOM MECHANIKA Biofizika I. -2014. 12. 02. 03. Dr. Bugyi Beáta PTE ÁOK Biofizikai Intézet

Részletesebben

1 2 3 4 5 6 7 112 8 9 10 11 12 13 [Nm] 400 375 350 325 300 275 250 225 200 175 150 125 114 kw 92 kw 74 kw [155 PS] [125 PS] [100 PS] kw [PS] 140 [190] 130 [176] 120 [163] 110 [149] 100 [136] 90 [122] 80

Részletesebben

1 2 3 4 5 A B 6 7 8 9 [Nm] 370 350 330 310 290 270 250 [kw] [PS] 110 150 100 136 90 122 80 109 70 95 230 210 60 82 190 170 150 50 40 68 54 130 110 90 140 PS 100 PS 125 PS 30 20 41 27 70 1000 1500 2000

Részletesebben

1 2 3 4 5 7 9 A B 10 11 12 13 14 15 16 17 18 19 [Nm] 370 350 330 310 290 270 250 230 210 190 170 150 130 110 90 140 PS 100 PS 125 PS 70 1000 1500 2000 2500 3000 3500 4000 RPM [kw] [PS] 110 150 100 136

Részletesebben

Á Ő ö Ö ő ú ő ö ő ú ö ő ö Á Ö ö Í ö ő ő ü ü ű ő Í ő ü ö ö ő ö ö ő Í ü ű Í Í Á Í Á Áú ú Í Ü ö ö É ú ü ö ú ö ü Í ő Á ő ü ő Á ú Ö Í Á Í ú Á ű Á ú ú Á ű ő ö ö ö ü ő Á Á Á Á Ő Á Á Ő É Á Á ö Í ő ü ü ü ö Á Í

Részletesebben

3. Általános egészségügyi ismeretek az egyes témákhoz kapcsolódóan

3. Általános egészségügyi ismeretek az egyes témákhoz kapcsolódóan 11. évfolyam BIOLÓGIA 1. Az emberi test szabályozása Idegi szabályozás Hormonális szabályozás 2. Az érzékelés Szaglás, tapintás, látás, íz érzéklés, 3. Általános egészségügyi ismeretek az egyes témákhoz

Részletesebben

Nemzeti alaptanterv 2012 EMBER ÉS TERMÉSZET

Nemzeti alaptanterv 2012 EMBER ÉS TERMÉSZET ALAPELVEK, CÉLOK A műveltségterület középpontjában a természet és az azt megismerni igyekvő ember áll. A természettudományi műveltség a természettel való közvetlen, megértő és szeretetteljes kapcsolaton

Részletesebben

Nanotanoda: érdekességek a nanoanyagok köréből

Nanotanoda: érdekességek a nanoanyagok köréből Nanotanoda: érdekességek a nanoanyagok köréből Szén nanoszerkezetek Dr. Zsoldos Ibolya Széchenyi István Egyetem, Győr Anyagismereti és Járműgyártási Tanszék 2011 január 12 Nanoméret, nanoanyagok fogalma

Részletesebben

Anyagismeret. Az anyagtudomány szerepe

Anyagismeret. Az anyagtudomány szerepe Anyagismeret Az anyagtudomány szerepe Az anyagtudomány szerepe a XX-XXI. század fordulóján Stratégia: anyag- és energiatakarékos rendszerek Reciklizálható rendszerek! Kritikus tudományok: energetika, számítástechnika,

Részletesebben

A fehérjéket felépítő húsz standard aminosav Fehérjék szerkezetének kialakulása

A fehérjéket felépítő húsz standard aminosav Fehérjék szerkezetének kialakulása A fehérjéket felépítő húsz standard aminosav Fehérjék szerkezetének kialakulása Osváth Szabolcs Semmelweis Egyetem szabolcs.osvath@eok.sote.hu reakció t 1/2 25 ºC-on t 1/2 100 ºC-on DNS hidrolízis Biopolimerek

Részletesebben

Ritmikus kémia. Szalai István ELTE

Ritmikus kémia. Szalai István ELTE Ritmikus kémia Szalai István ELTE 2015 Ritmus - Idõbeli jelenségekben megnyilvánuló szabályos váltakozás - Térbeli formáknak, elemeknek szabályos vagy arányos elrendezõdése, tagoltsága (Magyar értelmezõ

Részletesebben

KÖSZÖNTJÜK HALLGATÓINKAT!

KÖSZÖNTJÜK HALLGATÓINKAT! 2011. Január 12. KÖSZÖNTJÜK HALLGATÓINKAT! Önök Dr. Zsoldos Ibolya Nanotanoda - érdekességek a nanoanyagok köréből (Szén nanoszerkezetek) előadását hallhatják! Nanoméret, nanoanyagok 1 km = 1000 m 1 m

Részletesebben

Polimer nanokompozit blendek mechanikai és termikus tulajdonságai

Polimer nanokompozit blendek mechanikai és termikus tulajdonságai SZÉCHENYI ISTVÁN EGYETEM Anyagtudományi és Technológiai Tanszék Polimer nanokompozit blendek mechanikai és termikus tulajdonságai Dr. Hargitai Hajnalka, Ibriksz Tamás Mojzes Imre Nano Törzsasztal 2013.

Részletesebben

MÉRNÖKI ANYAGISMERET AJ002_1 Közlekedésmérnöki BSc szak Csizmazia Ferencné dr. főiskolai docens B 403. Dr. Dogossy Gábor Egyetemi adjunktus B 408

MÉRNÖKI ANYAGISMERET AJ002_1 Közlekedésmérnöki BSc szak Csizmazia Ferencné dr. főiskolai docens B 403. Dr. Dogossy Gábor Egyetemi adjunktus B 408 MÉRNÖKI ANYAGISMERET AJ002_1 Közlekedésmérnöki BSc szak Csizmazia Ferencné dr. főiskolai docens B 403 Dr. Dogossy Gábor Egyetemi adjunktus B 408 Az anyag Az anyagot az ember nyeri ki a természetből és

Részletesebben

Sejtmag, magvacska magmembrán

Sejtmag, magvacska magmembrán Sejtmag, magvacska magmembrán Láng Orsolya Semmelweis Egyetem, Genetikai, Sejt- és Immunbiológiai Intézet Kompartmentalizáció Prokaryóta Cytoplazma Eukaryóta Endomembrán Kromatin Plazma membrán Eredménye

Részletesebben

Biomolekulák nanomechanikája A biomolekuláris rugalmasság alapjai

Biomolekulák nanomechanikája A biomolekuláris rugalmasság alapjai Fogorvosi Anyagtan Fizikai Alapjai Biomolekulák nanomechanikája A biomolekuláris rugalmasság alapjai Mártonfalvi Zsolt Biofizikai és Sugárbiológiai Intézet Semmelweis Egyetem Budapest Biomolekulák mint

Részletesebben

BIOKÉMIA. Simonné Prof. Dr. Sarkadi Livia egyetemi tanár.

BIOKÉMIA. Simonné Prof. Dr. Sarkadi Livia egyetemi tanár. BIOKÉMIA Simonné Prof. Dr. Sarkadi Livia egyetemi tanár e-mail: sarkadi@mail.bme.hu Tudományterületi elhelyezés Alaptudományok (pl.: matematika, fizika, kémia, biológia) Alkalmazott tudományok Interdiszciplináris

Részletesebben

Művelettan 3 fejezete

Művelettan 3 fejezete Művelettan 3 fejezete Impulzusátadás Hőátszármaztatás mechanikai műveletek áramlástani műveletek termikus műveletek aprítás, osztályozás ülepítés, szűrés hűtés, sterilizálás, hőcsere Komponensátadás anyagátadási

Részletesebben

Lehet-e tökéletes nanotechnológiai eszközöket készíteni tökéletlen grafénból?

Lehet-e tökéletes nanotechnológiai eszközöket készíteni tökéletlen grafénból? Lehet-e tökéletes nanotechnológiai eszközöket készíteni tökéletlen grafénból? Márk Géza, Vancsó Péter, Nemes-Incze Péter, Tapasztó Levente, Dobrik Gergely, Osváth Zoltán, Philippe Lamin, Chanyong Hwang,

Részletesebben

ANYAGTUDOMÁNY ÉS TECHNOLÓGIA TANSZÉK. Anyagismeret 2016/17. Szilárdságnövelés. Dr. Mészáros István Az előadás során megismerjük

ANYAGTUDOMÁNY ÉS TECHNOLÓGIA TANSZÉK. Anyagismeret 2016/17. Szilárdságnövelés. Dr. Mészáros István Az előadás során megismerjük ANYAGTUDOMÁNY ÉS TECHNOLÓGIA TANSZÉK Anyagismeret 2016/17 Szilárdságnövelés Dr. Mészáros István meszaros@eik.bme.hu 1 Az előadás során megismerjük A szilárságnövelő eljárásokat; Az eljárások anyagszerkezeti

Részletesebben

6. változat. 3. Jelöld meg a nem molekuláris szerkezetű anyagot! A SO 2 ; Б C 6 H 12 O 6 ; В NaBr; Г CO 2.

6. változat. 3. Jelöld meg a nem molekuláris szerkezetű anyagot! A SO 2 ; Б C 6 H 12 O 6 ; В NaBr; Г CO 2. 6. változat Az 1-től 16-ig terjedő feladatokban négy válaszlehetőség van, amelyek közül csak egy helyes. Válaszd ki a helyes választ és jelöld be a válaszlapon! 1. Jelöld meg azt a sort, amely helyesen

Részletesebben

A kémiatanári zárószigorlat tételsora

A kémiatanári zárószigorlat tételsora 1. A. tétel A kémiatanári zárószigorlat tételsora Kémiai alapfogalmak: Atom- és molekulatömeg, anyagmennyiség, elemek és vegyületek elnevezése, jelölése. Kémiai egyenlet, sztöchiometria. A víz jelentősége

Részletesebben

Biológiai makromolekulák szerkezete

Biológiai makromolekulák szerkezete Biológiai makromolekulák szerkezete Biomolekuláris nemkovalens kölcsönhatások Elektrosztatikus kölcsönhatások (sóhidak: 4-6 kcal/m, dipól-dipól: ~10-1 kcal/m Diszperziós erők (~10-2 kcal/m) Hidrogén hidak

Részletesebben

LEHET-E TÖKÉLETES NANOELEKTRONIKAI ESZKÖZÖKET KÉSZÍTENI TÖKÉLETLEN GRAFÉNBÔL?

LEHET-E TÖKÉLETES NANOELEKTRONIKAI ESZKÖZÖKET KÉSZÍTENI TÖKÉLETLEN GRAFÉNBÔL? LEHET-E TÖKÉLETES NANOELEKTRONIKAI ESZKÖZÖKET KÉSZÍTENI TÖKÉLETLEN GRAFÉNBÔL? Márk Géza, Vancsó Péter, Biró László Péter MTA TTK Műszaki Fizikai és Anyagtudományi Kutatóintézet A grafén a grafit egyetlen

Részletesebben

SiAlON. , TiC, TiN, B 4 O 3

SiAlON. , TiC, TiN, B 4 O 3 ALKALMAZÁSOK 2. SiAlON A műszaki kerámiák (Al 2 O 3, Si 3 N 4, SiC, ZrO 2, TiC, TiN, B 4 C, stb.) fémekhez képest igen kemény, kopásálló, ugyanakkor rideg, azaz dinamikus igénybevételek elviselésére csak

Részletesebben

Mi is az a NANOTECHNOLÓGIA?

Mi is az a NANOTECHNOLÓGIA? Mi is az a NANOTECHNOLÓGIA? Ugye hallottál már arról, hogy minden apró atomokból áll? A kavicsok, a ceruzád, a telefonod, ez a képernyő, az állatok, és te magad is: mindent atomok építenek fel. Az atomok

Részletesebben

Nanotechnológia építıkövei: Nanocsövek és nanovezetékek

Nanotechnológia építıkövei: Nanocsövek és nanovezetékek Nanotechnológia építıkövei: Nanocsövek és nanovezetékek Molnár László Milán okl. mérnök-fizikus adjunktus Budapesti Mőszaki és Gazdaságtudományi Egyetem Elektronikai Technológia Tanszék Mi az a nano? Nanosz

Részletesebben

A BIOLÓGIAI GYÓGY- SZEREK FEJLESZTÉSÉNEK FINANSZÍROZÁSA ÉS TERÁPIÁS CÉLTERÜLETEI

A BIOLÓGIAI GYÓGY- SZEREK FEJLESZTÉSÉNEK FINANSZÍROZÁSA ÉS TERÁPIÁS CÉLTERÜLETEI Az élettudományi-klinikai felsőoktatás gyakorlatorientált és hallgatóbarát korszerűsítése a vidéki képzőhelyek nemzetközi versenyképességének erősítésére A BIOLÓGIAI GYÓGY- SZEREK FEJLESZTÉSÉNEK FINANSZÍROZÁSA

Részletesebben

Az élő anyag szerkezeti egységei: víz, nukleinsavak, fehérjék. elrendeződés, rend, rendszer, periodikus ismétlődés

Az élő anyag szerkezeti egységei: víz, nukleinsavak, fehérjék. elrendeződés, rend, rendszer, periodikus ismétlődés Az élő anyag szerkezeti egységei: víz, nukleinsavak, fehérjék Agócs Gergely 2013. december 3. kedd 10:00 11:40 1. Mit értünk élő anyag alatt? Az élő szervezetet felépítő anyagok. Az anyag azonban nem csupán

Részletesebben

Ipari robotok megfogó szerkezetei

Ipari robotok megfogó szerkezetei IPARI ROBOTOK Ipari robotok megfogó szerkezetei 6. előadás Dr. Pintér József Tananyag vázlata Ipari robotok megfogó szerkezetei 1. Effektor fogalma 2. Megfogó szerkezetek csoportosítása 3. Mechanikus megfogó

Részletesebben

A NANOTECHNOLÓGIA RÖVID TÖRTÉNETE

A NANOTECHNOLÓGIA RÖVID TÖRTÉNETE BEVEZETŐ Üdvözli minden olvasóját ez a különleges kiadvány, amely középiskolás diákok írásait tartalmazza a nanotechnológiáról, elsősorban középiskolás diákok számára. A tanulóknak, akiktől a bevezetőt

Részletesebben

Tömeg (2) kg/darab NYLATRON MC 901 NYLATRON GSM NYLATRON NSM 40042000 40050000 40055000 50. Átmérő tűrései (1) mm. Átmérő mm.

Tömeg (2) kg/darab NYLATRON MC 901 NYLATRON GSM NYLATRON NSM 40042000 40050000 40055000 50. Átmérő tűrései (1) mm. Átmérő mm. NYLTRON M 901, kék (színezett, növelt szívósságú, öntött P 6) NYLTRON GSM, szürkésfekete; (MoS, szilárd kenőanyagot tartalmazó, öntött P 6) NYLTRON NSM, szürke (szilárd kenőanyag kombinációt tartalmazó

Részletesebben

Az ioncsatorna fehérjék szerkezete, működése és szabályozása. A patch-clamp technika

Az ioncsatorna fehérjék szerkezete, működése és szabályozása. A patch-clamp technika Az ioncsatorna fehérjék szerkezete, működése és szabályozása. A patch-clamp technika Panyi György 2014. November 12. Mesterséges membránok ionok számára átjárhatatlanok Iontranszport a membránon keresztül:

Részletesebben

Kompaktaszfalt burkolat.

Kompaktaszfalt burkolat. Kompaktaszfalt burkolat. Építési feltételek és minőségi követelmények Képes Győző Útépítési Akadémia 18. 2012.10.25. www.maut.hu 1 Tartalom Burkolati követelmények, tönkremenetelek A kompaktaszfalt alkalmazásának

Részletesebben

A projekt rövidítve: NANOSTER A projekt időtartama: 2009. október 2012. december

A projekt rövidítve: NANOSTER A projekt időtartama: 2009. október 2012. december A projekt címe: Egészségre ártalmatlan sterilizáló rendszer kifejlesztése A projekt rövidítve: NANOSTER A projekt időtartama: 2009. október 2012. december A konzorcium vezetője: A konzorcium tagjai: A

Részletesebben

Építkezés biológiai makromolekulák segítségével

Építkezés biológiai makromolekulák segítségével A nanotechnológia két dologban különbözik az eddig ismert technológiáktól: Az egyik, hogy a nanométeres mérettartományban mozgunk, építkezünk. Nagyon fontos, hogy ez az építkezés alulról-felfelé építkezés,

Részletesebben

A biológiai mozgás molekuláris mechanizmusai

A biológiai mozgás molekuláris mechanizmusai BIOLÓGIAI MOZGÁSOK A biológiai mozgás molekuláris mechanizmusai Kollektív mozgás Szervezet mozgása ( Az évszázad ugrása ) Szerv mozgás BIOLÓGIAI MOZGÁSOK BIOLÓGIAI MOZGÁSOK Ritmusosan összehúzódó szívizomsejt

Részletesebben

Szoros kapcsolat. Termékminõség. Szakértelem. a vevõkkel. Tengine IMAGE. Termékismertetõ

Szoros kapcsolat. Termékminõség. Szakértelem. a vevõkkel. Tengine IMAGE. Termékismertetõ Szakértelem Termékminõség Szoros kapcsolat a vevõkkel Termékismertetõ Tengine IMAGE Tengine IMAGE család Robosztusak és nagy teljesítményûek: ezek a LED-modulok egyenletes megvilágítást adnak bármilyen

Részletesebben

Anyagismeret tételek

Anyagismeret tételek Anyagismeret tételek 1. Iparban használatos anyagok csoportosítása - Anyagok: - fémek: - vas - nem vas: könnyű fémek, nehéz fémek - nemesfémek - nem fémek: - műanyagok: - hőre lágyuló - hőre keményedő

Részletesebben

Szabályozott tulajdonságokkal rendelkező mágneses nanokristályok biomimetikus szintézise

Szabályozott tulajdonságokkal rendelkező mágneses nanokristályok biomimetikus szintézise Szabályozott tulajdonságokkal rendelkező mágneses nanokristályok biomimetikus szintézise Pósfai Mihály Pannon Egyetem, Környezettudományi Intézet Kutató Kari Minősítés Kötelezettségei és Lehetőségei Veszprém,

Részletesebben

Fehérjék nanomechanikai tulajdonságainak vizsgálata Atomi Er Mikroszkópiával NEMES CSILLA

Fehérjék nanomechanikai tulajdonságainak vizsgálata Atomi Er Mikroszkópiával NEMES CSILLA DOKTORI ÉRTEKEZÉS TÉZISEI Fehérjék nanomechanikai tulajdonságainak vizsgálata Atomi Er Mikroszkópiával NEMES CSILLA Témavezet : Dr. Rozlosnik Noémi ELTE, Biológiai Fizika Tanszék Semmelweis Orvostudományi

Részletesebben

1. változat. 4. Jelöld meg azt az oxidot, melynek megfelelője a vas(iii)-hidroxid! A FeO; Б Fe 2 O 3 ; В OF 2 ; Г Fe 3 O 4.

1. változat. 4. Jelöld meg azt az oxidot, melynek megfelelője a vas(iii)-hidroxid! A FeO; Б Fe 2 O 3 ; В OF 2 ; Г Fe 3 O 4. 1. változat z 1-től 16-ig terjedő feladatokban négy válaszlehetőség van, amelyek közül csak egy helyes. Válaszd ki a helyes választ és jelöld be a válaszlapon! 1. Melyik sor fejezi be helyesen az állítást:

Részletesebben

FOK Fogorvosi anyagtan fizikai alapjai tárgy kolokviumi kérdései 2012/13-es tanév I. félév

FOK Fogorvosi anyagtan fizikai alapjai tárgy kolokviumi kérdései 2012/13-es tanév I. félév FOK Fogorvosi anyagtan fizikai alapjai tárgy kolokviumi kérdései 2012/13-es tanév I. félév A kollokviumon egy-egy tételt kell húzni az 1-10. és a 11-20. kérdések közül. 1. Atomi kölcsönhatások, kötéstípusok.

Részletesebben

2 51 3 4 5 6 7 8 9 10 11 12 13 14 15 [Nm] 350 330 310 290 270 250 230 210 190 170 150 130 110 90 70 130 PS 110 PS 85 PS [kw] [PS] 100 136 90 122 80 109 70 95 60 82 50 68 40 54 30 41 20 27 10 14 [Nm] 400

Részletesebben

12/4/2014. Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció. 1952 Hershey & Chase 1953!!!

12/4/2014. Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció. 1952 Hershey & Chase 1953!!! Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció 1859 1865 1869 1952 Hershey & Chase 1953!!! 1879 1903 1951 1950 1944 1928 1911 1 1. DNS szerkezete Mi az örökítő anyag? Friedrich Miescher

Részletesebben

Az élő szervezetek felépítése I. Biogén elemek biomolekulák alkotóelemei a természetben előforduló elemek közül 22 fordul elő az élővilágban O; N; C; H; P; és S; - élő anyag 99%-a Biogén elemek sajátosságai:

Részletesebben

Informatika és növekedés. Pongrácz Ferenc ügyvezető igazgató, IBM ISC Magyarország Kft., az MKT Informatikai Szakosztályának elnöke

Informatika és növekedés. Pongrácz Ferenc ügyvezető igazgató, IBM ISC Magyarország Kft., az MKT Informatikai Szakosztályának elnöke Informatika és növekedés Pongrácz Ferenc ügyvezető igazgató, IBM ISC Magyarország Kft., az MKT Informatikai Szakosztályának elnöke Honnan jön a lendület? Az Infokommunikációs iparág adja!* 1 2 3 Permanens

Részletesebben

TestLine - Fizika 8. évfolyam elektromosság alapok Minta feladatsor

TestLine - Fizika 8. évfolyam elektromosság alapok Minta feladatsor Mi az áramerősség fogalma? (1 helyes válasz) 1. 1:56 Normál Egységnyi idő alatt áthaladó töltések száma. Egységnyi idő alatt áthaladó feszültségek száma. Egységnyi idő alatt áthaladó áramerősségek száma.

Részletesebben

BI/1 feladat megoldása Meghatározzuk a hőátbocsátási tényezőt 3 különböző szigetelés vastagság (0, 3 és 6 cm) mellett.

BI/1 feladat megoldása Meghatározzuk a hőátbocsátási tényezőt 3 különböző szigetelés vastagság (0, 3 és 6 cm) mellett. BI/1 feladat megoldása Meghatározzuk a hőátbocsátási tényezőt 3 különböző szigetelés vastagság (0, 3 és 6 cm) mellett. 1 1 2 U6 cm = = = 0,4387 W/ m K 1 d 1 1 0,015 0,06 0,3 0,015 1 + + + + + + + α λ α

Részletesebben

A biológiai mozgások. Motorfehérjék. Motorfehérjék közös tulajdonságai 4/22/2015. A biológiai mozgás molekuláris mechanizmusai. Szerkezeti homológia

A biológiai mozgások. Motorfehérjék. Motorfehérjék közös tulajdonságai 4/22/2015. A biológiai mozgás molekuláris mechanizmusai. Szerkezeti homológia A biológiai mozgások Molekuláris mozgás A biológiai mozgás molekuláris mechanizmusai. Celluláris mozgás Mártonfalvi Zsolt Bakteriális flagellum Szervezet mozgása Keratocita mozgása felületen Motorfehérjék

Részletesebben

kompozit profilok FORGALMAZÓ: Personal Visitor Kereskedelmi és Szolgáltató Bt. 6728 Szeged, Délceg utca 32/B Magyarország

kompozit profilok FORGALMAZÓ: Personal Visitor Kereskedelmi és Szolgáltató Bt. 6728 Szeged, Délceg utca 32/B Magyarország Epoxi gyanta epoxi ragasztó pultrud profilok szendvics panelek TERMÉK KATALÓGUS PULTRUDÁLT PROFILOK kompozit profilok FORGALMAZÓ: Personal Visitor Kereskedelmi és Szolgáltató Bt. 6728 Szeged, Délceg utca

Részletesebben

1.7. Felületek és katalizátorok

1.7. Felületek és katalizátorok Mobilitás és Környezet Konferencia Magyar Tudományos Akadémia Budapest, 2012. január 23. 1.7. Felületek és katalizátorok Polimer töltőanyagként alkalmazható agyagásvány nanostruktúrák előállítása Horváth

Részletesebben

Méréstechnika. Hőmérséklet mérése

Méréstechnika. Hőmérséklet mérése Méréstechnika Hőmérséklet mérése Hőmérséklet: A hőmérséklet a termikus kölcsönhatáshoz tartozó állapotjelző. A hőmérséklet azt jelzi, hogy egy test hőtartalma milyen szintű. Amennyiben két eltérő hőmérsékletű

Részletesebben

Mikro és nanorobot koncepciók. Horváth Gergő Márton Gergely

Mikro és nanorobot koncepciók. Horváth Gergő Márton Gergely Mikro és nanorobot koncepciók Készítette: Horváth Gergő Márton Gergely Nanorobotok alatt mikroszpókikus méretű robotokat értünk, melyeket specifikus feladatok végrehajtására terveztek. (Leendő) alkalmazások?

Részletesebben

Fizika 7. 8. évfolyam

Fizika 7. 8. évfolyam Éves órakeret: 55,5 Heti óraszám: 1,5 7. évfolyam Fizika 7. 8. évfolyam Óraszám A testek néhány tulajdonsága 8 A testek mozgása 8 A dinamika alapjai 10 A nyomás 8 Hőtan 12 Összefoglalás, ellenőrzés 10

Részletesebben

PHYWE Fizikai kémia és az anyagok tulajdonságai

PHYWE Fizikai kémia és az anyagok tulajdonságai PHYWE Fizikai kémia és az anyagok tulajdonságai Témakörök: Gázok és gáztörvények Felületi feszültség Viszkozitás Sűrűség és hőtágulás Olvadáspont, forráspont, lobbanáspont Hőtan és kalorimetria Mágneses

Részletesebben

Ciklodextrinek alkalmazási lehetőségei kolloid diszperz rendszerekben

Ciklodextrinek alkalmazási lehetőségei kolloid diszperz rendszerekben Ciklodextrinek alkalmazási lehetőségei kolloid diszperz rendszerekben Vázlat I. Diszperziós kolloidok stabilitása általános ismérvek II. Ciklodextrinek és kolloidok kölcsönhatása - szorpció - zárványkomplex-képződés

Részletesebben

Általános Kémia, BMEVESAA101

Általános Kémia, BMEVESAA101 Általános Kémia, BMEVESAA101 Dr Csonka Gábor, egyetemi tanár Az anyag Készítette: Dr. Csonka Gábor egyetemi tanár, csonkagi@gmail.com 1 Jegyzet Dr. Csonka Gábor http://web.inc.bme.hu/csonka/ Óravázlatok:

Részletesebben

Az anyagok mágneses tulajdonságai

Az anyagok mágneses tulajdonságai BME, Anyagtudomány és Technológia Tanszék Dr. Mészáros István Mágneses tulajdonságok, mágneses anyagok Előadásvázlat 2013. 1 Az anyagok mágneses tulajdonságai Alkalmazási területek Jelentőségük (lágy:

Részletesebben

tervezési szempontok (igénybevétel, feszültségeloszlás,

tervezési szempontok (igénybevétel, feszültségeloszlás, Elhasználódási és korróziós folyamatok Bagi István BME MTAT Biofunkcionalitás Az élő emberi szervezettel való kölcsönhatás biokompatibilitás (gyulladás, csontfelszívódás, metallózis) aktív biológiai környezet

Részletesebben

Évelő lágyszárú növények biomasszájának hasznosítása

Évelő lágyszárú növények biomasszájának hasznosítása Évelő lágyszárú növények biomasszájának hasznosítása Dr. Hornyák Margit c. egyetemi docens SZE Mezőgazdaság- és Élelmiszertudományi Kar Mosonmagyaróvár MMK Környezetvédelmi Tagozat 2016. január 20. Problémafelvetés

Részletesebben

9. évfolyam. Osztályozóvizsga tananyaga FIZIKA

9. évfolyam. Osztályozóvizsga tananyaga FIZIKA 9. évfolyam Osztályozóvizsga tananyaga A testek mozgása 1. Egyenes vonalú egyenletes mozgás 2. Változó mozgás: gyorsulás fogalma, szabadon eső test mozgása 3. Bolygók mozgása: Kepler törvények A Newtoni

Részletesebben

Általános Kémia, BMEVESAA101 Dr Csonka Gábor, egyetemi tanár. Az anyag Készítette: Dr. Csonka Gábor egyetemi tanár,

Általános Kémia, BMEVESAA101 Dr Csonka Gábor, egyetemi tanár. Az anyag Készítette: Dr. Csonka Gábor egyetemi tanár, Általános Kémia, BMEVESAA101 Dr Csonka Gábor, egyetemi tanár Az anyag Készítette: Dr. Csonka Gábor egyetemi tanár, csonkagi@gmail.com 1 Jegyzet Dr. Csonka Gábor http://web.inc.bme.hu/csonka/ Facebook,

Részletesebben

Fém, kerámia és biokompozit bioanyagok lézersugaras felületmódosítása

Fém, kerámia és biokompozit bioanyagok lézersugaras felületmódosítása Fém, kerámia és biokompozit bioanyagok lézersugaras felületmódosítása Bitay Enikő 1, Olasz Sándor 2, Dobránszky János 3 1 Sapientia Erdélyi Magyar Tudományegyetem, Marosvásárhely-Koronka, ebitay@ms.sapientia.ro

Részletesebben

Lumineszcencia alapjelenségek

Lumineszcencia alapjelenségek Lumineszcencia alapjelenségek (Nyitrai Miklós; 211 február 7.) Lumineszcencia Definíció: Egyes anyagok spontán fénykibocsátása, a termikus fényemissziótól függetlenül, elektrongerjesztést követően. Lumineszcens

Részletesebben

Farmakológus szakasszisztens Farmakológus szakasszisztens 2/34

Farmakológus szakasszisztens Farmakológus szakasszisztens 2/34 -06 Farmakológus szakasszisztens feladatok A 0/007 (II. 7.) SzMM rendelettel módosított /006 (II. 7.) OM rendelet Országos Képzési Jegyzékről és az Országos Képzési Jegyzékbe történő felvétel és törlés

Részletesebben

Szénszálak és szén nanocsövek

Szénszálak és szén nanocsövek Szénszálak és szén nanocsövek Hernádi Klára Szegedi Tudományegyetem Alkalmazott Kémiai Tanszék 1 Rendszám: 6 IV. főcsoport Nemfémek Négy vegyértékű Legjelentősebb allotróp módosulatok: SZÉN Kötéserősség:

Részletesebben

MŰANYAGOK ALKALMAZÁSA, UTÓMŰVELETEK

MŰANYAGOK ALKALMAZÁSA, UTÓMŰVELETEK MŰANYAGOK ALKALMAZÁSA, UTÓMŰVELETEK Hibrid szerkezetek szerves bádoggal A hibrid szerkezetek tömege jelentősen csökkenthető, ha a fémkomponens helyett is műanyagot, ún. szerves bádogot használnak. A szerves

Részletesebben

Az anyag tulajdonságaitól a felhasználásig - természetes alapanyagok és hulladékok hasznosítását megalapozó kutatások

Az anyag tulajdonságaitól a felhasználásig - természetes alapanyagok és hulladékok hasznosítását megalapozó kutatások Pannon Egyetem, 2013. május 31. Az anyag tulajdonságaitól a felhasználásig - természetes alapanyagok és hulladékok hasznosítását megalapozó kutatások TÁMOP-4.2.2.A-11/1/KONV-2012-0071 Kedvezményezett:

Részletesebben