Fehérjék nanomechanikai tulajdonságainak vizsgálata Atomi Er Mikroszkópiával NEMES CSILLA

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "Fehérjék nanomechanikai tulajdonságainak vizsgálata Atomi Er Mikroszkópiával NEMES CSILLA"

Átírás

1 DOKTORI ÉRTEKEZÉS TÉZISEI Fehérjék nanomechanikai tulajdonságainak vizsgálata Atomi Er Mikroszkópiával NEMES CSILLA Témavezet : Dr. Rozlosnik Noémi ELTE, Biológiai Fizika Tanszék Semmelweis Orvostudományi Egyetem Doktori Iskola Ionizáló és nem ionizáló sugárzások biológiai hatásai Programvezet : Dr. Rontó Györgyi 2002

2 Kutatási célkit zések és módszerek Az utóbbi évtizedekben fontossá vált a felületek lokális mechanikai és adhéziós tulajdonságainak, valamint a nanoskálájú intra- és intermolekuláris kölcsönhatásoknak fiziológiás környezetben való vizsgálata. Molekuláris felbontású szerkezeti vizsgálatok hagyományos mikroszkópos és spektroszkópiás technikákkal végezhet k. A makromolekulák funkcionális tulajdonságai pedig különböz biokémiai és molekuláris biológiai módszerekkel vizsgálhatók. Következtetések levonását a különböz módszerekkel nyert szerkezeti illetve funkcionális információkból nehezíti, hogy az eljárások eltér minta-el készítést igényelnek. Ugyanakkor ezekkel a módszerekkel nagyon kevés információ nyerhet a biológiai molekulák felszínér l, lokális felületi tulajdonságairól, a molekulán belül és a molekulák között ható er kr l. Ezen a téren nagy el relépést jelentett az atomi er mikroszkópia (AFM) kifejlesztése és felhasználása nanoskálájú er mérésekre. A lokális er spektroszkópia segítségével a felület egy jól meghatározott pontján felvesszük az er -

3 távolság függvényt, ahol a távolság alatt a t z-irányú elmozdulását értjük, az er pedig egyenesen arányos a t t hordozó rugólapka elhajlásával. A görbe alakjából és a kezdeti meredekségb l következtethetünk a minta felületi tulajdonságaira (lokális adhézió, deformálhatóság), információkat kaphatunk a a biológiai makromolekulák között fellép er k nagyságáról, egyes kémiai kötések er sségér l. A fent említett tulajdonságok vizsgálata az utóbbi id ben egyre nagyobb hangsúlyt kapott, hiszen ezek a nanoskálán m köd kölcsönhatások határozzák meg az anyagok makroszkópikus tulajdonságait. Így pl. a mikroszkópikus adhézió számos folyamatot nagymértékben befolyásol: a különböz festékek és ragasztók hatékonyságát, a gyógyszerek hatásmechanizmusát. Szintén fontos az anyagok mikroszkópikus rugalmasságának ismerete, mivel ez határozza meg a különböz rendszerek szerkezeti és dinamikus jellemz it. Fontos a különböz makromolekulák között fellép nano- vagy pikonewton nagyságú er k ismerete és tanulmányozása is, mivel minden biológiai, biokémiai folyamatot (DNS replikáció,

4 fehérje szintézis, enzim reakciók, a specifikus és nemspecifikus antigén-antitest komplex kialakulása, stb.) az intermolekuláris er k határoznak meg. Tudjuk, hogy az oldat ionösszetétele befolyásolja a fehérjék szerkezetének stabilitását és felületi tulajdonságait, s ezek közül is leginkább az oldhatóságát. Vannak olyan ionok, amelyek stabilizálják a natív szerkezetet, de csökkentik az oldhatóságot. Ezek általában polárosak és úgy befolyásolják a fehérjéhez kötött víz szerkezetét, hogy az a szerkezet stabilitását fokozza. Ilyenek például a foszfát-ion, szulfát-ion. Más ionok csökkentik a stabilitást és növelik a fehérjemolekulák oldhatóságát, roncsolják a víz térhálós szerkezetét, mint például a tiocianát-ion. A klór-iont semlegesnek tekintjük, ugyanis alig van hatása a víz szerkezetére és M-os koncentráció tartományban a fehérjékre sem gyakorol hatást. A doktori értekezésemben két különböz, de bizonyos pontokon mégis kapcsolódó témával foglalkoztam: fehérjék nanomechanikai tulajdonságainak vizsgálatával és a fehérjéket alkotó alegységek kitekeredéséhez szükséges er meghatározásával. A

5 különböz fehérjéken végzett er -méréseim további kísérletek kiindulópontjául szolgálnak, amelyek arra irányulnak, hogy összefüggést találjunk a fehérjék nanomechanikai és adhéziós tulajdonságainak változásai és a sejtek szerkezetében és m ködésében bekövetkezett változások között. A vizsgált fehérjék fontos szerepet játszanak a szervezetben. Az extracelluláris mátrixot alkotó két nem kollagén-szer fehérje, a laminin-nidogén komplex és a tenascin, kulcsfontosságúak a sejt alakjának meghatározásában, a sejt-sejt közötti adhézióban. Az albumin és a metallothionein ([1], [2]) részt vesznek számos anyag, ligandum, fém szállításában, homeosztázisuk fenntartásában és más folyamatban. A lizozim enzim aktivitással rendelkezik és a szervezet baktériumok elleni védelmében játszik fontos szerepet. A nanomechanikai méréseinkben a lizozimet, mint modell fehérjét használtuk, mivel kis molekulatömeg, globuláris (14kD és 129 aminosavból áll) fehérje, amely kísérleti körülményeink között könnyen letapasztható a szilárd hordózóra (csillámra).

6 Tudományos eredmények 1. Az er -spektroszkópai módszerrel különböz ionösszetétel és ion-er sség oldatokban felvettem az er - elmozdulás görbéket az AFM t mozgási sebességét változtatva. A különböz sebességeken felvett görbék hiszterézisének változásából az alábbi következtetéseket vonhatjuk le: 1.1. Az AFM t mozgási sebességének viszonylag kis tartományában (hozzávet legesen 60 és 280 µm/s közötti tartományban) a fehérje-réteg newtoni folyadékként viselkedik és ebben a tartományban jó közelítéssel alkalmazható Stokes törvénye, amib l a réteg viszkozitását kiszámíthatjuk [3] A viszkozitás az intermolekuláris súrlódás következménye, amely az oldat összetételével változik. Az általam használt ionok esetében a kapott viszkozitás eredmények összhangban vannak a Hofmeister-sorozat ionjainak a fehérjék oldhatóságára és stabilitására gyakorolt makroszkópikus hatásáról leírt megfigyelésekkel.

7 1.3. A viszkozitás legmagasabb értékét a foszfát-ionok jelenlétében figyeltem meg. A Hofmeister sorozatban a foszfát-ionok csökkentik a fehérje molekula oldhatóságát, tehát a fehérje rétegnek valószín leg kisebb lesz a szabad-víz tartalma. Ez megnövelheti a molekulák között adhéziós er t, és ez jelentkezik a viszkozitás növekedésében. Ennek megfelel en, a legalacsonyabb viszkozitást a tiocianát-ion jelenlétében figyeltük meg, amely annak a következménye, hogy több szabadon mozgó vízmolekula került a fehérjerétegbe. A klorid ionok a várakozásunknak megfelel en köztes hatást gyakoroltak A fehérje molekula deformálhatósága, a k p, a tiocianát-ionok jelenlétében a legkisebb, amely összhangban van a destabilizáló hatással, és a legnagyobb a stabilizáló hatású foszfát jelenlétében [3] Laminin esetében nem tudtuk ugyanazt a megközelítést használni a molekularéteg jellemzésére, mint amit a lizozim molekula esetében. A magyarázat az, hogy a fehérjerétegben a

8 molekulák er sen kötött hexagonális térszerkezetet alkotnak, és így a réteg még közelít leg sem viselkedik newtoni folyadékként. 2. A fehérjeláncot alkotó alegységek küls er hatására történ ki/visszatekeredési (folding/unfolding) folyamatai a molekula mechanikai stabilitását jellemzik. Nagyon sok fehérje mechanikai szerepet is betölt az él rendszerekben, ilyenek pl. az izomfehérjék és a sejtvázat ill. a sejtek közötti állományt alkotó fehérjék. Ezért ezen molekulák mechanikai stabilitásának vizsgálata további szerkezeti tulajdonságokkal kapcsolatos információt szolgáltathat. Ezek a fehérjék polipeptid-láncuk jellegzetes "kitekeredésén" keresztül fejtik ki funkcióikat A humán szérum albumin mechanikai er hatására történ ki/visszatekeredési folyamatait vizsgáltuk, meghatározva egy-egy alegység kitekeredéséhez szükséges er nagyságát illetve két csúcs közötti távolságot, amely egy kitekeredett alegység hosszának felel meg Az albumin ph függ konformációs átalakuláson megy keresztül, amely az er méréseken is megfigyelhet. Savas ph-n egy alegység

9 kitekeredéséhez szükséges er és két er csúcs közötti távolság lecsökkent. Ez azzal magyarázható, hogy alacsony ph-n az inter- és intramolekuláris er k átrendez dnek, s a fehérje-lánc konformációja lazább lesz A laminin molekulán mért er -elmozdulás görbék összetettek, hiszen a fehérje több nyújtható alegységbõl áll: (α-helikális régiók, α-helixet és β- lemezkét tartalmazó globuláris alegységek). Így az er -elmozdulás görbék értelmezése bonyolultabb feladat. A görbéken megjelen csúcsok egymástól való távolságának és a hozzájuk tartozó er knek eloszlás-függvényéb l egyértelm en meg lehetett határozni, hogy melyik alegység kitekeredésére jellemz ek a csúcsok [4] A kitekeredési er kre kapott mérési eredményeink alapján megállapítottam, hogy a laminin molekulát alkotó globuláris alegységek átmenetet jelentenek azon struktúrák között, amelyek csak α-helixb l vagy csak β-lemezkékb l állnak.

10 A doktori értekezés téziseihez kapcsolódó közlemények [1] Zs. Szitányi, Cs. Nemes and N. Rozlosnik: "Metallothionein and heavy metal concentration in blood" Microchemical Journal 54, (1996) [2] Zs. Szitányi, Cs. Nemes and N. Rozlosnik. "Lead detoxification: the roles of essential metals and metallothionein" Central European Journal of Enviromental and Occupational Medicine 4 (1), (1998) [3] Cs. Nemes, J.J. Ramsden, N. Rozlosnik "Direct measurement of the viscoelasticity of adsorbed protein layers using atomic force microscopy" Phys. Rev. E. 60(2), R1166-R1169 (1999) [4] Cs. Nemes, J.J. Ramsden, N. Rozlosnik "The unfolding of native laminin investigated by atomic force microscopy" Physica A (2002)

11 Közlemények konferencia kiadványokban [5] Cs. Nemes, J.J. Ramsden, N. Rozlosnik "Direct measurement of nanomechanical properties of thick layer of lysozyme" Polymer Preprint 39(2), (1998) Magyar nyelv közlemények [6] Rozlosnik N., Nemes Cs., Glavák Cs. "Pásztázó er méréses mikroszkópia " Modern fizikai mérések biológusoknak, jegyzet, szerk.: Rozlosnik Noémi (ELTE, 1999) [7] Nemes Cs., Ramsden, J.J., Rozlosnik N. "Atomer -mikroszkópos mérések biológiai alkalmazásai" Fizikai Szemle 2, (2002)

Az élő sejt fizikai Biológiája:

Az élő sejt fizikai Biológiája: Az élő sejt fizikai Biológiája: Modellépítés, biológiai rendszerek skálázódása Kellermayer Miklós Fizikai biológia Ma már nem csak kvalitatív megfigyeléseket, hanem kvantitatív méréseket végzünk (biológiai

Részletesebben

Atomi er mikroszkópia jegyz könyv

Atomi er mikroszkópia jegyz könyv Atomi er mikroszkópia jegyz könyv Zsigmond Anna Julia Fizika MSc III. Mérés vezet je: Szabó Bálint Mérés dátuma: 2010. október 7. Leadás dátuma: 2010. október 20. 1. Mérés leírása A laboratóriumi mérés

Részletesebben

Atomok és molekulák elektronszerkezete

Atomok és molekulák elektronszerkezete Atomok és molekulák elektronszerkezete Szabad atomok és molekulák Schrödinger egyenlete Tekintsünk egy kvantummechanikai rendszert amely N n magból és N e elektronból áll. Koordinátáikat jelölje rendre

Részletesebben

FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest,

FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest, FEHÉRJÉK A MÁGNESEKBEN Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium Alkímia Ma, Budapest, 2013.02.28. I. FEHÉRJÉK: L-α aminosavakból felépülő lineáris polimerek α H 2 N CH COOH amino

Részletesebben

POSZTTRANSZLÁCIÓS MÓDOSÍTÁSOK: GLIKOZILÁLÁSOK

POSZTTRANSZLÁCIÓS MÓDOSÍTÁSOK: GLIKOZILÁLÁSOK POSZTTRANSZLÁCIÓS MÓDOSÍTÁSOK: GLIKOZILÁLÁSOK Dr. Pécs Miklós Budapesti Műszaki és Gazdaságtudományi Egyetem, Alkalmazott Biotechnológia és Élelmiszertudomány Tanszék 1 Glikozilálás A rekombináns fehérjék

Részletesebben

TDK lehetőségek az MTA TTK Enzimológiai Intézetben

TDK lehetőségek az MTA TTK Enzimológiai Intézetben TDK lehetőségek az MTA TTK Enzimológiai Intézetben Vértessy G. Beáta egyetemi tanár TDK mind 1-3 helyezettek OTDK Pro Scientia különdíj 1 második díj Diákjaink Eredményei Zsűri különdíj 2 első díj OTDK

Részletesebben

K68464 OTKA pályázat szakmai zárójelentés

K68464 OTKA pályázat szakmai zárójelentés K68464 OTKA pályázat szakmai zárójelentés A fehérjeaggregáció és amiloidképződés szerkezeti alapjai; a különféle morfológiájú aggregátumok kialakulásának körülményei és in vivo hatásuk vizsgálata Vezető

Részletesebben

Reológia Mérési technikák

Reológia Mérési technikák Reológia Mérési technikák Reológia Testek (és folyadékok) külső erőhatásra bekövetkező deformációját, mozgását írja le. A deformációt irreverzibilisnek nevezzük, ha a az erőhatás megszűnése után a test

Részletesebben

1.7. Felületek és katalizátorok

1.7. Felületek és katalizátorok Mobilitás és Környezet Konferencia Magyar Tudományos Akadémia Budapest, 2012. január 23. 1.7. Felületek és katalizátorok Polimer töltőanyagként alkalmazható agyagásvány nanostruktúrák előállítása Horváth

Részletesebben

Elektrosztatikus számítások. Elektrosztatikus számítások. Elektrosztatikus számítások. Elektrosztatikus számítások Definíciók

Elektrosztatikus számítások. Elektrosztatikus számítások. Elektrosztatikus számítások. Elektrosztatikus számítások Definíciók Jelentősége szubsztrát kötődés szolvatáció ionizációs állapotok (pka) mechanizmus katalízis ioncsatornák szimulációk (szerkezet) all-atom dipolar fluid dipolar lattice continuum Definíciók töltéseloszlás

Részletesebben

Az anyagi rendszer fogalma, csoportosítása

Az anyagi rendszer fogalma, csoportosítása Az anyagi rendszer fogalma, csoportosítása A bemutatót összeállította: Fogarasi József, Petrik Lajos SZKI, 2011 1 1 A rendszer fogalma A körülöttünk levő anyagi világot atomok, ionok, molekulák építik

Részletesebben

Ragyogó molekulák: dióhéjban a fluoreszcenciáról és biológiai alkalmazásairól

Ragyogó molekulák: dióhéjban a fluoreszcenciáról és biológiai alkalmazásairól Ragyogó molekulák: dióhéjban a fluoreszcenciáról és biológiai alkalmazásairól Kele Péter egyetemi adjunktus Lumineszcencia jelenségek Biolumineszcencia (biológiai folyamat, pl. luciferin-luciferáz) Kemilumineszcencia

Részletesebben

Nanotudományok vívmányai a mindennapokban Lagzi István László Eötvös Loránd Tudományegyetem Meteorológiai Tanszék

Nanotudományok vívmányai a mindennapokban Lagzi István László Eötvös Loránd Tudományegyetem Meteorológiai Tanszék Nanotudományok vívmányai a mindennapokban Lagzi István László Eötvös Loránd Tudományegyetem Meteorológiai Tanszék 2011. szeptember 22. Mi az a nano? 1 nm = 10 9 m = 0.000000001 m Nanotudományok: 1-100

Részletesebben

Bio-nanorendszerek. Vonderviszt Ferenc. Pannon Egyetem Nanotechnológia Tanszék

Bio-nanorendszerek. Vonderviszt Ferenc. Pannon Egyetem Nanotechnológia Tanszék Bio-nanorendszerek Vonderviszt Ferenc Pannon Egyetem Nanotechnológia Tanszék Technológia: képesség az anyag szerkezetének, az anyagot felépítő részecskék elrendeződésének befolyásolására. A technológiai

Részletesebben

Az anyagi rendszerek csoportosítása

Az anyagi rendszerek csoportosítása Általános és szervetlen kémia 1. hét A kémia az anyagok tulajdonságainak leírásával, átalakulásaival, elıállításának lehetıségeivel és felhasználásával foglalkozik. Az általános kémia vizsgálja az anyagi

Részletesebben

Farmakológus szakasszisztens Farmakológus szakasszisztens 2/34

Farmakológus szakasszisztens Farmakológus szakasszisztens 2/34 -06 Farmakológus szakasszisztens feladatok A 0/007 (II. 7.) SzMM rendelettel módosított /006 (II. 7.) OM rendelet Országos Képzési Jegyzékről és az Országos Képzési Jegyzékbe történő felvétel és törlés

Részletesebben

Sejtmozgás és adhézió Molekuláris biológia kurzus 8. hét. Kun Lídia Genetikai, Sejt és Immunbiológiai Intézet

Sejtmozgás és adhézió Molekuláris biológia kurzus 8. hét. Kun Lídia Genetikai, Sejt és Immunbiológiai Intézet Sejtmozgás és adhézió Molekuláris biológia kurzus 8. hét Kun Lídia Genetikai, Sejt és Immunbiológiai Intézet Sejtmozgás -amőboid - csillós - kontrakció Sejt adhézió -sejt-ecm -sejt-sejt MOZGÁS A sejtmozgás

Részletesebben

Polimerek fizikai, mechanikai, termikus tulajdonságai

Polimerek fizikai, mechanikai, termikus tulajdonságai SZÉCHENYI ISTVÁN EGYETEM ANYAGISMERETI ÉS JÁRMŰGYÁRTÁSI TANSZÉK POLIMERTECHNIKA NGB_AJ050_1 Polimerek fizikai, mechanikai, termikus tulajdonságai DR Hargitai Hajnalka 2011.10.05. BURGERS FÉLE NÉGYPARAMÉTERES

Részletesebben

AZ ÉLET KÉMIÁJA... ÉLŐ ANYAG SZERVEZETI ALAPEGYSÉGE

AZ ÉLET KÉMIÁJA... ÉLŐ ANYAG SZERVEZETI ALAPEGYSÉGE AZ ÉLET KÉMIÁJA... ÉLŐ ANYAG SZERVEZETI ALAPEGYSÉGE A biológia az élet tanulmányozásával foglalkozik, az élő szervezetekre viszont vonatkoznak a fizika és kémia törvényei MI ÉPÍTI FEL AZ ÉLŐ ANYAGOT? HOGYAN

Részletesebben

Immunológia alapjai előadás. Az immunológiai felismerés molekuláris összetevői.

Immunológia alapjai előadás. Az immunológiai felismerés molekuláris összetevői. Immunológia alapjai 3 4. előadás Az immunológiai felismerés molekuláris összetevői. Az antigén fogalma. Antitestek, T- és B- sejt receptorok: molekuláris szerkezet, funkciók, alcsoportok Az antigén meghatározása

Részletesebben

TRIPSZIN TISZTÍTÁSA AFFINITÁS KROMATOGRÁFIA SEGÍTSÉGÉVEL

TRIPSZIN TISZTÍTÁSA AFFINITÁS KROMATOGRÁFIA SEGÍTSÉGÉVEL TRIPSZIN TISZTÍTÁSA AFFINITÁS KROMATOGRÁFIA SEGÍTSÉGÉVEL Az egyes biomolekulák izolálása kulcsfontosságú a biológiai szerepük tisztázásához. Az affinitás kromatográfia egyszerűsége, reprodukálhatósága

Részletesebben

Az ellenanyagok orvosbiológiai. PhD kurzus 2011/2012 II. félév

Az ellenanyagok orvosbiológiai. PhD kurzus 2011/2012 II. félév Az ellenanyagok orvosbiológiai alkalmazása PhD kurzus 2011/2012 II. félév Ellenanyaggal működő módszerek Analitikai felhasználás Analitikai felhasználás Ellenanyag / antigén kapcsolódás Az Ab/Ag kapcsolat

Részletesebben

Ábragyűjtemény levelező hallgatók számára

Ábragyűjtemény levelező hallgatók számára Ábragyűjtemény levelező hallgatók számára Ez a bemutató a tanszéki Fizika jegyzet kiegészítése Mechanika I. félév 1 Stabilitás Az úszás stabilitása indifferens a stabil, b labilis S súlypont Sf a kiszorított

Részletesebben

TÖBBKOMPONENS RENDSZEREK FÁZISEGYENSÚLYAI IV.

TÖBBKOMPONENS RENDSZEREK FÁZISEGYENSÚLYAI IV. TÖBBKOMPONENS RENDSZEREK FÁZISEGYENSÚLYAI IV. TÖBBFÁZISÚ, TÖBBKOMPONENS RENDSZEREK Kétkomponens szilárd-folyadék egyensúlyok Néhány fogalom: - olvadék - ötvözetek - amorf anyagok Állapotok feltüntetése:

Részletesebben

Atomok. szilárd. elsődleges kölcsönhatás. kovalens ionos fémes. gázok, folyadékok, szilárd anyagok. ionos fémek vegyületek ötvözetek

Atomok. szilárd. elsődleges kölcsönhatás. kovalens ionos fémes. gázok, folyadékok, szilárd anyagok. ionos fémek vegyületek ötvözetek Atomok elsődleges kölcsönhatás kovalens ionos fémes véges számú atom térhálós szerkezet 3D ionos fémek vegyületek ötvözetek molekulák atomrácsos vegyületek szilárd gázok, folyadékok, szilárd anyagok Gázok

Részletesebben

12/4/2014. Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció. 1952 Hershey & Chase 1953!!!

12/4/2014. Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció. 1952 Hershey & Chase 1953!!! Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció 1859 1865 1869 1952 Hershey & Chase 1953!!! 1879 1903 1951 1950 1944 1928 1911 1 1. DNS szerkezete Mi az örökítő anyag? Friedrich Miescher

Részletesebben

Tartalmi követelmények kémia tantárgyból az érettségin K Ö Z É P S Z I N T

Tartalmi követelmények kémia tantárgyból az érettségin K Ö Z É P S Z I N T 1. Általános kémia Atomok és a belőlük származtatható ionok Molekulák és összetett ionok Halmazok A kémiai reakciók A kémiai reakciók jelölése Termokémia Reakciókinetika Kémiai egyensúly Reakciótípusok

Részletesebben

Célkitűzés/témák Fehérje-ligandum kölcsönhatások és a kötődés termodinamikai jellemzése

Célkitűzés/témák Fehérje-ligandum kölcsönhatások és a kötődés termodinamikai jellemzése Célkitűzés/témák Fehérje-ligandum kölcsönhatások és a kötődés termodinamikai jellemzése Ferenczy György Semmelweis Egyetem Biofizikai és Sugárbiológiai Intézet Biokémiai folyamatok - Ligandum-fehérje kötődés

Részletesebben

Biomolekulák nanomechanikája A biomolekuláris rugalmasság alapjai

Biomolekulák nanomechanikája A biomolekuláris rugalmasság alapjai Fogorvosi Anyagtan Fizikai Alapjai Biomolekulák nanomechanikája A biomolekuláris rugalmasság alapjai Mártonfalvi Zsolt Biofizikai és Sugárbiológiai Intézet Semmelweis Egyetem Budapest Biomolekulák mint

Részletesebben

Fehérjeszerkezet, és tekeredés

Fehérjeszerkezet, és tekeredés Fehérjeszerkezet, és tekeredés Futó Kinga 2013.10.08. Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983

Részletesebben

Spektroszkópiai módszerek 2.

Spektroszkópiai módszerek 2. Spektroszkópiai módszerek 2. NMR spektroszkópia magspinek rendeződése külső mágneses tér hatására az eredő magspin nem nulla, ha a magot alkotó nukleonok közül legalább az egyik páratlan a szerves kémiában

Részletesebben

6. változat. 3. Jelöld meg a nem molekuláris szerkezetű anyagot! A SO 2 ; Б C 6 H 12 O 6 ; В NaBr; Г CO 2.

6. változat. 3. Jelöld meg a nem molekuláris szerkezetű anyagot! A SO 2 ; Б C 6 H 12 O 6 ; В NaBr; Г CO 2. 6. változat Az 1-től 16-ig terjedő feladatokban négy válaszlehetőség van, amelyek közül csak egy helyes. Válaszd ki a helyes választ és jelöld be a válaszlapon! 1. Jelöld meg azt a sort, amely helyesen

Részletesebben

A hulladék alapjellemzés során nyert vizsgálati eredmények értelmezési kérdései Dr. Ágoston Csaba

A hulladék alapjellemzés során nyert vizsgálati eredmények értelmezési kérdései Dr. Ágoston Csaba A hulladék alapjellemzés során nyert vizsgálati eredmények értelmezési kérdései Dr. Ágoston Csaba 1 Hulladékvizsgálatok 98/2001 (VI. 15.) Korm. rendelet 20/2006 (IV. 5.) KvVM rendelet Hulladék minősítés

Részletesebben

Sillabusz orvosi kémia szemináriumokhoz 1. Kémiai kötések

Sillabusz orvosi kémia szemináriumokhoz 1. Kémiai kötések Sillabusz orvosi kémia szemináriumokhoz 1. Kémiai kötések Pécsi Tudományegyetem Általános Orvostudományi Kar 2010-2011. 1 A vegyületekben az atomokat kémiai kötésnek nevezett erők tartják össze. Az elektronok

Részletesebben

Biofizika I 2013-2014 2014.12.02.

Biofizika I 2013-2014 2014.12.02. ÁTTEKINTÉS AZ IZOM TÍPUSAI: SZERKEZET és FUNKCIÓ A HARÁNTCSÍKOLT IZOM SZERKEZETE MŰKÖDÉSÉNEK MOLEKULÁRIS MECHANIZMUSA IZOM MECHANIKA Biofizika I. -2014. 12. 02. 03. Dr. Bugyi Beáta PTE ÁOK Biofizikai Intézet

Részletesebben

Az elemeket 3 csoportba osztjuk: Félfémek vagy átmeneti fémek nemfémek. fémek

Az elemeket 3 csoportba osztjuk: Félfémek vagy átmeneti fémek nemfémek. fémek Kémiai kötések Az elemeket 3 csoportba osztjuk: Félfémek vagy átmeneti fémek nemfémek fémek Fémek Szürke színűek, kivétel a színesfémek: arany,réz. Szilárd halmazállapotúak, kivétel a higany. Vezetik az

Részletesebben

Kémiai reakciók mechanizmusa számítógépes szimulációval

Kémiai reakciók mechanizmusa számítógépes szimulációval Kémiai reakciók mechanizmusa számítógépes szimulációval Stirling András stirling@chemres.hu Elméleti Kémiai Osztály Budapest Stirling A. (MTA Kémiai Kutatóközpont) Reakciómechanizmus szimulációból 2007.

Részletesebben

és s alkalmazása Dencs Béla*, Dencs Béláné**, Marton Gyula**

és s alkalmazása Dencs Béla*, Dencs Béláné**, Marton Gyula** Környezetbarát t kemény nyítőszármazékok előáll llítása és s alkalmazása a környezet k védelme v érdekében Dencs Béla*, Dencs Béláné**, Marton Gyula** *Hydra 2002 Kutató, Fejlesztő és Tanácsadó Kft., Veszprém

Részletesebben

Elektromos ellenállás, az áram hatásai, teljesítmény

Elektromos ellenállás, az áram hatásai, teljesítmény Elektromos ellenállás, az áram hatásai, teljesítmény Elektromos ellenállás Az anyag részecskéi akadályozzák a töltések mozgását. Ezt a tulajdonságot nevezzük elektromos ellenállásnak. Annak a fogyasztónak

Részletesebben

1. változat. 4. Jelöld meg azt az oxidot, melynek megfelelője a vas(iii)-hidroxid! A FeO; Б Fe 2 O 3 ; В OF 2 ; Г Fe 3 O 4.

1. változat. 4. Jelöld meg azt az oxidot, melynek megfelelője a vas(iii)-hidroxid! A FeO; Б Fe 2 O 3 ; В OF 2 ; Г Fe 3 O 4. 1. változat z 1-től 16-ig terjedő feladatokban négy válaszlehetőség van, amelyek közül csak egy helyes. Válaszd ki a helyes választ és jelöld be a válaszlapon! 1. Melyik sor fejezi be helyesen az állítást:

Részletesebben

Szalay Péter (ELTE, Kémia Intézet) Szentjánosbogár, trópusi halak, sarki fény Mi a közös a természet fénytüneményeiben?

Szalay Péter (ELTE, Kémia Intézet) Szentjánosbogár, trópusi halak, sarki fény Mi a közös a természet fénytüneményeiben? Szalay Péter (ELTE, Kémia Intézet) Szentjánosbogár, trópusi halak, sarki fény Mi a közös a természet fénytüneményeiben? Boronkay György Műszaki Középiskola és Gimnázium Budapest, 2011. október 27. www.meetthescientist.hu

Részletesebben

tervezési szempontok (igénybevétel, feszültségeloszlás,

tervezési szempontok (igénybevétel, feszültségeloszlás, Elhasználódási és korróziós folyamatok Bagi István BME MTAT Biofunkcionalitás Az élő emberi szervezettel való kölcsönhatás biokompatibilitás (gyulladás, csontfelszívódás, metallózis) aktív biológiai környezet

Részletesebben

Búza tartalékfehérjék mozgásának követése a transzgénikus rizs endospermium sejtjeiben

Búza tartalékfehérjék mozgásának követése a transzgénikus rizs endospermium sejtjeiben TÉMA ÉRTÉKELÉS TÁMOP-4.2.1/B-09/1/KMR-2010-0003 (minden téma külön lapra) 2010. június 1. 2012. május 31. 1. Az elemi téma megnevezése Búza tartalékfehérjék mozgásának követése a transzgénikus rizs endospermium

Részletesebben

NEHÉZFÉMEK ELTÁVOLÍTÁSA IPARI SZENNYVIZEKBŐL Modell kísérletek Cr(VI) alkalmazásával növényi hulladékokból nyert aktív szénen

NEHÉZFÉMEK ELTÁVOLÍTÁSA IPARI SZENNYVIZEKBŐL Modell kísérletek Cr(VI) alkalmazásával növényi hulladékokból nyert aktív szénen NEHÉZFÉMEK ELTÁVOLÍTÁSA IPARI SZENNYVIZEKBŐL Modell kísérletek Cr(VI) alkalmazásával növényi hulladékokból nyert aktív szénen Készítette: Battistig Nóra Környezettudomány mesterszakos hallgató A DOLGOZAT

Részletesebben

Természetes vizek, keverékek mindig tartalmaznak oldott anyagokat! Írd le milyen természetes vizeket ismersz!

Természetes vizek, keverékek mindig tartalmaznak oldott anyagokat! Írd le milyen természetes vizeket ismersz! Összefoglalás Víz Természetes víz. Melyik anyagcsoportba tartozik? Sorolj fel természetes vizeket. Mitől kemény, mitől lágy a víz? Milyen okokból kell a vizet tisztítani? Kémiailag tiszta víz a... Sorold

Részletesebben

Általános és szervetlen kémia 1. hét

Általános és szervetlen kémia 1. hét Általános és szervetlen kémia 1. hét A tantárgy elméleti és gyakorlati anyaga http://cheminst.emk.nyme.hu A CAPA teszt-gyakorló program használata Kliens programot letölteni a weboldalról Bejelentkezés

Részletesebben

KÉMIA A KÉMIÁT SZERETŐK SZÁMÁRA

KÉMIA A KÉMIÁT SZERETŐK SZÁMÁRA XXI. Századi Közoktatás (fejlesztés, koordináció) II. szakasz TÁMOP-3.1.1-11/1-2012-0001 KÉMIA A KÉMIÁT SZERETŐK SZÁMÁRA A művelődési anyag tematikájának összeállítása a Nemzeti Alaptanterv és a kapcsolódó

Részletesebben

BIOMOLEKULÁK KÉMIÁJA. Novák-Nyitrai-Hazai

BIOMOLEKULÁK KÉMIÁJA. Novák-Nyitrai-Hazai BIOMOLEKULÁK KÉMIÁJA Novák-Nyitrai-Hazai A tankönyv elsısorban szerves kémiai szempontok alapján tárgyalja az élı szervezetek felépítésében és mőködésében kulcsfontosságú szerves vegyületeket. A tárgyalás-

Részletesebben

A TÖMEGSPEKTROMETRIA ALAPJAI

A TÖMEGSPEKTROMETRIA ALAPJAI A TÖMEGSPEKTROMETRIA ALAPJAI web.inc.bme.hu/csonka/csg/oktat/tomegsp.doc alapján tömeg-töltés arány szerinti szétválasztás a legérzékenyebb módszerek közé tartozik (Nagyon kis anyagmennyiség kimutatására

Részletesebben

egyetemi tanár Nyugat-Magyarországi Egyetem

egyetemi tanár Nyugat-Magyarországi Egyetem egyetemi tanár Nyugat-Magyarországi Egyetem Folyadékok szerkezeti jellemz i Az el adás témakörei: Mit nevezünk folyadéknak? - részecskék kölcsönhatása, rendezettsége - mechanikai viselkedése alapján A

Részletesebben

Az áramlási citométer és sejtszorter felépítése és működése, diagnosztikai alkalmazásai

Az áramlási citométer és sejtszorter felépítése és működése, diagnosztikai alkalmazásai Az áramlási citométer és sejtszorter felépítése és működése, diagnosztikai alkalmazásai Az áramlási citométer és sejtszorter felépítése és működése Kereskedelmi forgalomban kapható készülékek 1 Fogalmak

Részletesebben

Modern fizika laboratórium

Modern fizika laboratórium Modern fizika laboratórium Röntgen-fluoreszcencia analízis Készítette: Básti József és Hagymási Imre 1. Bevezetés A röntgen-fluoreszcencia analízis (RFA) egy roncsolásmentes anyagvizsgálati módszer. Rövid

Részletesebben

NÖVÉNYÉLETTAN. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010

NÖVÉNYÉLETTAN. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 NÖVÉNYÉLETTAN Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 Sejtfal szintézis és megnyúlás Környezeti tényezők hatása a növények növekedésére és fejlődésére Előadás áttekintése

Részletesebben

Adatgyűjtés, mérési alapok, a környezetgazdálkodás fontosabb műszerei

Adatgyűjtés, mérési alapok, a környezetgazdálkodás fontosabb műszerei Tudományos kutatásmódszertani, elemzési és közlési ismeretek modul Gazdálkodási modul Gazdaságtudományi ismeretek I Közgazdasá Adatgyűjtés, mérési alapok, a környezetgazdálkodás fontosabb műszerei KÖRNYEZETGAZDÁLKODÁSI

Részletesebben

A fehérjék harmadlagos vagy térszerkezete. Még a globuláris fehérjék térszerkezete is sokféle lehet.

A fehérjék harmadlagos vagy térszerkezete. Még a globuláris fehérjék térszerkezete is sokféle lehet. A fehérjék harmadlagos vagy térszerkezete Még a globuláris fehérjék térszerkezete is sokféle lehet. A ribonukleáz redukciója és denaturálódása Chrisian B. Anfinsen A ribonukleáz renaturálódása 1972 obel-díj

Részletesebben

3D bútorfrontok (előlapok) gyártása

3D bútorfrontok (előlapok) gyártása 3D bútorfrontok (előlapok) gyártása 1 2 3 4 5 6 7 8 9 MDF lapok vágása Marás rakatolás Tisztítás Ragasztófelhordás 3D film laminálás Szegély eltávolítása Tisztítás Kész bútorfront Membránpréses kasírozás

Részletesebben

A II. kategória Fizika OKTV mérési feladatainak megoldása

A II. kategória Fizika OKTV mérési feladatainak megoldása Nyomaték (x 0 Nm) O k t a t á si Hivatal A II. kategória Fizika OKTV mérési feladatainak megoldása./ A mágnes-gyűrűket a feladatban meghatározott sorrendbe és helyre rögzítve az alábbi táblázatban feltüntetett

Részletesebben

Evolúcióelmélet és az evolúció mechanizmusai

Evolúcióelmélet és az evolúció mechanizmusai Evolúcióelmélet és az evolúció mechanizmusai Az élet Darwini szemlélete Melyek az evolúció bizonyítékai a világban? EVOLÚCIÓ: VÁLTOZATOSSÁG Mutáció Horizontális géntranszfer Genetikai rekombináció Rekombináció

Részletesebben

Kerámia, üveg és fém-kerámia implantátumok

Kerámia, üveg és fém-kerámia implantátumok Kerámia, üveg és fém-kerámia implantátumok Bagi István BME MTAT Bevezetés Kerámiák csoportosítása teljesen tömör bioinert porózus bioinert teljesen tömör bioaktív oldódó Definíciók Bioinert a szomszédos

Részletesebben

Helyi tanterv a kémia. tantárgy oktatásához

Helyi tanterv a kémia. tantárgy oktatásához Helyi tanterv a kémia. tantárgy oktatásához 1. A tanterv szerzıi: Név szerint ki, vagy kik készítették 2. Óraszámok: 9. osztály 36.. óra (humán) 10. osztály óra 11. osztály -.óra 12. osztály -.óra SZAKKÖZÉPISKOLA

Részletesebben

Kész polimerek reakciói. Makromolekulák átalakítása. Makromolekulák átalakítása. Természetes és mesterséges makromolekulák átalakítása cellulóz, PVAc

Kész polimerek reakciói. Makromolekulák átalakítása. Makromolekulák átalakítása. Természetes és mesterséges makromolekulák átalakítása cellulóz, PVAc Kész polimerek reakciói 8. hét Természetes és mesterséges makromolekulák átalakítása cellulóz, PVAc szabad funkciós csoportok reakciói bomlási folyamatok Térhálósítási folyamatok A cellulóz szabad alkoholos

Részletesebben

Modern Fizika Labor. Fizika BSc. Értékelés: A mérés dátuma: A mérés száma és címe: 5. mérés: Elektronspin rezonancia. 2008. március 18.

Modern Fizika Labor. Fizika BSc. Értékelés: A mérés dátuma: A mérés száma és címe: 5. mérés: Elektronspin rezonancia. 2008. március 18. Modern Fizika Labor Fizika BSc A mérés dátuma: 28. március 18. A mérés száma és címe: 5. mérés: Elektronspin rezonancia Értékelés: A beadás dátuma: 28. március 26. A mérést végezte: 1/7 A mérés leírása:

Részletesebben

Konferencia a tapasztalatok jegyében

Konferencia a tapasztalatok jegyében Konferencia a tapasztalatok jegyében 2010. november Dornbach Ildikó szakmai igazgató Új biológia, új fizika, régi beidegzések Edzőink felbecsülhetetlen értékű tevékenysége Köztársasági Érdemrendet minden

Részletesebben

Az elektromos kettősréteg. Az elektromos potenciálkülönbség eredete, értéke és az azt befolyásoló tényezők. Kolloidok stabilitása.

Az elektromos kettősréteg. Az elektromos potenciálkülönbség eredete, értéke és az azt befolyásoló tényezők. Kolloidok stabilitása. Az elektromos kettősréteg. Az elektromos potenciálkülönbség eredete, értéke és az azt befolyásoló tényezők. Kolloidok stabilitása. Adszorpció oldatból szilárd felületre Adszorpció oldatból Nem-elektrolitok

Részletesebben

Mérés: Millikan olajcsepp-kísérlete

Mérés: Millikan olajcsepp-kísérlete Mérés: Millikan olajcsepp-kísérlete Mérés célja: 1909-ben ezt a mérést Robert Millikan végezte el először. Mérése során meg tudta határozni az elemi részecskék töltését. Ezért a felfedezéséért Nobel-díjat

Részletesebben

Szentjánosbogár, trópusi halak, sarki fény Mi a közös a természet fénytüneményeiben?

Szentjánosbogár, trópusi halak, sarki fény Mi a közös a természet fénytüneményeiben? Szentjánosbogár, trópusi halak, sarki fény Mi a közös a természet fénytüneményeiben? Szalay Péter egyetemi tanár ELTE, Kémiai Intézet Elméleti Kémiai Laboratórium Van közös bennük? Egy kis történelem

Részletesebben

PhD beszámoló. 2015/16, 2. félév. Novotny Tamás. Óbudai Egyetem, június 13.

PhD beszámoló. 2015/16, 2. félév. Novotny Tamás. Óbudai Egyetem, június 13. PhD beszámoló 2015/16, 2. félév Novotny Tamás Óbudai Egyetem, 2016. június 13. Tartalom Tézisek Módszer bemutatása Hidrogénezés A hidrogénezett minták gyűrűtörő vizsgálatai Eredmények Konklúzió 2 Tézisek

Részletesebben

Flagellin alapú filamentáris nanoszerkezetek létrehozása

Flagellin alapú filamentáris nanoszerkezetek létrehozása Flagellin alapú filamentáris nanoszerkezetek létrehozása Vonderviszt Ferenc PE MÜKKI Bio-Nanorendszerek Laboratórium MTA Enzimológiai Intézete MTA MFA Bakteriális flagellumok Flagelláris filamentum: ~10

Részletesebben

Modern Fizika Labor. Fizika BSc. Értékelés: A mérés dátuma: A mérés száma és címe: 12. mérés: Infravörös spektroszkópia. 2008. május 6.

Modern Fizika Labor. Fizika BSc. Értékelés: A mérés dátuma: A mérés száma és címe: 12. mérés: Infravörös spektroszkópia. 2008. május 6. Modern Fizika Labor Fizika BSc A mérés dátuma: A mérés száma és címe: 12. mérés: Infravörös spektroszkópia Értékelés: A beadás dátuma: 28. május 13. A mérést végezte: 1/5 A mérés célja A mérés célja az

Részletesebben

Szakértesítő 1 Interkerám szakmai füzetek A folyósító szerek viselkedése a kerámia anyagokban

Szakértesítő 1 Interkerám szakmai füzetek A folyósító szerek viselkedése a kerámia anyagokban Szakértesítő 1 Interkerám szakmai füzetek A folyósító szerek viselkedése a kerámia anyagokban A folyósító szerek viselkedése a kerámia anyagokban Bevezetés A kerámia masszák folyósításkor fő cél az anyag

Részletesebben

Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek

Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek Hidroxikarbonsavak α-hidroxi karbonsavak -Glikolsav (kézkrémek) - Tejsav (tejtermékek, izomláz, fogszuvasodás) - Citromsav (citrusfélékben,

Részletesebben

A biológiai mozgás molekuláris mechanizmusai

A biológiai mozgás molekuláris mechanizmusai BIOLÓGIAI MOZGÁSOK A biológiai mozgás molekuláris mechanizmusai Kollektív mozgás Szervezet mozgása ( Az évszázad ugrása ) Szerv mozgás BIOLÓGIAI MOZGÁSOK BIOLÓGIAI MOZGÁSOK Ritmusosan összehúzódó szívizomsejt

Részletesebben

A kémiatanári zárószigorlat tételsora

A kémiatanári zárószigorlat tételsora 1. A. tétel A kémiatanári zárószigorlat tételsora Kémiai alapfogalmak: Atom- és molekulatömeg, anyagmennyiség, elemek és vegyületek elnevezése, jelölése. Kémiai egyenlet, sztöchiometria. A víz jelentősége

Részletesebben

Lótuszvirág effektuson alapuló öntisztuló felületek képzésére alkalmas vízbázisú bevonat

Lótuszvirág effektuson alapuló öntisztuló felületek képzésére alkalmas vízbázisú bevonat Lótuszvirág effektuson alapuló öntisztuló felületek képzésére alkalmas vízbázisú bevonat Nanocolltech Kft. Jól ismert, hogy a lótuszvirág levelét és virágát a víz és más folyadékok nem nedvesítik, olyan

Részletesebben

Molekuláris dinamika. 10. előadás

Molekuláris dinamika. 10. előadás Molekuláris dinamika 10. előadás Mirőlis szól a MD? nagy részecskeszámú rendszerek ismerjük a törvényeket mikroszkópikus szinten? Hogyan tudjuk megérteni a folyadékok, gázok, szilárdtestek makroszkópikus

Részletesebben

Citoszkeleton. Sejtek rugalmassága. Polimer mechanika: Hooke-rugalmasság. A citoszkeleton filamentumai. Fogászati anyagtan fizikai alapjai 12.

Citoszkeleton. Sejtek rugalmassága. Polimer mechanika: Hooke-rugalmasság. A citoszkeleton filamentumai. Fogászati anyagtan fizikai alapjai 12. Fogászati anyagtan fizikai alapjai 12. Sejtek rugalmassága Citoszkeleton Eukariota sejtek dinamikus vázrendszere Három fő filamentum-osztály: A. Vékony (aktin) B. Intermedier C. Mikrotubulus Polimerizáció:

Részletesebben

Modern Fizika Labor Fizika BSC

Modern Fizika Labor Fizika BSC Modern Fizika Labor Fizika BSC A mérés dátuma: 2009. május 4. A mérés száma és címe: 9. Röntgen-fluoreszencia analízis Értékelés: A beadás dátuma: 2009. május 13. A mérést végezte: Márton Krisztina Zsigmond

Részletesebben

Sztöchiometriai egyenletrendszerek minimális számú aktív változót tartalmazó megoldásainak meghatározása a P-gráf módszertan alkalmazásával

Sztöchiometriai egyenletrendszerek minimális számú aktív változót tartalmazó megoldásainak meghatározása a P-gráf módszertan alkalmazásával Sztöchiometriai egyenletrendszerek minimális számú aktív változót tartalmazó megoldásainak meghatározása a P-gráf módszertan alkalmazásával * Pannon Egyetem, M szaki Informatikai Kar, Számítástudomány

Részletesebben

A borok tisztulása (kolloid tulajdonságok)

A borok tisztulása (kolloid tulajdonságok) A borok tisztulása (kolloid tulajdonságok) Tisztasági problémák a borban Áttetszőség fogyasztói elvárás, különösen a fehérborok esetében Zavarosságok: 1. bor felületén (pl. hártya); 2. borban szétszórtan

Részletesebben

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin.

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin. Myoglobin Fehérje-szerkezetek! MGLSDGEWQLVLNVWGKVEADIPGGQEVLIRLFK GPETLEKFDKFKLKSEDEMKASE DLKKGATVLTALGGILKKKGEAEIKPLAQSA TKKIPVKYLEFISECIIQVLQSK PGDFGADAQGAMNKALELFRKDMASNYKELGFQG Fuxreiter Mónika! Debreceni

Részletesebben

Adatgyőjtés, mérési alapok, a környezetgazdálkodás fontosabb mőszerei

Adatgyőjtés, mérési alapok, a környezetgazdálkodás fontosabb mőszerei GazdálkodásimodulGazdaságtudományismeretekI.Közgazdaságtan KÖRNYEZETGAZDÁLKODÁSIMÉRNÖKIMScTERMÉSZETVÉDELMIMÉRNÖKIMSc Tudományos kutatásmódszertani, elemzési és közlési ismeretek modul Adatgyőjtés, mérési

Részletesebben

Géprajz - gépelemek. Előadó: Németh Szabolcs mérnöktanár. Belső használatú jegyzet 2

Géprajz - gépelemek. Előadó: Németh Szabolcs mérnöktanár. Belső használatú jegyzet  2 Géprajz - gépelemek FELÜLETI ÉRDESSÉG Előadó: Németh Szabolcs mérnöktanár Belső használatú jegyzet http://gepesz-learning.shp.hu 1 Felületi érdesség Az alkatrészek elkészítéséhez a rajznak tartalmaznia

Részletesebben

Hogyan lesznek új gyógyszereink? Bevezetés a gyógyszerkutatásba

Hogyan lesznek új gyógyszereink? Bevezetés a gyógyszerkutatásba Hogyan lesznek új gyógyszereink? Bevezetés a gyógyszerkutatásba Keserű György Miklós, PhD, DSc Magyar Tudományos Akadémia Természettudományi Kutatóközpont A gyógyszerkutatás folyamata Megalapozó kutatások

Részletesebben

VIDÉKFEJLESZTÉSI MINISZTÉRIUM. Petrik Lajos Két Tanítási Nyelvű Vegyipari, Környezetvédelmi és Informatikai Szakközépiskola

VIDÉKFEJLESZTÉSI MINISZTÉRIUM. Petrik Lajos Két Tanítási Nyelvű Vegyipari, Környezetvédelmi és Informatikai Szakközépiskola A versenyző kódja:... VIDÉKFEJLESZTÉSI MINISZTÉRIUM Petrik Lajos Két Tanítási Nyelvű Vegyipari, Környezetvédelmi és Informatikai Szakközépiskola Budapest, Thököly út 48-54. XV. KÖRNYEZETVÉDELMI ÉS VÍZÜGYI

Részletesebben

A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA

A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA 2013.10.09. CITOSZKELETON - DEFINÍCIÓ Fehérjékből felépülő, a sejt vázát alkotó intracelluláris rendszer. Eukarióta és prokarióta sejtekben egyaránt megtalálható.

Részletesebben

Modern Fizika Labor. A mérés száma és címe: A mérés dátuma: Értékelés: Infravörös spektroszkópia. A beadás dátuma: A mérést végezte:

Modern Fizika Labor. A mérés száma és címe: A mérés dátuma: Értékelés: Infravörös spektroszkópia. A beadás dátuma: A mérést végezte: Modern Fizika Labor A mérés dátuma: 2005.10.26. A mérés száma és címe: 12. Infravörös spektroszkópia Értékelés: A beadás dátuma: 2005.11.09. A mérést végezte: Orosz Katalin Tóth Bence 1 A mérés során egy

Részletesebben

INTERFERONI GAMMA-1B SOLUTIO CONCENTRATA. Tömény gamma-1b-interferon-oldat

INTERFERONI GAMMA-1B SOLUTIO CONCENTRATA. Tömény gamma-1b-interferon-oldat 01/2008:1440 javított 7.0 INTERFERONI GAMMA-1B SOLUTIO CONCENTRATA Tömény gamma-1b-interferon-oldat C 734 H 1166 N 204 O 216 S 5 M r 16 465 DEFINÍCIÓ A tömény gamma-1b-interferon-oldat a gamma interferon

Részletesebben

SZENNYVÍZKEZELÉS NAGYHATÉKONYSÁGÚ OXIDÁCIÓS ELJÁRÁSSAL

SZENNYVÍZKEZELÉS NAGYHATÉKONYSÁGÚ OXIDÁCIÓS ELJÁRÁSSAL SZENNYVÍZKEZELÉS NAGYHATÉKONYSÁGÚ OXIDÁCIÓS ELJÁRÁSSAL Kander Dávid Környezettudomány MSc Témavezető: Dr. Barkács Katalin Konzulens: Gombos Erzsébet Tartalom Ferrát tulajdonságainak bemutatása Ferrát optimális

Részletesebben

Mikrohullámú abszorbensek vizsgálata 4. félév

Mikrohullámú abszorbensek vizsgálata 4. félév Óbudai Egyetem Anyagtudományok és Technológiák Doktori Iskola Mikrohullámú abszorbensek vizsgálata 4. félév Balla Andrea Témavezetők: Dr. Klébert Szilvia, Dr. Károly Zoltán MTA Természettudományi Kutatóközpont

Részletesebben

Módszer az ASEA-ban található reaktív molekulák ellenőrzésére

Módszer az ASEA-ban található reaktív molekulák ellenőrzésére Módszer az ASEA-ban található reaktív molekulák ellenőrzésére Az ASEA-ban található reaktív molekulák egy komplex szabadalmaztatott elektrokémiai folyamat, mely csökkenti és oxidálja az alap sóoldatot,

Részletesebben

ATOMEMISSZIÓS SPEKTROSZKÓPIA

ATOMEMISSZIÓS SPEKTROSZKÓPIA ATOMEMISSZIÓS SPEKTROSZKÓPIA Elvi jellemzők, amelyek meghatározzák a készülék felépítését magas hőmérsékletű fényforrás (elsősorban plazma, szikra, stb.) kis méretű sugárforrás (az önabszorpció csökkentése

Részletesebben

2012.11.27. Neuronok előkészítése funkcionális vizsgálatokra. Az alkalmazható technikák előnyei és hátrányai. Neuronok izolálása I

2012.11.27. Neuronok előkészítése funkcionális vizsgálatokra. Az alkalmazható technikák előnyei és hátrányai. Neuronok izolálása I Neuronok előkészítése funkcionális vizsgálatokra. Az alkalmazható technikák előnyei és hátrányai Sejtszintű elektrofiziológia 1.: csatornák funkcionális Sejtszintű elektrofiziológia 2.: izolált/sejtkultúrában

Részletesebben

Immunológiai módszerek a klinikai kutatásban

Immunológiai módszerek a klinikai kutatásban Immunológiai módszerek a klinikai kutatásban 3. előadás Az immunrendszer molekuláris elemei: antigén, ellenanyag, Ig osztályok Az antigén meghatározása Detre László: antitest generátor - Régi meghatározás:

Részletesebben

Pásztázó mikroszkópiás módszerek

Pásztázó mikroszkópiás módszerek Pásztázó mikroszkópiás módszerek - Pásztázó alagútmikroszkóp, Scanning tunneling microscope, STM - Pászázó elektrokémiai mikroszkóp, Scanning electrochemical microscopy, SECM - pásztázó közeli mező optikai

Részletesebben

Anaerob fermentált szennyvíziszap jellemzése enzimaktivitás-mérésekkel

Anaerob fermentált szennyvíziszap jellemzése enzimaktivitás-mérésekkel Eötvös Loránd Tudományegyetem Természettudományi Kar Környezettudományi Centrum Anaerob fermentált szennyvíziszap jellemzése enzimaktivitás-mérésekkel készítette: Felföldi Edit környezettudomány szakos

Részletesebben

Mikrohullámú abszorbensek vizsgálata

Mikrohullámú abszorbensek vizsgálata Óbudai Egyetem Anyagtudományok és Technológiák Doktori Iskola Mikrohullámú abszorbensek vizsgálata Balla Andrea Témavezetők: Dr. Klébert Szilvia, Dr. Károly Zoltán MTA Természettudományi Kutatóközpont

Részletesebben

T I T - M T T. Hevesy György Kémiaverseny. A megyei forduló feladatlapja. 7. osztály. A versenyző jeligéje:... Megye:...

T I T - M T T. Hevesy György Kémiaverseny. A megyei forduló feladatlapja. 7. osztály. A versenyző jeligéje:... Megye:... T I T - M T T Hevesy György Kémiaverseny A megyei forduló feladatlapja 7. osztály A versenyző jeligéje:... Megye:... Elért pontszám: 1. feladat:... pont 2. feladat:... pont 3. feladat:... pont 4. feladat:...

Részletesebben

ALKÍMIA MA Az anyagról mai szemmel, a régiek megszállottságával. www.chem.elte.hu/pr

ALKÍMIA MA Az anyagról mai szemmel, a régiek megszállottságával. www.chem.elte.hu/pr ALKÍMIA MA Az anyagról mai szemmel, a régiek megszállottságával www.chem.elte.hu/pr Kvíz az előző előadáshoz 1) Mikor kapott Paul Ehrlich orvosi Nobel-díjat? A) Idén. B) Pont 100 éve, 1908-ban. C) Nem

Részletesebben

Molekuláris biológiai eljárások alkalmazása a GMO analitikában és az élelmiszerbiztonság területén

Molekuláris biológiai eljárások alkalmazása a GMO analitikában és az élelmiszerbiztonság területén Molekuláris biológiai eljárások alkalmazása a GMO analitikában és az élelmiszerbiztonság területén Dr. Dallmann Klára A molekuláris biológia célja az élőlények és sejtek működésének molekuláris szintű

Részletesebben

Dózis-válasz görbe A dózis válasz kapcsolat ábrázolása a legáltalánosabb módja annak, hogy bemutassunk eredményeket a tudományban vagy a klinikai

Dózis-válasz görbe A dózis válasz kapcsolat ábrázolása a legáltalánosabb módja annak, hogy bemutassunk eredményeket a tudományban vagy a klinikai Dózis-válasz görbe A dózis válasz kapcsolat ábrázolása a legáltalánosabb módja annak, hogy bemutassunk eredményeket a tudományban vagy a klinikai gyakorlatban. Például egy kísérletben növekvő mennyiségű

Részletesebben