Biokémiai kutatások ma

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "Biokémiai kutatások ma"

Átírás

1 Nyitray László Biokémiai Tanszék Hb Biokémiai kutatások ma Makromolekulák szerkezet-funkció kutatása Molekuláris biológia minden szinten Redukcionista molekuláris biológia vs. holisztikus rendszerbiológia ( omika tudományok) Molekuláris gépezetek Riboszóma (Nobel-díj 2009) Motorfehérjék (egyedi molekula vizsgálatok is!) Repliszóma, nukleoszóma, apoptoszóma, egyéb komplexek Molekuláris kölcsönhatások in vitro és in vivo Fehérje-fehérje interakciók (PPI) és gyógyszertervezés A molekuláris szignalizáció logikája (Nobel-díj 2012) Molekuláris vizualizáció GFP ( hiszem, ha látom ; Nobel-díj 2008) 1

2 Molekuláris információ kutatása Centrális dogma: DNS (3,2 Gbp) RNS fehérje Replikáció, Transzkripció, Transzláció Posztranszkripciós módosulások ~21 ezer gén, de > fehérje Fehérjék feltekeredése (folding) Spontán folyamat!!! (Anfinsen kísérlet) Sok szerkezet nélküli fehérje! (IDP) Rossz feltekeredés: amiloid-betegségek Biokémiai Tanszék kutatásai Dosztányi Zsuzsa: Lineáris fehérjemotívumok bioinformatikája Gyimesi Máté: DNS-helikázok működése Kardos József: Amiloid aggregátumok Kovács Mihály: Motorfehérjék (miozinok, DNS-helikázok) Málnási Csizmadia András: Motorfehérjék és gyógyszer mellékhatások (bioinformatika) 2

3 Biokémiai Tanszék kutatásai Mike Árpád: Opto-farmakológia, neuronális Na + -csatornák gátlása Nyitray László: Fehérje-fehérje kölcsönhatások (motorfehérjék, Ca 2+ -kötő fehérjék) Pál Gábor : Irányított fehérje-evolúció (szerin-proteázok) Venekei István: Rovar patogén proteázok Biokémiai Tanszék e-tankönyvek A biokémia és a molekuláris biológia alapjai Bevezetés a biokémiába gyakorlat Introduction to Practical Biochemistry Géntechnológia és fehérjemérnökség Elérhetőség: (e-learning tananyagok) 3

4 Biokémiai Tanszék műszerek és módszerek Géntechnológiai, fehérje szeparációs és analitikai, fehérjekristályosító laboratóriumok: Fluoreszcens spektroszkópiai és gyorskinetikai laboratórium : Biokémiai Tanszék műszerek és módszerek Molekuláris kölcsönhatás laboratórium In vitro evolúciós laboratórium : 4

5 Replikáció DNS pol.-áz III DnaB helikáz DnaG primáz Molekuláris grafikai animáció: ld. A biokémia és a molekuláris biológia alapjai e-jegyzet γ/τ csuszka loader vezető szál β csuszka DNS pol.-áz III SSB Repliszóma Arthur Kornberg, Nobel-díj 1959 követő szál E. Coli repliszóma DNS csuszka ( kapocs ) Transzkipció Molekuláris grafikai animáció: ld. A biokémia és a molekuláris biológia alapjai e-jegyzet R. Kornberg: Nobel-díj, 2006 RNS-polimeráz II és α-amanitin 5

6 Riboszóma: a Nobel-díjas gépezet Prokarióta riboszóma kis alegység (30 S) Prokarióta riboszóma nagy alegység (50 S) Prokarióta (70 S): 2 MDa (50 S + 30 S) Eukarióta (80 S): 3,2 Mda (60 S + 40 S) V. Ramakrishnan Thomas Steitz Ada Yonath (2009) A riboszóma működés közben Molekuláris grafikai animáció: ld. A biokémia és a molekuláris biológia alapjai e-jegyzet A sejtek legősibb molekuláris gépezete Fehérjeszintézis gátló antibiotikumok sztreptomicin, higromicin, tetraciklin, kloramfenikol, eritromicin 6

7 Egy receptor működés közben Robert Lefkowitz Brian Kobilka β-adrenerg receptor (GPCR) ligandum heterotrimer G- fehérje komplex (Nobel-díj 2012) Miozin: az izom motorja 7

8 GFP, a Nobel-díjas fehérje (2008) Osamu Shimomura Martin Chalfie Roger Y. Tsien Aequorea victoria Ca 2+ + aequorin (coelenterazine prosztetikus csoport) bioluminszcencia (kék fény) GFP: intrinszik fluoreszcens fehérje 8

9 Green Fluorescence Protein 27 kd (238 as.), -hordó szerkezet Ser65-Tyr66-Gly67: autokatalitikus oxidáció Kromofór: p-hidroxibenzilidén-imidazolidon Mutációkkal más színek is GFP származékok S65T + F64L (egfp): stabilabb fluorofór BFC, YFP, CFP, RFP stb. 9

10 Esettanulmány: S100A4 (metasztazin) fehérje-fehérje kölcsönhatásai Ca 2+ -kötő fehérje EF-kéz fehérje szupercsalád tagja, ld. kalmodulin Gerinces-specifikus fehérjecsalád (12 kd) PPI-ken keresztül szabályoz fehérjéket Metasztázis-asszociált fehérje Metasztázis folyamatainak (angiogenezis, sejtmigráció, sejtinvázió) fokozása Intracelluláris funkció: nem-izom miozin (NMIIA) gátlása és ezáltal sejtmigráció szabályozása Extracelluláris funkció: mátrix metalloproteázok aktiválása ezáltal sejtinvázió NM miozin IIA szerepe a sejtmotilitásban A sejtmigráció kuplungja 10

11 S100A4 szerepe a sejtmotilitásban Makrofág kemotaxis S100A4 KO egér Li et al Bresnick: MBC, 2010 S100A4: Ca 2+ -kötés H2 H1 H2 H3 H1 Loop2 H3 H4 H4 2 EF-kéz motívum alegységenként Ca 2+ -kötés hélix átrendeződés, hidrofób kötőfelszín 11

12 S100A4 miozin IIA komplex térszerkezete S100A: gyógyszertervezési célfehérje! Powering the Cell: Mitochondria Molekuláris grafikai animáció: https://www.youtube.com/watch?v=rrs2uroujk4 12

ALKÍMIA MA Az anyagról mai szemmel, a régiek megszállottságával. www.chem.elte.hu/pr

ALKÍMIA MA Az anyagról mai szemmel, a régiek megszállottságával. www.chem.elte.hu/pr ALKÍMIA MA Az anyagról mai szemmel, a régiek megszállottságával www.chem.elte.hu/pr Kvíz az előző előadáshoz 1) Mikor kapott Paul Ehrlich orvosi Nobel-díjat? A) Idén. B) Pont 100 éve, 1908-ban. C) Nem

Részletesebben

Fehérjeszerkezet, és tekeredés

Fehérjeszerkezet, és tekeredés Fehérjeszerkezet, és tekeredés Futó Kinga 2013.10.08. Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983

Részletesebben

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Azonosító szám: TÁMOP-4.1.2-08/1/A-2009-0011 Az orvosi

Részletesebben

TDK lehetőségek az MTA TTK Enzimológiai Intézetben

TDK lehetőségek az MTA TTK Enzimológiai Intézetben TDK lehetőségek az MTA TTK Enzimológiai Intézetben Vértessy G. Beáta egyetemi tanár TDK mind 1-3 helyezettek OTDK Pro Scientia különdíj 1 második díj Diákjaink Eredményei Zsűri különdíj 2 első díj OTDK

Részletesebben

A polipeptidlánc szabályozott lebontása: mit mondanak a fehérjekristályok? Harmat Veronika ELTE Kémiai Intézet, Szerkezeti Kémia és Biológia Laboratórium MTA-ELTE Fehérjemodellező Kutatócsoport A magyar

Részletesebben

A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA

A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA 2013.10.09. CITOSZKELETON - DEFINÍCIÓ Fehérjékből felépülő, a sejt vázát alkotó intracelluláris rendszer. Eukarióta és prokarióta sejtekben egyaránt megtalálható.

Részletesebben

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin.

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin. Myoglobin Fehérje-szerkezetek! MGLSDGEWQLVLNVWGKVEADIPGGQEVLIRLFK GPETLEKFDKFKLKSEDEMKASE DLKKGATVLTALGGILKKKGEAEIKPLAQSA TKKIPVKYLEFISECIIQVLQSK PGDFGADAQGAMNKALELFRKDMASNYKELGFQG Fuxreiter Mónika! Debreceni

Részletesebben

Hamar Péter. RNS világ. Lánczos Kornél Gimnázium, Székesfehérvár, 2014. október 21. www.meetthescientist.hu 1 26

Hamar Péter. RNS világ. Lánczos Kornél Gimnázium, Székesfehérvár, 2014. október 21. www.meetthescientist.hu 1 26 Hamar Péter RNS világ Lánczos Kornél Gimnázium, Székesfehérvár, 2014. október 21. 1 26 Főszereplők: DNS -> RNS -> fehérje A kód lefordítása Dezoxy-ribo-Nuklein-Sav: DNS az élet kódja megkettőződés (replikáció)

Részletesebben

DNS replikáció. DNS RNS Polipeptid Amino terminus. Karboxi terminus. Templát szál

DNS replikáció. DNS RNS Polipeptid Amino terminus. Karboxi terminus. Templát szál DNS replikáció DNS RNS Polipeptid Amino terminus Templát szál Karboxi terminus Szuper-csavarodott prokarióta cirkuláris DNS Hisztonok komplexe DNS hisztonokra történő felcsvarodása Hiszton-kötött negatív

Részletesebben

Sejtmag, magvacska magmembrán

Sejtmag, magvacska magmembrán Sejtmag, magvacska magmembrán Láng Orsolya Semmelweis Egyetem, Genetikai, Sejt- és Immunbiológiai Intézet Kompartmentalizáció Prokaryóta Cytoplazma Eukaryóta Endomembrán Kromatin Plazma membrán Eredménye

Részletesebben

Fehérjeszerkezet, és tekeredés. Futó Kinga

Fehérjeszerkezet, és tekeredés. Futó Kinga Fehérjeszerkezet, és tekeredés Futó Kinga Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983 H 211861 N

Részletesebben

12/4/2014. Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció. 1952 Hershey & Chase 1953!!!

12/4/2014. Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció. 1952 Hershey & Chase 1953!!! Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció 1859 1865 1869 1952 Hershey & Chase 1953!!! 1879 1903 1951 1950 1944 1928 1911 1 1. DNS szerkezete Mi az örökítő anyag? Friedrich Miescher

Részletesebben

Az elektromágneses spektrum

Az elektromágneses spektrum Az elektromágneses spektrum 400 nm 750 nm Hőmérsékleti sugárzás 1 Minden test anyagi minőségétől független, csak a test hőmérséklete által meghatározott spektrumú elektromágneses sugárzást bocsát ki, melyet

Részletesebben

Fehérje szintézis 2. TRANSZLÁCIÓ Molekuláris biológia kurzus 7. hét. Kun Lídia Genetikai, Sejt- és immunbiológiai Intézet

Fehérje szintézis 2. TRANSZLÁCIÓ Molekuláris biológia kurzus 7. hét. Kun Lídia Genetikai, Sejt- és immunbiológiai Intézet Fehérje szintézis 2. TRANSZLÁCIÓ Molekuláris biológia kurzus 7. hét Kun Lídia Genetikai, Sejt- és immunbiológiai Intézet Gén mrns Fehérje Transzkripció Transzláció A transzkriptum : mrns Hogyan mutatható

Részletesebben

Sejtalkotók a 2008. évi kémiai Nobel-díj fényében

Sejtalkotók a 2008. évi kémiai Nobel-díj fényében Sejtalkotók a 2008. évi kémiai Nobel-díj fényében Szabad János Szegedi Tudományegyetem Orvosi Biológiai Intézet 6720 Szeged, Somogyi utca 4. Tel: (62) 545-109 Evél: szabad@mdbio.szote.u-szeged.hu - Ellenanyagokkal

Részletesebben

FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest,

FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest, FEHÉRJÉK A MÁGNESEKBEN Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium Alkímia Ma, Budapest, 2013.02.28. I. FEHÉRJÉK: L-α aminosavakból felépülő lineáris polimerek α H 2 N CH COOH amino

Részletesebben

A biológiai mozgás molekuláris mechanizmusai

A biológiai mozgás molekuláris mechanizmusai BIOLÓGIAI MOZGÁSOK A biológiai mozgás molekuláris mechanizmusai Kollektív mozgás Szervezet mozgása ( Az évszázad ugrása ) Szerv mozgás BIOLÓGIAI MOZGÁSOK BIOLÓGIAI MOZGÁSOK Ritmusosan összehúzódó szívizomsejt

Részletesebben

Az NMR spektroszkópia a fehérjék szolgálatában. Bodor Andrea. ELTE Szerkezeti Kémia és Biológia Laboratórium Visegrád

Az NMR spektroszkópia a fehérjék szolgálatában. Bodor Andrea. ELTE Szerkezeti Kémia és Biológia Laboratórium Visegrád Az NMR spektroszkópia a fehérjék szolgálatában Bodor Andrea ELTE Szerkezeti Kémia és Biológia Laboratórium 2011.01.18. Visegrád Nobel díjak tükrében 1952 Fizika: Módszer és elméleti alapok Felix Bloch

Részletesebben

RNS-ek. 1. Az ősi RNS Világ: - az élet hajnalán. 2. Egy már ismert RNS Világ: - a fehérjeszintézis ben résztvevő RNS-ek

RNS-ek. 1. Az ősi RNS Világ: - az élet hajnalán. 2. Egy már ismert RNS Világ: - a fehérjeszintézis ben résztvevő RNS-ek RNS-ek RNS-ek 1. Az ősi RNS Világ: - az élet hajnalán 2. Egy már ismert RNS Világ: - a fehérjeszintézis ben résztvevő RNS-ek 3. Egy újonnan felfedezett RNS Világ: - szabályozó RNS-ek 4. Transzkripció Ősi

Részletesebben

Makromolekulák. Fehérjetekeredé. rjetekeredés. Biopolimer. Polimerek

Makromolekulák. Fehérjetekeredé. rjetekeredés. Biopolimer. Polimerek Biopolimerek Makromolekulá Makromolekulák. Fehé Fehérjetekeredé rjetekeredés. Osztódó sejt magorsófonala 2011. November 16. Huber Tamá Tamás Dohány levél epidermális sejtjének aktin hálózata Bakteriofágból

Részletesebben

Biomolekuláris nanotechnológia. Vonderviszt Ferenc PE MÜKKI Bio-Nanorendszerek Laboratórium

Biomolekuláris nanotechnológia. Vonderviszt Ferenc PE MÜKKI Bio-Nanorendszerek Laboratórium Biomolekuláris nanotechnológia Vonderviszt Ferenc PE MÜKKI Bio-Nanorendszerek Laboratórium Az élő szervezetek példája azt mutatja, hogy a fehérjék és nukleinsavak kiválóan alkalmasak önszerveződő molekuláris

Részletesebben

ÚJ TÁVLATOK AZ S100 FEHÉRJÉK SZERKEZETI BIOLÓGIÁJÁBAN. Doktori (Ph.D.) értekezés. Kiss Bence

ÚJ TÁVLATOK AZ S100 FEHÉRJÉK SZERKEZETI BIOLÓGIÁJÁBAN. Doktori (Ph.D.) értekezés. Kiss Bence ÚJ TÁVLATOK AZ S100 FEHÉRJÉK SZERKEZETI BIOLÓGIÁJÁBAN Doktori (Ph.D.) értekezés Kiss Bence Eötvös Loránd Tudományegyetem, Természettudományi Kar, Biológia Doktori Iskola Doktori Iskola vezetője: Prof.

Részletesebben

Gáspári Zoltán. Élő molekulák az élet molekulái

Gáspári Zoltán. Élő molekulák az élet molekulái Gáspári Zoltán Élő molekulák az élet molekulái Invokáció Kajtár Márton 1929-1991 www.eotvoskiado.hu Élő és élettelen? Élő és élettelen: a kemoton Élő kémiai rendszer, de nem élőlény (Gánti, 1975) Autokatalitikus

Részletesebben

A citoszkeletális rendszer, a harántcsíkolt izom biofizikája.

A citoszkeletális rendszer, a harántcsíkolt izom biofizikája. A citoszkeletális rendszer, a harántcsíkolt izom biofizikája. SCIENCE PHOTO LIBRARY Kupi Tünde 2010. 10. 19. Citoszkeleton: eukarióta sejtek dinamikus fehérjevázrendszere Három fı filamentum-osztály: A.

Részletesebben

16. A sejtek kommunikációja: jelátviteli folyamatok (szignál-transzdukció)

16. A sejtek kommunikációja: jelátviteli folyamatok (szignál-transzdukció) 16. A sejtek kommunikációja: jelátviteli folyamatok (szignál-transzdukció) 2016. február 25. Lippai Mónika lippai@elte.hu Minden sejt érzékel többféle, más sejtek által kibocsájtott jelmolekulát. - A jeleket

Részletesebben

TRANSZLÁCIÓ és fehérje transzport Hogyan lesz a DNS-ben kódolt információból fehérje? A DNS felszínén az aminosavak sorba állnak?

TRANSZLÁCIÓ és fehérje transzport Hogyan lesz a DNS-ben kódolt információból fehérje? A DNS felszínén az aminosavak sorba állnak? TRANSZLÁCIÓ és fehérje transzport Hogyan lesz a DNS-ben kódolt információból fehérje? A DNS felszínén az aminosavak sorba állnak? mrns, trns, riboszómák felfedezése A GENETIKAI KÓD 20 AS és csak 4 bázis,

Részletesebben

Biofizika I 2013-2014 2014.12.02.

Biofizika I 2013-2014 2014.12.02. ÁTTEKINTÉS AZ IZOM TÍPUSAI: SZERKEZET és FUNKCIÓ A HARÁNTCSÍKOLT IZOM SZERKEZETE MŰKÖDÉSÉNEK MOLEKULÁRIS MECHANIZMUSA IZOM MECHANIKA Biofizika I. -2014. 12. 02. 03. Dr. Bugyi Beáta PTE ÁOK Biofizikai Intézet

Részletesebben

A fehérjék hierarchikus szerkezete

A fehérjék hierarchikus szerkezete Fehérjék felosztása A fehérjék hierarchikus szerkezete Smeller László Semmelweis Egyetem Biofizikai és Sugárbiológiai Intézet Biológiai funkció alapján Enzimek (pl.: tripszin, citokróm-c ) Transzportfehérjék

Részletesebben

A 9,9 -biantril különleges fluoreszcenciája

A 9,9 -biantril különleges fluoreszcenciája A 9,9 -biantril különleges fluoreszcenciája Témavezetők: Demeter Attila és Harangozó József Az oldatok színe attól függ, hogy az oldott molekula a látható színkép mely hullámhossz tartományában nyeli el

Részletesebben

Evolúcióelmélet és az evolúció mechanizmusai

Evolúcióelmélet és az evolúció mechanizmusai Evolúcióelmélet és az evolúció mechanizmusai Az élet Darwini szemlélete Melyek az evolúció bizonyítékai a világban? EVOLÚCIÓ: VÁLTOZATOSSÁG Mutáció Horizontális géntranszfer Genetikai rekombináció Rekombináció

Részletesebben

2007/11/05 Molekuláris biológia előadások - Putnoky 1-1

2007/11/05 Molekuláris biológia előadások - Putnoky 1-1 1-1 Fehérje transzportmechanizmusok az eukariota sejtben: 1) transzmembrán transzport kitekert formában, egyedi fehérjék transzportja célzottan - citoszol ER, citoszol MT 2) póruson keresztüli transzport

Részletesebben

MedInProt Szinergia IV. program. Szerkezetvizsgáló módszer a rendezetlen fehérjék szerkezetének és kölcsönhatásainak jellemzésére

MedInProt Szinergia IV. program. Szerkezetvizsgáló módszer a rendezetlen fehérjék szerkezetének és kölcsönhatásainak jellemzésére MedInProt Szinergia IV. program Szerkezetvizsgáló módszer a rendezetlen fehérjék szerkezetének és kölcsönhatásainak jellemzésére Tantos Ágnes MTA TTK Enzimológiai Intézet, Rendezetlen fehérje kutatócsoport

Részletesebben

MITOCHONDRIUM. Molekuláris sejtbiológia: Dr. habil. Kőhidai László egytemi docens Semmelweis Egyetem, Genetikai, Sejt- és Immunbiológiai Intézet

MITOCHONDRIUM. Molekuláris sejtbiológia: Dr. habil. Kőhidai László egytemi docens Semmelweis Egyetem, Genetikai, Sejt- és Immunbiológiai Intézet Molekuláris sejtbiológia: MITOCHONDRIUM külső membrán belső membrán lemezek / crista matrix Dr. habil. Kőhidai László egytemi docens Semmelweis Egyetem, Genetikai, Sejt- és Immunbiológiai Intézet Tudomány-történet

Részletesebben

Genetika. Tartárgyi adatlap: tantárgy adatai

Genetika. Tartárgyi adatlap: tantárgy adatai Genetika Előadás a I. éves Génsebészet szakos hallgatók számára Tartárgyi adatlap: tantárgy adatai 2.1. Tantárgy címe Genetika 2.2. Előadás felelőse Dr. Mara Gyöngyvér, docens 2.3. Egyéb oktatási tevékenységek

Részletesebben

Részletes szakmai beszámoló Az erbb proteinek asszociációjának kvantitatív jellemzése című OTKA pályázatról (F049025)

Részletes szakmai beszámoló Az erbb proteinek asszociációjának kvantitatív jellemzése című OTKA pályázatról (F049025) Részletes szakmai beszámoló Az erbb proteinek asszociációjának kvantitatív jellemzése című OTKA pályázatról (F049025) A pályázat megvalósítása során célunk volt egyrészt a molekulák asszociációjának tanulmányozására

Részletesebben

A fehérjék hierarchikus szerkezete

A fehérjék hierarchikus szerkezete Fehérjék felosztása A fehérjék hierarchikus szerkezete Smeller László Semmelweis Egyetem Biofizikai és Sugárbiológiai Intézet Biológiai funkció alapján Enzimek (pl.: tripszin, citokróm-c ) Transzportfehérjék

Részletesebben

Fehérje expressziós rendszerek. Gyógyszerészi Biotechnológia

Fehérje expressziós rendszerek. Gyógyszerészi Biotechnológia Fehérje expressziós rendszerek Gyógyszerészi Biotechnológia Expressziós rendszerek Cél: rekombináns fehérjék előállítása nagy tisztaságban és nagy mennyiségben kísérleti ill. gyakorlati (therapia) felhasználásokra

Részletesebben

Ragyogó molekulák: dióhéjban a fluoreszcenciáról és biológiai alkalmazásairól

Ragyogó molekulák: dióhéjban a fluoreszcenciáról és biológiai alkalmazásairól Ragyogó molekulák: dióhéjban a fluoreszcenciáról és biológiai alkalmazásairól Kele Péter egyetemi adjunktus Lumineszcencia jelenségek Biolumineszcencia (biológiai folyamat, pl. luciferin-luciferáz) Kemilumineszcencia

Részletesebben

Epigenetikai Szabályozás

Epigenetikai Szabályozás Epigenetikai Szabályozás Kromatin alapegysége a nukleoszóma 1. DNS Linker DNS Nukleoszóma mag H1 DNS 10 nm 30 nm Nukleoszóma gyöngy (4x2 hiszton molekula + 146 nukleotid pár) 10 nm-es szál 30 nm-es szál

Részletesebben

AZ ÉLET KÉMIÁJA... ÉLŐ ANYAG SZERVEZETI ALAPEGYSÉGE

AZ ÉLET KÉMIÁJA... ÉLŐ ANYAG SZERVEZETI ALAPEGYSÉGE AZ ÉLET KÉMIÁJA... ÉLŐ ANYAG SZERVEZETI ALAPEGYSÉGE A biológia az élet tanulmányozásával foglalkozik, az élő szervezetekre viszont vonatkoznak a fizika és kémia törvényei MI ÉPÍTI FEL AZ ÉLŐ ANYAGOT? HOGYAN

Részletesebben

Receptorok, szignáltranszdukció jelátviteli mechanizmusok

Receptorok, szignáltranszdukció jelátviteli mechanizmusok Receptorok, szignáltranszdukció jelátviteli mechanizmusok Sántha Péter 2016.09.16. A sejtfunkciók szabályozása - bevezetés A sejtek közötti kommunikáció fő típusai: Endokrin Parakrin - Autokrin Szinaptikus

Részletesebben

Az ioncsatorna fehérjék szerkezete, működése és szabályozása. A patch-clamp technika

Az ioncsatorna fehérjék szerkezete, működése és szabályozása. A patch-clamp technika Az ioncsatorna fehérjék szerkezete, működése és szabályozása. A patch-clamp technika Panyi György 2014. November 12. Mesterséges membránok ionok számára átjárhatatlanok Iontranszport a membránon keresztül:

Részletesebben

A keringı tumor markerek klinikai alkalmazásának aktuális kérdései és irányelvei

A keringı tumor markerek klinikai alkalmazásának aktuális kérdései és irányelvei A keringı tumor markerek klinikai alkalmazásának aktuális kérdései és irányelvei A TM vizsgálatok alapkérdései A vizsgálatok célja, információértéke? Az alkalmazás területei? Hogyan válasszuk ki az alkalmazott

Részletesebben

Immunológia alapjai előadás MHC. szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás.

Immunológia alapjai előadás MHC. szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás. Immunológia alapjai 5-6. előadás MHC szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás. Antigén felismerés Az ellenanyagok és a B sejt receptorok natív formában

Részletesebben

Norvég Finanszírozási Mechanizmus által támogatott projekt HU-0115/NA/2008-3/ÖP-9 ÚJ TERÁPIÁS CÉLPONTOK AZONOSÍTÁSA GENOMIKAI MÓDSZEREKKEL

Norvég Finanszírozási Mechanizmus által támogatott projekt HU-0115/NA/2008-3/ÖP-9 ÚJ TERÁPIÁS CÉLPONTOK AZONOSÍTÁSA GENOMIKAI MÓDSZEREKKEL Norvég Finanszírozási Mechanizmus által támogatott projekt HU-0115/NA/2008-3/ÖP-9 ÚJ TERÁPIÁS CÉLPONTOK AZONOSÍTÁSA GENOMIKAI MÓDSZEREKKEL KÖZÖS STRATÉGIA KIFEJLESZTÉSE MOLEKULÁRIS MÓDSZEREK ALKALMAZÁSÁVAL

Részletesebben

A fehérjéket felépítő húsz standard aminosav Fehérjék szerkezetének kialakulása

A fehérjéket felépítő húsz standard aminosav Fehérjék szerkezetének kialakulása A fehérjéket felépítő húsz standard aminosav Fehérjék szerkezetének kialakulása Osváth Szabolcs Semmelweis Egyetem szabolcs.osvath@eok.sote.hu reakció t 1/2 25 ºC-on t 1/2 100 ºC-on DNS hidrolízis Biopolimerek

Részletesebben

Nanotechnológia. Vonderviszt Ferenc. Veszprémi Egyetem Nanotechnológia Tanszék

Nanotechnológia. Vonderviszt Ferenc. Veszprémi Egyetem Nanotechnológia Tanszék Nanotechnológia Vonderviszt Ferenc Veszprémi Egyetem Nanotechnológia Tanszék Ősi technológiák Mikroelektronika Technológia: képesség az anyag szerkezetének, az anyagot felépítő részecskék elrendeződésének

Részletesebben

A sejtfelszíni receptorok három fő kategóriája

A sejtfelszíni receptorok három fő kategóriája A sejtfelszíni receptorok három fő kategóriája 1. Saját enzimaktivitás nélküli receptorok 1a. G proteinhez kapcsolt pl. adrenalin, szerotonin, glukagon, bradikinin receptorok 1b. Tirozin kinázhoz kapcsolt

Részletesebben

Molekuláris biológiai technikák

Molekuláris biológiai technikák Molekuláris biológiai technikák Wunderlich Lívius A Molekuláris biológiai technikák jegyzet igyekszik átfogó képet adni a jövő tudományának, a molekuláris biológiának a módszertanáról. A technikák elméleti

Részletesebben

Jelátviteli útvonalak 1

Jelátviteli útvonalak 1 Jelátviteli útvonalak 1 Információ metabolizmus Szignál transzdukció 1 Jelátviteli séma Mi lehet a jel? Hormonok Növekedési faktorok Fejlődési szignálok Neurotranszmitterek Antigének Sejtfelszíni glikoproteinek

Részletesebben

A MASP-1 dózis-függő módon vazorelaxációt. okoz egér aortában

A MASP-1 dózis-függő módon vazorelaxációt. okoz egér aortában Analog input Analog input 157.34272 167.83224 178.32175 188.81127 Relaxáció (prekontrakció %) Channel 8 Channel 8 Analog input Volts Volts Channel 12 A dózis-függő módon vazorelaxációt Vehikulum 15.80

Részletesebben

12. évfolyam esti, levelező

12. évfolyam esti, levelező 12. évfolyam esti, levelező I. ÖKOLÓGIA EGYED FELETTI SZERVEZŐDÉSI SZINTEK 1. A populációk jellemzése, növekedése 2. A populációk környezete, tűrőképesség 3. Az élettelen környezeti tényezők: fény hőmérséklet,

Részletesebben

A TATA-kötő fehérje asszociált faktor 3 (TAF3) p53-mal való kölcsönhatásának funkcionális vizsgálata

A TATA-kötő fehérje asszociált faktor 3 (TAF3) p53-mal való kölcsönhatásának funkcionális vizsgálata Ph.D. ÉRTEKEZÉS TÉZISEI A TATA-kötő fehérje asszociált faktor 3 (TAF3) p53-mal való kölcsönhatásának funkcionális vizsgálata Buzás-Bereczki Orsolya Témavezetők: Dr. Bálint Éva Dr. Boros Imre Miklós Biológia

Részletesebben

A citoszkeleton. A citoszkeleton, a motorfehérjék, az izom és működésének szabályozása. A citoszkeleton. A citoszkeleton.

A citoszkeleton. A citoszkeleton, a motorfehérjék, az izom és működésének szabályozása. A citoszkeleton. A citoszkeleton. , a motorfehérjék, az izom és működésének szabályozása PTE ÁOK Biofizikai Intézet Ujfalusi Zoltán 2012. január-február Eukarióta sejtek dinamikus vázrendszere Három fő filamentum-osztály: 1. Intermedier

Részletesebben

Bio-nanorendszerek. Vonderviszt Ferenc. Pannon Egyetem Nanotechnológia Tanszék

Bio-nanorendszerek. Vonderviszt Ferenc. Pannon Egyetem Nanotechnológia Tanszék Bio-nanorendszerek Vonderviszt Ferenc Pannon Egyetem Nanotechnológia Tanszék Technológia: képesség az anyag szerkezetének, az anyagot felépítő részecskék elrendeződésének befolyásolására. A technológiai

Részletesebben

Receptorok és szignalizációs mechanizmusok

Receptorok és szignalizációs mechanizmusok Molekuláris sejtbiológia: Receptorok és szignalizációs mechanizmusok Dr. habil Kőhidai László Semmelweis Egyetem Genetikai, Sejt- és Immunbiológiai Intézet Sejtek szignalizációs kapcsolatai Sejtek szignalizációs

Részletesebben

Szentjánosbogár, trópusi halak, sarki fény Mi a közös a természet fénytüneményeiben?

Szentjánosbogár, trópusi halak, sarki fény Mi a közös a természet fénytüneményeiben? Szentjánosbogár, trópusi halak, sarki fény Mi a közös a természet fénytüneményeiben? Szalay Péter egyetemi tanár ELTE, Kémiai Intézet Elméleti Kémiai Laboratórium Van közös bennük? Egy kis történelem

Részletesebben

Kulcsszavak: Zöld fluoreszcens fehérje, helyspecifikus mutáció, kromofor, hisztidin

Kulcsszavak: Zöld fluoreszcens fehérje, helyspecifikus mutáció, kromofor, hisztidin Zöld fluoreszcens fehérje írányított mutagenézise és a mutáció hatásának vizsgálata Directed Mutagenesis of Green Fluorescent Protein and Study of the Mutation Effect Mutageneza direcţionată a proteinei

Részletesebben

Lehninger et al.: Principles of Biochemistry 3 rd ed (2000); Worth Publ. Voet et al.: Fundamentals of Biochemistry 1 st ed (1999); John Wiley

Lehninger et al.: Principles of Biochemistry 3 rd ed (2000); Worth Publ. Voet et al.: Fundamentals of Biochemistry 1 st ed (1999); John Wiley 1 TANKÖNYVEK Stryer et al.: Biochemistry 5 th ed. (2002); W.H Freeman ISBN: 0716746840 Lehninger et al.: Principles of Biochemistry 3 rd ed (2000); Worth Publ. Garrett & Grisham: Biochemistry 2 nd ed (1998);

Részletesebben

Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek

Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek Hidroxikarbonsavak α-hidroxi karbonsavak -Glikolsav (kézkrémek) - Tejsav (tejtermékek, izomláz, fogszuvasodás) - Citromsav (citrusfélékben,

Részletesebben

A Földön előforduló sejtek (pro- és eukarioták) közös és eltérő tulajdonságai. A sejtes szerveződés evolúciója.

A Földön előforduló sejtek (pro- és eukarioták) közös és eltérő tulajdonságai. A sejtes szerveződés evolúciója. A tárgy neve: Sejtbiológia előadás 1. Jellege: Törzs Gazda tanszék: Állattani és Sejtbiológiai Tanszék Felelős oktató: Dr. Gulya Károly Kredit: 2 Heti óraszám: 2 Típus: előadás Számonkérés: K A Földön

Részletesebben

TÉMAKÖRÖK. Ősi RNS világ BEVEZETÉS. RNS-ek tradicionális szerepben

TÉMAKÖRÖK. Ősi RNS világ BEVEZETÉS. RNS-ek tradicionális szerepben esirna mirtron BEVEZETÉS TÉMAKÖRÖK Ősi RNS világ RNS-ek tradicionális szerepben bevezetés BIOLÓGIAI MOLEKULÁK FEHÉRJÉK NUKLEINSAVAK DNS-ek RNS-ek BIOLÓGIAI MOLEKULÁK FEHÉRJÉK NUKLEINSAVAK DNS-ek RNS-ek

Részletesebben

Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis

Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis Szerkezet Protein Data Bank (PDB) http://www.rcsb.org/pdb ~ 35 701 szerkezet közepes felbontás 1552 szerkezet d 1.5 Å 160 szerkezet d 1.0 Å 10 szerkezet d 0.8 Å (atomi felbontás) E globális minimum? funkció

Részletesebben

Az élő sejt fizikai Biológiája: motorfehérjék, egyensúlytól távoli folyamatok

Az élő sejt fizikai Biológiája: motorfehérjék, egyensúlytól távoli folyamatok Tematika Az élő sejt fizikai Biológiája: motorfehérjék, egyensúlytól távoli folyamatok Kellermayer Miklós Motorfehérjék működése. A munkaciklus Egyensúlytól távoli folyamatok. Erővezérelt fehérjegombolyodás.

Részletesebben

A DNS mentén mozgó motorfehérjék processzivitása

A DNS mentén mozgó motorfehérjék processzivitása A DNS mentén mozgó motorfehérjék processzivitása Szakdolgozat biológia alapszak, biológus szakirány készítette: Szabó Judit Eszter témavezető: Kovács Mihály, tudományos főmunkatárs Biokémiai Tanszék EÖTVÖS

Részletesebben

4. A humorális immunválasz október 12.

4. A humorális immunválasz október 12. 4. A humorális immunválasz 2016. október 12. A klónszelekciós elmélet sarokpontjai: Monospecifictás: 1 sejt 1-féle specificitású receptor Az antigén receptorhoz kötődése aktiválja a limfocitát A keletkező

Részletesebben

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Azonosító szám: TÁMOP-4.1.2-08/1/A-2009-0011 Az orvosi

Részletesebben

Biopolimer 12/7/09. Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. DNS. Polimerek. Kardos Roland DNS elsődleges szerkezete

Biopolimer 12/7/09. Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. DNS. Polimerek. Kardos Roland DNS elsődleges szerkezete Biopolimerek Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. Osztódó sejt magorsófonala Kardos Roland 2009.10.29. Dohány levél epidermális sejtjének aktin hálózat Bakteriofágból kiszabaduló

Részletesebben

RNS-ek. 1. Az ősi RNS Világ: - az élet hajnalán. 2. Egy már ismert RNS Világ: - a fehérjeszintézis ben résztvevő RNS-ek

RNS-ek. 1. Az ősi RNS Világ: - az élet hajnalán. 2. Egy már ismert RNS Világ: - a fehérjeszintézis ben résztvevő RNS-ek RNS-ek RNS-ek 1. Az ősi RNS Világ: - az élet hajnalán 2. Egy már ismert RNS Világ: - a fehérjeszintézis ben résztvevő RNS-ek 3. Egy újonnan felfedezett RNS Világ: - szabályozó RNS-ek 4. Transzkripció 5.

Részletesebben

Célkitűzés/témák Fehérje-ligandum kölcsönhatások és a kötődés termodinamikai jellemzése

Célkitűzés/témák Fehérje-ligandum kölcsönhatások és a kötődés termodinamikai jellemzése Célkitűzés/témák Fehérje-ligandum kölcsönhatások és a kötődés termodinamikai jellemzése Ferenczy György Semmelweis Egyetem Biofizikai és Sugárbiológiai Intézet Biokémiai folyamatok - Ligandum-fehérje kötődés

Részletesebben

17.2. ábra Az immunválasz kialakulása és lezajlása patogén hatására

17.2. ábra Az immunválasz kialakulása és lezajlása patogén hatására 11. 2016. nov 30. 17.2. ábra Az immunválasz kialakulása és lezajlása patogén hatására 17.3. ábra A sejtközötti térben és a sejten belül élő és szaporodó kórokozók ellen kialakuló védekezési mechanizmusok

Részletesebben

Poligénes v. kantitatív öröklődés

Poligénes v. kantitatív öröklődés 1. Öröklődés komplexebb sajátosságai 2. Öröklődés molekuláris alapja Poligénes v. kantitatív öröklődés Azok a tulajdonságokat amelyek mértékegységgel nem, vagy csak nehezen mérhetők, kialakulásuk kevéssé

Részletesebben

BIOKÉMIA. levelezõ MSc számára A TANTÁRGY KÖVETELMÉNYRENDSZERE

BIOKÉMIA. levelezõ MSc számára A TANTÁRGY KÖVETELMÉNYRENDSZERE levelezõ MSc számára A TANTÁRGY KÖVETELMÉNYRENDSZERE MKK 2009/2010. tanév, 1. félév KÖVETELMÉNYRENDSZER A TÁRGY KÖVETELMÉNYRENDSZERE ÉS VIZSGARENDJE 1. A félév elismerésének feltétele S Az összes gyakorlat

Részletesebben

Kémiai biológia avagy mit nyújt(hat) a kémia az élettudományoknak

Kémiai biológia avagy mit nyújt(hat) a kémia az élettudományoknak A Magyar Tudomány Ünnepe 2007 Kémiai biológia avagy mit nyújt(hat) a kémia az élettudományoknak Tudományos ülésszak A Debreceni Egyetem Természettudományi Karának Kémiai Intézete és A Debreceni Akadémiai

Részletesebben

A TRANSZLÁCIÓ Hogyan lesz a DNS-ben kódolt információból fehérje? A DNS felszínén az aminosavak sorba állnak?

A TRANSZLÁCIÓ Hogyan lesz a DNS-ben kódolt információból fehérje? A DNS felszínén az aminosavak sorba állnak? A TRANSZLÁCIÓ Hogyan lesz a DNS-ben kódolt információból fehérje? A DNS felszínén az aminosavak sorba állnak? mrns, trns, riboszómák felfedezése A GENETIKAI KÓD 20 AS és csak 4 bázis, a kódolás hogy lehetséges?

Részletesebben

CIÓ A GENETIKAI INFORMÁCI A DNS REPLIKÁCI

CIÓ A GENETIKAI INFORMÁCI A DNS REPLIKÁCI A GENETIKAI INFORMÁCI CIÓ TÁROLÁSA ÉS S KIFEJEZŐDÉSE A DNS SZERKEZETE Két antiparalel (ellentétes lefutású) polinukleotid láncból álló kettős helix A két lánc egy képzeletbeli közös tengely körül van feltekeredve,

Részletesebben

RO-060042, Bukarest, Splaiul Independenţei 313, tel.: 4021-402 96 24, fax 4021-402 39 34, email: balintemese@sapientia.siculorum.ro, www.upb.

RO-060042, Bukarest, Splaiul Independenţei 313, tel.: 4021-402 96 24, fax 4021-402 39 34, email: balintemese@sapientia.siculorum.ro, www.upb. A réz ionok hatása a módosított Zöld Fluoreszcens Fehérjére Effect of cooper ions on modified Green Fluorescent Protein Efectul ionilor de cupru asupra Proteinei Fluorescente Verzi modificate BÁLINT Emese-Éva

Részletesebben

MULTICELLULÁRIS SZERVEZŐDÉS: SEJT-SEJT (SEJT-MÁTRIX) KÖLCSÖNHATÁSOK 1. Bevezetés (2.)Extracelluláris mátrix (ECM) (Kollagén, hialuron sav,

MULTICELLULÁRIS SZERVEZŐDÉS: SEJT-SEJT (SEJT-MÁTRIX) KÖLCSÖNHATÁSOK 1. Bevezetés (2.)Extracelluláris mátrix (ECM) (Kollagén, hialuron sav, MULTICELLULÁRIS SZERVEZŐDÉS: SEJT-SEJT (SEJT-MÁTRIX) KÖLCSÖNHATÁSOK 1. Bevezetés (2.)Extracelluláris mátrix (ECM) (Kollagén, hialuron sav, proteoglikánok) (3.)Multiadhéziós fehérjék és sejtfelszíni receptorok

Részletesebben

DNS, RNS, Fehérjék. makromolekulák biofizikája. Biológiai makromolekulák. A makromolekulák TÖMEG szerinti mennyisége a sejtben NAGY

DNS, RNS, Fehérjék. makromolekulák biofizikája. Biológiai makromolekulák. A makromolekulák TÖMEG szerinti mennyisége a sejtben NAGY makromolekulák biofizikája DNS, RNS, Fehérjék Kellermayer Miklós Tér Méret, alak, lokális és globális szerkezet Idő Fluktuációk, szerkezetváltozások, gombolyodás Kölcsönhatások Belső és külső kölcsöhatások,

Részletesebben

Agrármérnök MSc KÖVETELMÉNYRENDSZER Alkalmazott biokémia SMKKB4011AN ALKALMAZOTT BIOKÉMIA A TÁRGY KÖVETELMÉNYRENDSZERE ÉS VIZSGARENDJE

Agrármérnök MSc KÖVETELMÉNYRENDSZER Alkalmazott biokémia SMKKB4011AN ALKALMAZOTT BIOKÉMIA A TÁRGY KÖVETELMÉNYRENDSZERE ÉS VIZSGARENDJE Agrármérnök MSc KÖVETELMÉNYRENDSZER Alkalmazott biokémia SMKKB4011AN A TÁRGY KÖVETELMÉNYRENDSZERE ÉS VIZSGARENDJE 1. Előadás Az előadások látogatását nem ellenőrizzük, de mindenki számára ajánlott! Az

Részletesebben

Az ellenanyagok orvosbiológiai. PhD kurzus 2011/2012 II. félév

Az ellenanyagok orvosbiológiai. PhD kurzus 2011/2012 II. félév Az ellenanyagok orvosbiológiai alkalmazása PhD kurzus 2011/2012 II. félév Ellenanyaggal működő módszerek Analitikai felhasználás Analitikai felhasználás Ellenanyag / antigén kapcsolódás Az Ab/Ag kapcsolat

Részletesebben

Farmakológus szakasszisztens Farmakológus szakasszisztens 2/34

Farmakológus szakasszisztens Farmakológus szakasszisztens 2/34 -06 Farmakológus szakasszisztens feladatok A 0/007 (II. 7.) SzMM rendelettel módosított /006 (II. 7.) OM rendelet Országos Képzési Jegyzékről és az Országos Képzési Jegyzékbe történő felvétel és törlés

Részletesebben

BIOKÉMIA A TÁRGY KÖVETELMÉNYRENDSZERE ÉS VIZSGARENDJE

BIOKÉMIA A TÁRGY KÖVETELMÉNYRENDSZERE ÉS VIZSGARENDJE Biokémia (SMKKB4011XN) KÖVETELMÉNYRENDSZER Biotechnológus MSc A TÁRGY KÖVETELMÉNYRENDSZERE ÉS VIZSGARENDJE 1. Előadás Az előadások való részvétel ajánlott! Az előadásokon és a gyakorlatokon elhangzottak

Részletesebben

BIOKÉMIA. Simonné Prof. Dr. Sarkadi Livia egyetemi tanár.

BIOKÉMIA. Simonné Prof. Dr. Sarkadi Livia egyetemi tanár. BIOKÉMIA Simonné Prof. Dr. Sarkadi Livia egyetemi tanár e-mail: sarkadi@mail.bme.hu Tudományterületi elhelyezés Alaptudományok (pl.: matematika, fizika, kémia, biológia) Alkalmazott tudományok Interdiszciplináris

Részletesebben

Tudásmenedzsment és gyógyszerinnováció

Tudásmenedzsment és gyógyszerinnováció Tudásmenedzsment és gyógyszerinnováció Ipari szükségletek / elvárások Dr. Bátori Sándor Sanofi-aventis Innovatív Gyógyszerek Kutatása, MAGYOSZ, 2009.01.07. Alapvető együttm ttműködések Hosszútávú elhatározás:

Részletesebben

Biomolekuláris kölcsönhatások vizsgálata felületi plazmonrezonancia elvén működő Biacore keszülékkel

Biomolekuláris kölcsönhatások vizsgálata felületi plazmonrezonancia elvén működő Biacore keszülékkel Biomolekuláris kölcsönhatások vizsgálata felületi plazmonrezonancia elvén működő Biacore keszülékkel Biomolekuláris interakciók Fehérje-fehérje Fehérje-ligand Fehérje-DNS/RNS fehérje/ligand-lipid Alegység-kölcsönhatások,

Részletesebben

K68464 OTKA pályázat szakmai zárójelentés

K68464 OTKA pályázat szakmai zárójelentés K68464 OTKA pályázat szakmai zárójelentés A fehérjeaggregáció és amiloidképződés szerkezeti alapjai; a különféle morfológiájú aggregátumok kialakulásának körülményei és in vivo hatásuk vizsgálata Vezető

Részletesebben

A PET szerepe a gyógyszerfejlesztésben. Berecz Roland DE KK Pszichiátriai Tanszék

A PET szerepe a gyógyszerfejlesztésben. Berecz Roland DE KK Pszichiátriai Tanszék A PET szerepe a gyógyszerfejlesztésben Berecz Roland DE KK Pszichiátriai Tanszék Gyógyszerfejlesztés Felfedezés gyógyszertár : 10-15 év Kb. 1 millárd USD/gyógyszer (beleszámolva a sikertelen fejlesztéseket)

Részletesebben

A fehérje-fehérje kölcsönhatás szerkezeti alapjai és biológiai szerepük: multidiszciplináris megközelítés (zárójelentés)

A fehérje-fehérje kölcsönhatás szerkezeti alapjai és biológiai szerepük: multidiszciplináris megközelítés (zárójelentés) A fehérje-fehérje kölcsönhatás szerkezeti alapjai és biológiai szerepük: multidiszciplináris megközelítés (zárójelentés) Az ELTE Biokémiai Tanszék tudományos kutatásainak tengelyében évtizedek óta a fehérjék

Részletesebben

A preventív vakcináció lényege :

A preventív vakcináció lényege : Vakcináció Célja: antigénspecifkus immunválasz kiváltása a szervezetben A vakcina egy olyan készítmény, amely fokozza az immunitást egy adott betegséggel szemben (aktiválja az immunrendszert). A preventív

Részletesebben

A kórokozók ellen kialakuló immunválasz jellemzői; vírusok, baktériumok

A kórokozók ellen kialakuló immunválasz jellemzői; vírusok, baktériumok A kórokozók ellen kialakuló immunválasz jellemzői; vírusok, baktériumok A tankönyben (http://immunologia.elte.hu/oktatas.php): Bajtay Zsuzsa Immunológiai Tanszék ELTE Tanárszakosok, 2016 A mikrobák és

Részletesebben

KÖRNYEZETI MIKROBIOLÓGIA ÉS BIOTECHNOLÓGIA. Bevezető előadás

KÖRNYEZETI MIKROBIOLÓGIA ÉS BIOTECHNOLÓGIA. Bevezető előadás KÖRNYEZETI MIKROBIOLÓGIA ÉS BIOTECHNOLÓGIA Bevezető előadás Dr. Molnár Mónika, Dr. Feigl Viktória Budapesti Műszaki és Gazdaságtudományi Egyetem Alkalmazott Biotechnológia és Élelmiszertudományi Tanszék

Részletesebben

Az élő sejt fizikai Biológiája:

Az élő sejt fizikai Biológiája: Az élő sejt fizikai Biológiája: Modellépítés, biológiai rendszerek skálázódása Kellermayer Miklós Fizikai biológia Ma már nem csak kvalitatív megfigyeléseket, hanem kvantitatív méréseket végzünk (biológiai

Részletesebben

Citoszkeleton. Sejtek rugalmassága. Polimer mechanika: Hooke-rugalmasság. A citoszkeleton filamentumai. Fogászati anyagtan fizikai alapjai 12.

Citoszkeleton. Sejtek rugalmassága. Polimer mechanika: Hooke-rugalmasság. A citoszkeleton filamentumai. Fogászati anyagtan fizikai alapjai 12. Fogászati anyagtan fizikai alapjai 12. Sejtek rugalmassága Citoszkeleton Eukariota sejtek dinamikus vázrendszere Három fő filamentum-osztály: A. Vékony (aktin) B. Intermedier C. Mikrotubulus Polimerizáció:

Részletesebben

METASZTÁZISKÉPZÉS. Láng Orsolya. Kemotaxis speciálkollégium 2005.

METASZTÁZISKÉPZÉS. Láng Orsolya. Kemotaxis speciálkollégium 2005. METASZTÁZISKÉPZÉS Láng Orsolya Kemotaxis speciálkollégium 2005. TUMOROK ÉS MIGRÁCIÓ PRIMER TUMOR METASZTÁZIS Angiogenezis Adhézió SEJT - SEJTCIKLUS Apoptózis Kemokinek Növekedési faktorok Szabályozó fehérjék

Részletesebben

Molekuláris biológiai eljárások alkalmazása a GMO analitikában és az élelmiszerbiztonság területén

Molekuláris biológiai eljárások alkalmazása a GMO analitikában és az élelmiszerbiztonság területén Molekuláris biológiai eljárások alkalmazása a GMO analitikában és az élelmiszerbiztonság területén Dr. Dallmann Klára A molekuláris biológia célja az élőlények és sejtek működésének molekuláris szintű

Részletesebben

Szalay Péter (ELTE, Kémia Intézet) Szentjánosbogár, trópusi halak, sarki fény Mi a közös a természet fénytüneményeiben?

Szalay Péter (ELTE, Kémia Intézet) Szentjánosbogár, trópusi halak, sarki fény Mi a közös a természet fénytüneményeiben? Szalay Péter (ELTE, Kémia Intézet) Szentjánosbogár, trópusi halak, sarki fény Mi a közös a természet fénytüneményeiben? Boronkay György Műszaki Középiskola és Gimnázium Budapest, 2011. október 27. www.meetthescientist.hu

Részletesebben

Az immunrendszer alapjai, sejtöregedés, tumorképződés. Biológiai alapismeretek

Az immunrendszer alapjai, sejtöregedés, tumorképződés. Biológiai alapismeretek Az immunrendszer alapjai, sejtöregedés, tumorképződés Biológiai alapismeretek Az immunrendszer Immunis (latin szó): jelentése mentes valamitől Feladata: a szervezetbe került idegen anyagok: 1. megtalálása

Részletesebben

BIOLÓGIA OSZTÁLYOZÓ VIZSGA ÉS JAVÍTÓVIZSGA KÖVETELMÉNYEK (2016)

BIOLÓGIA OSZTÁLYOZÓ VIZSGA ÉS JAVÍTÓVIZSGA KÖVETELMÉNYEK (2016) BIOLÓGIA OSZTÁLYOZÓ VIZSGA ÉS JAVÍTÓVIZSGA KÖVETELMÉNYEK (2016) 1 Biológia tantárgyból mindhárom évfolyamon (10.-11.-12.) írásbeli és szóbeli vizsga van. A vizsga részei írásbeli szóbeli Írásbeli Szóbeli

Részletesebben

Fehérjék szerkezetének kialakulása II

Fehérjék szerkezetének kialakulása II Egy kis fehérje gombolyodása több párhuzamos úton Fehérjék szerkezetének kialakulása II Osváth Szabolcs Semmelweis Egyetem hélix kialakulás és kollapszus több párhuzamos úton további kollapszus és hélix

Részletesebben