Elektrosztatikus számítások. Elektrosztatikus számítások. Elektrosztatikus számítások. Elektrosztatikus számítások Definíciók

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "Elektrosztatikus számítások. Elektrosztatikus számítások. Elektrosztatikus számítások. Elektrosztatikus számítások Definíciók"


1 Jelentősége szubsztrát kötődés szolvatáció ionizációs állapotok (pka) mechanizmus katalízis ioncsatornák szimulációk (szerkezet) all-atom dipolar fluid dipolar lattice continuum Definíciók töltéseloszlás Elektromos tér acetilkolin-észterázban Q i : ponttöltések; dipólusok: Elektromos erő (field): Elektrosztatikus potenciál: Definíciók Definíciók potenciális energia ndukált dipólusok, több-test probléma α: polarizálhatóság (QM számolásokból) Elektromos erő (field): Elektrosztatikus potenciál: Dipólus potenciális energiája E(r) térben E 0 : külső erőtér, E µ : µ dipólustól származó erőtér iteratív megoldás (+screening for E 0 <d(r)>) Warshel és Russell, Quat. Rev. in Biophysics (1984),17, pp

2 Mikroszkopikus megközelítések <E 0 +E µ > effektív potenciál meghatározása d i : screening function Mikroszkopikus megközelítések További egyszerűsítések: átlagos polarizáció szabadenergia: Sok konfiguráción átlagolt elektrosztatikus szabadenergia ad csak helyes eredményt U i : nem elektrosztatikus tagok (vdw), : effektív potenciál i dipóluson (U es E i minden állására kiátlagolva) Langevin formula All-atom QM? Mikroszkopikus megközelítések szupermolekula nem ad helyes oldáshőt (ΔG s ) inter- és intramolekuláris tagok szétválasztása 3-tag kölcsönhatások számítása (indukált dipólusok) self-consistent módon QM szerű potenciálfüggvények (beépítés a hullámfv-be) konvergencia problémák (átlagolás) All-atom Kölcsönhatások leírása erőtérrel Probléma: hosszútávú kölcsönhatások Lehetséges megoldások: periódikus határfeltételek Ewald összegzés - divergens szolvatációs energiák - függ a rendszer méretétől gömbszimmetrikus határfeltételek local reaction field (LRF) felszíni molekulákra ható erő számítása Dipólus modellek Cél: jobb konvergencia elérése modellek (potenciálok) egyszerűsítésével Langevin Dipólus modell oldószer dipólusok átlagos orientációja Kétségek: hidrogénkötéses oldószer energetikája nem írható le dipólusokkal ( re-kalibrálás) szerkezetét nem adja vissza Megfigyelések: a szolvatációs energia számításához a quadrupól momentumok nem annyira fontosak a megfelelő átlagolás játszik fontos szerepet Langevin dipólus többi oldószer tere d(r i ) screening function 2

3 Langevin Dipólus modell Langevin Dipólus modell d(r i ) számítása: E 0 /E all-atom modellel oldott anyag tere többi oldószer tere közeli oldószerek tere C, d(r i ) egymástól függő paraméterek µ 0 -al együtt szolvatációs energiákhoz kell fittelni gyors konvergencia Makroszkópikus modellek Makroszkópikus modellek Elektromos tér : minden dipólus hozzájárulását tartalmazza (sajátot is) l q=σa P: polarizációs vektor makroszkópikus modell ε: makroszkópikus dielektromos állandó ha V elég nagy, ε a tömbfázis dielektromos állandója Makroszkópikus modellek A makroszkópikus és mikroszkópikus dielektromos állandó Energia : all-atom MD nő a fehérje relaxációt figyelembe véve dipólusok tere ε = 2-10 fehérjében csökken, minél teljesebb a modell U (R,r) nem elektrosztatikus tagok King et al. (1991) J. Chem. Phys 95, pp

4 Szabadenergia : Szabadenergia, makroszkópikus közelítésben : Oldáshő (tiszta oldószerhez képest) r 0 minimum energia konformáció (oldószer) makroszkópikus megközelítésben: ε a + vákuumból az oldószerbe Born formula Probléma: ε,a ismeretlen két különböző közeg között: P polarizáció Δτ térfogat elemben, ΔG self adott térfogatelem polarizációjának energiája Onsager modell: Generalized Born (GB): Φ RF reakciótér ε a Hullámfüggvénybe beépíthető (perturbáció) ΔG sol meghatározása QM módszerrel PCM polarizable continuum modell egységes ε, fehérjékre nem jó Poisson Boltzmann (PB): Poisson Boltzmann (PB): Problémák: Helyfüggő dielektromos állandó ionos közegben: κ ionerősséggel arányos DELPH program (Honig csoport) Φ,ρ,ε meghatározása gridpontokban rosszul definiált ε merev fehérje lokális effektusok hiánya: nem adja vissza a reorganizációs effektust pka eltolódások vizsgálatára nem alkalmas ligand kötésre nem ad kvantitatív eredményeket 4

5 Mi a glikoziláz lépés mechanizmusa? pka értékek az aktív helyen ΔΔG w p a feltételezett intermedierekre Fuxreiter, Warshel, Osman (1999) Biochemistry 38, pp intrinsic pka minden csoport semleges (csak parciális töltések) többi töltött csoport hatása intrinsic pka minden csoport semleges (csak parciális töltések) többi töltött csoport hatása Sham, Chu és Warshel (1997) J. Phys. Chem B 101, pp deszolvatáció Töltött csoportok hatása Protein Dipoles Langevin Dipoles (PDLD) modell: : Q; : q,µ,γ; : q,µ,γ; V: tömbfázis megoldás self-consistent iterációval i o V 5

6 Protein Dipoles Langevin Dipoles (PDLD) modell: Protein Dipoles Langevin Dipoles (PDLD) modell: 1. [Q()-Q()] 4. [Q(+)-µ()] 2. [Q()-q()] 5. i 3. [Q(+)-µ()] i 6. o o V V Warshel és mtsai (1993) J. Comput. Chem. 14, pp Konvergencia elősegítése lokális reakciótér korrekció (LRF) távoli Langevin dipólusok terét nem számítja újra minden iterációban Konformációs átlagolás lineáris válasz (LRA) Mi a glikoziláz lépés mechanizmusa? kulcsfontosságú enzimek működésének megértéséhez pka értékek az aktív helyen ΔΔG w p a feltételezett intermedierekre Fuxreiter, Warshel, Osman (1999) Biochemistry 38, pp Fuxreiter, Warshel, Osman (1999) Biochemistry 38, pp

7 7

Erőterek. Erőterek. Erőterek. Erőterek. Erőterek. Erőterek. Probléma: fehérjéknél nagy dimenziók értelmetlen QM eredmények.

Erőterek. Erőterek. Erőterek. Erőterek. Erőterek. Erőterek. Probléma: fehérjéknél nagy dimenziók értelmetlen QM eredmények. fehérjéknél nagy dimenziók értelmetlen QM eredmények Megoldás: egyszerűsítés dimenzió-csökkentés Közelítések Born-Oppenheimer közelítés (Ψ mol = Ψ el Ψ mag ; E tot =E el +E mag ) az energia párkölcsönhatások


Vezetők elektrosztatikus térben

Vezetők elektrosztatikus térben Vezetők elektrosztatikus térben Vezető: a töltések szabadon elmozdulhatnak Ha a vezető belsejében a térerősség nem lenne nulla akkor áram folyna. Ha a felületen a térerősségnek lenne tangenciális (párhuzamos)


Enzimek. Enzimek! IUBMB: szisztematikus nevek. Enzimek jellemzése! acetilkolin-észteráz! legalább 10 nagyságrend gyorsulás. szubsztrát-specificitás

Enzimek. Enzimek! IUBMB: szisztematikus nevek. Enzimek jellemzése! acetilkolin-észteráz! legalább 10 nagyságrend gyorsulás. szubsztrát-specificitás Enzimek acetilkolin-észteráz! Enzimek! [s -1 ] enzim víz carbonic anhydrase 6x10 5 10-9 karbonikus anhidráz acetylcholine esterase 2x10 4 8x10-10 acetilkolin észteráz staphylococcal nuclease 10 2 2x10-14


Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis

Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis Szerkezet Protein Data Bank (PDB) http://www.rcsb.org/pdb ~ 35 701 szerkezet közepes felbontás 1552 szerkezet d 1.5 Å 160 szerkezet d 1.0 Å 10 szerkezet d 0.8 Å (atomi felbontás) E globális minimum? funkció


Molekuláris dinamika. 10. előadás

Molekuláris dinamika. 10. előadás Molekuláris dinamika 10. előadás Mirőlis szól a MD? nagy részecskeszámú rendszerek ismerjük a törvényeket mikroszkópikus szinten? Hogyan tudjuk megérteni a folyadékok, gázok, szilárdtestek makroszkópikus





Célkitűzés/témák Fehérje-ligandum kölcsönhatások és a kötődés termodinamikai jellemzése

Célkitűzés/témák Fehérje-ligandum kölcsönhatások és a kötődés termodinamikai jellemzése Célkitűzés/témák Fehérje-ligandum kölcsönhatások és a kötődés termodinamikai jellemzése Ferenczy György Semmelweis Egyetem Biofizikai és Sugárbiológiai Intézet Biokémiai folyamatok - Ligandum-fehérje kötődés


Szalai István. ELTE Kémiai Intézet 1/74

Szalai István. ELTE Kémiai Intézet 1/74 Elsőrendű kötések Szalai István ELTE Kémiai Intézet 1/74 Az előadás vázlata ˆ Ismétlés ˆ Ionos vegyületek képződése ˆ Ionok típusai ˆ Kovalens kötés ˆ Fémes kötés ˆ VSEPR elmélet ˆ VB elmélet 2/74 Periodikus


Lendület. Lendület (impulzus): A test tömegének és sebességének szorzata. vektormennyiség: iránya a sebesség vektor iránya.

Lendület. Lendület (impulzus): A test tömegének és sebességének szorzata. vektormennyiség: iránya a sebesség vektor iránya. Lendület Lendület (impulzus): A test tömegének és sebességének szorzata. vektormennyiség: iránya a sebesség vektor iránya. Lendülettétel: Az lendület erő hatására változik meg. Az eredő erő határozza meg


Idegen atomok hatása a grafén vezet képességére

Idegen atomok hatása a grafén vezet képességére hatása a grafén vezet képességére Eötvös Loránd Tudományegyetem, Komplex Rendszerek Fizikája Tanszék Mahe Tisk'11 Vázlat 1 Kisérleti eredmények Kémiai szennyez k hatása a Fermi-energiára A vezet képesség


Kötések kialakítása - oktett elmélet

Kötések kialakítása - oktett elmélet Kémiai kötések Az elemek és vegyületek halmazai az atomok kapcsolódásával - kémiai kötések kialakításával - jönnek létre szabad atomként csak a nemesgázatomok léteznek elsődleges kémiai kötések Kötések


A kovalens kötés polaritása

A kovalens kötés polaritása Általános és szervetlen kémia 4. hét Kovalens kötés A kovalens kötés kialakulásakor szabad atomokból molekulák jönnek létre. A molekulák létrejötte mindig energia csökkenéssel jár. A kovalens kötés polaritása


Orvosi Fizika 12. Bari Ferenc egyetemi tanár SZTE ÁOK-TTIK Orvosi Fizikai és Orvosi Informatikai Intézet

Orvosi Fizika 12. Bari Ferenc egyetemi tanár SZTE ÁOK-TTIK Orvosi Fizikai és Orvosi Informatikai Intézet Orvosi Fizika. Elektromosságtan és mágnességtan az életfolyamatokban Bari Ferenc egyetemi tanár SZTE ÁOK-TTIK Orvosi Fizikai és Orvosi Informatikai Intézet Szeged, 0.november 8. Az életjelenségek elektromos


Elektromos alapjelenségek

Elektromos alapjelenségek Elektrosztatika Elektromos alapjelenségek Dörzselektromos jelenség: egymással szorosan érintkező, vagy egymáshoz dörzsölt testek a szétválasztásuk után vonzó, vagy taszító kölcsönhatást mutatnak. Ilyenkor


Orvosi Fizika 10. Biológiai membránok fizikája, diffúzió, ozmózis Dr. Nagy László

Orvosi Fizika 10. Biológiai membránok fizikája, diffúzió, ozmózis Dr. Nagy László Orvosi Fizika 10. Biológiai membránok fizikája, diffúzió, ozmózis Dr. Nagy László -Az anyagcsere és a transzportfolyamatok. - Makrotranszport : jelentős anyagmennyiségek transzportja : csöveken, edényeken


Atomok és molekulák elektronszerkezete

Atomok és molekulák elektronszerkezete Atomok és molekulák elektronszerkezete Szabad atomok és molekulák Schrödinger egyenlete Tekintsünk egy kvantummechanikai rendszert amely N n magból és N e elektronból áll. Koordinátáikat jelölje rendre


Monte Carlo módszerek a statisztikus fizikában. Az Ising modell. 8. előadás

Monte Carlo módszerek a statisztikus fizikában. Az Ising modell. 8. előadás Monte Carlo módszerek a statisztikus fizikában. Az Ising modell. 8. előadás Démon algoritmus az ideális gázra időátlag fizikai mennyiségek átlagértéke sokaságátlag E, V, N pl. molekuláris dinamika Monte


Kiterjedt biokémiai rendszerek számítógépes modellezése

Kiterjedt biokémiai rendszerek számítógépes modellezése Kiterjedt biokémiai rendszerek számítógépes modellezése MTA DOKTORI ÉRTEKEZÉS TÉZISEI FERENCZY GYÖRGY BUDAPEST, 2013 1 Bevezetés, célkitűzések Doktori értekezésem az elmúlt, közel 20 év, döntően gyógyszergyári


A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin.

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin. Myoglobin Fehérje-szerkezetek! MGLSDGEWQLVLNVWGKVEADIPGGQEVLIRLFK GPETLEKFDKFKLKSEDEMKASE DLKKGATVLTALGGILKKKGEAEIKPLAQSA TKKIPVKYLEFISECIIQVLQSK PGDFGADAQGAMNKALELFRKDMASNYKELGFQG Fuxreiter Mónika! Debreceni


Atomok. szilárd. elsődleges kölcsönhatás. kovalens ionos fémes. gázok, folyadékok, szilárd anyagok. ionos fémek vegyületek ötvözetek

Atomok. szilárd. elsődleges kölcsönhatás. kovalens ionos fémes. gázok, folyadékok, szilárd anyagok. ionos fémek vegyületek ötvözetek Atomok elsődleges kölcsönhatás kovalens ionos fémes véges számú atom térhálós szerkezet 3D ionos fémek vegyületek ötvözetek molekulák atomrácsos vegyületek szilárd gázok, folyadékok, szilárd anyagok Gázok


1. Elektromos alapjelenségek

1. Elektromos alapjelenségek 1. Elektromos alapjelenségek 1. Bizonyos testek dörzsölés hatására különleges állapotba kerülhetnek: más testekre vonzerőt fejthetnek ki, apróbb tárgyakat magukhoz vonzhatnak. Ezt az állapotot elektromos


Általános Kémia, BMEVESAA101

Általános Kémia, BMEVESAA101 Általános Kémia, BMEVESAA101 Dr Csonka Gábor, egyetemi tanár Az anyag Készítette: Dr. Csonka Gábor egyetemi tanár, csonkagi@gmail.com 1 Jegyzet Dr. Csonka Gábor http://web.inc.bme.hu/csonka/ Óravázlatok:


Általános Kémia, BMEVESAA101 Dr Csonka Gábor, egyetemi tanár. Az anyag Készítette: Dr. Csonka Gábor egyetemi tanár,

Általános Kémia, BMEVESAA101 Dr Csonka Gábor, egyetemi tanár. Az anyag Készítette: Dr. Csonka Gábor egyetemi tanár, Általános Kémia, BMEVESAA101 Dr Csonka Gábor, egyetemi tanár Az anyag Készítette: Dr. Csonka Gábor egyetemi tanár, csonkagi@gmail.com 1 Jegyzet Dr. Csonka Gábor http://web.inc.bme.hu/csonka/ Facebook,


ELEKTROSZTATIKA. Ma igazán feltöltődhettek!

ELEKTROSZTATIKA. Ma igazán feltöltődhettek! ELEKTROSZTATIKA Ma igazán feltöltődhettek! Elektrosztatikai alapismeretek THALÉSZ: a borostyánt (élektron) megdörzsölve az a könnyebb testeket magához vonzza. Elektrosztatikai alapjelenségek Az egymással


Fizika 1 Elektrodinamika belépő kérdések

Fizika 1 Elektrodinamika belépő kérdések Fizika 1 Elektrodinamika belépő kérdések 1) Maxwell-egyenletek lokális (differenciális) alakja rot H = j+ D rot = B div B=0 div D=ρ H D : mágneses térerősség : elektromos megosztás B : mágneses indukció


Elektrosztatikai alapismeretek

Elektrosztatikai alapismeretek Elektrosztatikai alapismeretek THALÉSZ: a borostyánt (élektron) megdörzsölve az a könnyebb testeket magához vonzza. Az egymással szorosan érintkező anyagok elektromosan feltöltődnek, elektromos állapotba


Kémiai reakciók mechanizmusa számítógépes szimulációval

Kémiai reakciók mechanizmusa számítógépes szimulációval Kémiai reakciók mechanizmusa számítógépes szimulációval Stirling András stirling@chemres.hu Elméleti Kémiai Osztály Budapest Stirling A. (MTA Kémiai Kutatóközpont) Reakciómechanizmus szimulációból 2007.


A válaszok között több is lehet helyes. Minden hibás válaszért egy pontot levonunk.

A válaszok között több is lehet helyes. Minden hibás válaszért egy pontot levonunk. A válaszok között több is lehet helyes. Minden hibás válaszért egy pontot levonunk. 1) Villamos töltések rekombinációja a) mindig energia felszabadulással jár; b) energia felvétellel jár; c) nincs kapcsolata


Lemez- és gerendaalapok méretezése

Lemez- és gerendaalapok méretezése Lemez- és gerendaalapok méretezése Az alapmerevség hatása az alap hajlékony merev a talpfeszültség egyenletes széleken nagyobb a süllyedés teknıszerő egyenletes Terhelés hatása hajlékony alapok esetén


A Casimir effektus és a fizikai vákuum

A Casimir effektus és a fizikai vákuum A Casimir effektus és a fizikai vákuum Takács Gábor MTA-ELTE Elméleti Fizikai Kutatócsoport ELTE Fizikai Intézet, Ortvay Kollokvium 2008. december 4. Vázlat 1 Bevezetés: QED és a Casimir effektus története


dinamikai tulajdonságai

dinamikai tulajdonságai Szilárdtest rácsok statikus és dinamikai tulajdonságai Szilárdtestek osztályozása kötéstípusok szerint Kötések eredete: elektronszerkezet k t ionok (atomtörzsek) tö Coulomb- elektronok kölcsönhatás lokalizáltak


Tantárgycím: Kísérleti Fizika II. (Elektrodinamika és Optika)

Tantárgycím: Kísérleti Fizika II. (Elektrodinamika és Optika) Eötvös Loránd Tudományegyetem Természettudományi Kar TANTÁRGYI ADATLAP és tantárgyi követelmények 2006/07 Földtudományi Szak Kötelező tantárgy Tantárgycím: Kísérleti Fizika II. (Elektrodinamika és Optika)


Megoldott feladatok november 30. n+3 szigorúan monoton csökken, 5. n+3. lim a n = lim. n+3 = 2n+3 n+4 2n+1

Megoldott feladatok november 30. n+3 szigorúan monoton csökken, 5. n+3. lim a n = lim. n+3 = 2n+3 n+4 2n+1 Megoldott feladatok 00. november 0.. Feladat: Vizsgáljuk az a n = n+ n+ sorozat monotonitását, korlátosságát és konvergenciáját. Konvergencia esetén számítsuk ki a határértéket! : a n = n+ n+ = n+ n+ =


Elektrosztatikus modell fragmens méretű ligandumok fehérje komplexeinek vizsgálatára

Elektrosztatikus modell fragmens méretű ligandumok fehérje komplexeinek vizsgálatára Elektrosztatikus modell fragmens méretű ligandumok fehérje komplexeinek vizsgálatára Szakdolgozat Vegyész Mesterszak KISS DÓRA JUDIT Témavezető: Dr. Ferenczy György MTA TTK Gyógyszerkémiai Kutatócsoport



A TÖMEGSPEKTROMETRIA ALAPJAI A TÖMEGSPEKTROMETRIA ALAPJAI web.inc.bme.hu/csonka/csg/oktat/tomegsp.doc alapján tömeg-töltés arány szerinti szétválasztás a legérzékenyebb módszerek közé tartozik (Nagyon kis anyagmennyiség kimutatására


Elektromágneses hullámok

Elektromágneses hullámok Bevezetés a modern fizika fejezeteibe 2. (a) Elektromágneses hullámok Utolsó módosítás: 2015. október 3. 1 A Maxwell-egyenletek (1) (2) (3) (4) E: elektromos térerősség D: elektromos eltolás H: mágneses


Elektrokémia 01. Fogalmak, Elektrokémia, Elektroanalitika, Elektródok. Láng Győző

Elektrokémia 01. Fogalmak, Elektrokémia, Elektroanalitika, Elektródok. Láng Győző Elektrokémia 01. Fogalmak, Elektrokémia, Elektroanalitika, Elektródok Láng Győző Kémiai Intézet, Fizikai Kémiai Tanszék Eötvös Loránd Tudományegyetem Budapest Elektrokémia Elektrokémia: Egy ma már klasszikusnak



TARTALOMJEGYZÉK EL SZÓ... 13 TARTALOMJEGYZÉK EL SZÓ... 13 1. A TÖLTÉS ÉS ELEKTROMOS TERE... 15 1.1. Az elektromos töltés... 15 1.2. Az elektromos térer sség... 16 1.3. A feszültség... 18 1.4. A potenciál és a potenciálfüggvény...


A munkavégzés a rendszer és a környezete közötti energiacserének a D hőátadástól eltérő valamennyi más formája.

A munkavégzés a rendszer és a környezete közötti energiacserének a D hőátadástól eltérő valamennyi más formája. 11. Transzportfolyamatok termodinamikai vonatkozásai 1 Melyik állítás HMIS a felsoroltak közül? mechanikában minden súrlódásmentes folyamat irreverzibilis. disszipatív folyamatok irreverzibilisek. hőmennyiség


Radioaktív sugárzások tulajdonságai és kölcsönhatásuk az elnyelő közeggel. A radioaktív sugárzások detektálása.

Radioaktív sugárzások tulajdonságai és kölcsönhatásuk az elnyelő közeggel. A radioaktív sugárzások detektálása. Különböző sugárzások tulajdonságai Típus töltés Energia hordozó E spektrum Radioaktí sugárzások tulajdonságai és kölcsönhatásuk az elnyelő közeggel. A radioaktí sugárzások detektálása. α-sugárzás pozití


Folyadékfázisú relaxációs folyamatok tanulmányozása a szolvatált elektron modelljének kvantum molekuladinamikai szimulációjával.

Folyadékfázisú relaxációs folyamatok tanulmányozása a szolvatált elektron modelljének kvantum molekuladinamikai szimulációjával. Folyadékfázisú relaxációs folyamatok tanulmányozása a szolvatált elektron modelljének kvantum molekuladinamikai szimulációjával Doktori Értekezés Túri László ELTE TTK, Kémiai Intézet Budapest 2006 2006


Alap-ötlet: Karl Friedrich Gauss ( ) valószínűségszámítási háttér: Andrej Markov ( )

Alap-ötlet: Karl Friedrich Gauss ( ) valószínűségszámítási háttér: Andrej Markov ( ) Budapesti Műszaki és Gazdaságtudományi Egyetem Gépészmérnöki Kar Hidrodinamikai Rendszerek Tanszék, Budapest, Műegyetem rkp. 3. D ép. 334. Tel: 463-6-80 Fa: 463-30-9 http://www.vizgep.bme.hu Alap-ötlet:


Az elektromos kettősréteg. Az elektromos potenciálkülönbség eredete, értéke és az azt befolyásoló tényezők. Kolloidok stabilitása.

Az elektromos kettősréteg. Az elektromos potenciálkülönbség eredete, értéke és az azt befolyásoló tényezők. Kolloidok stabilitása. Az elektromos kettősréteg. Az elektromos potenciálkülönbség eredete, értéke és az azt befolyásoló tényezők. Kolloidok stabilitása. Adszorpció oldatból szilárd felületre Adszorpció oldatból Nem-elektrolitok


Ionok és dielektrikumok ionhomogén rendszereinek Monte Carlo szimulációs vizsgálata

Ionok és dielektrikumok ionhomogén rendszereinek Monte Carlo szimulációs vizsgálata MTA DOKTORI ÉRTEKEZÉS Ionok és dielektrikumok ionhomogén rendszereinek Monte Carlo szimulációs vizsgálata BODA DEZSŽ Pannon Egyetem Kémia Intézet, Fizikai Kémiai Intézeti Tanszék Veszprém 212 Szüleimnek.


Kolloidstabilitás. Berka Márta 2010/2011/II

Kolloidstabilitás. Berka Márta 2010/2011/II Kolloidstabilitás Berka Márta 2010/2011/II Kolloid stabilitáshoz taszítás kell. Sztérikus stabilizálás V R V S sztérikus stabilizálás: liofil kolloidok alkalmazása védőhatás adszorpció révén (természetes


Az elektronpályák feltöltődési sorrendje

Az elektronpályák feltöltődési sorrendje 3. előadás 12-09-17 2 12-09-17 Az elektronpályák feltöltődési sorrendje 3 Az elemek rendszerezése, a periódusos rendszer Elsőként Dimitrij Ivanovics Mengyelejev és Lothar Meyer vette észre az elemek halmazában


Molekuláris motorok működése

Molekuláris motorok működése Biológiai molekuláris motorok tulajdonságai Molekuláris motorok működése Osváth Szabolcs Semmelweis Egyetem - anyaguk lágy (biopolimerek) - nem kovalens kölcsönhatások vezérlik a működést - nincsenek sima


Sillabusz orvosi kémia szemináriumokhoz 1. Kémiai kötések

Sillabusz orvosi kémia szemináriumokhoz 1. Kémiai kötések Sillabusz orvosi kémia szemináriumokhoz 1. Kémiai kötések Pécsi Tudományegyetem Általános Orvostudományi Kar 2010-2011. 1 A vegyületekben az atomokat kémiai kötésnek nevezett erők tartják össze. Az elektronok


1D multipulzus NMR kísérletek

1D multipulzus NMR kísérletek D multipulzus NMR kísérletek Rohonczy János ELTE, Szervetlen Kémia Tanszék Modern szerkezetkutatási módszerek elıadás 202. . Protonlecsatolt heteronukleáris mérések Elv 3 C mag detektálása alatt a protoncsatornán


Égés és oltáselmélet I. (zárójelben a helyes válaszra adott pont)

Égés és oltáselmélet I. (zárójelben a helyes válaszra adott pont) Égés és oltáselmélet I. (zárójelben a helyes válaszra adott pont) 1. "Az olyan rendszereket, amelyek határfelülete a tömegáramokat megakadályozza,... rendszernek nevezzük" (1) 2. "Az olyan rendszereket,



A BIOLÓGIAI JELENSÉGEK FIZIKAI HÁTTERE Zimányi László A BIOLÓGIAI JELENSÉGEK FIZIKAI HÁTTERE Zimányi László Összefoglalás A négy alapvető fizikai kölcsönhatás közül az elektromágneses kölcsönhatásnak van fontos szerepe a biológiában. Atomi és molekuláris


Szilárdtestek el e ek e tr t o r n o s n zer e k r ez e et e e t

Szilárdtestek el e ek e tr t o r n o s n zer e k r ez e et e e t Szilárdtestek elektronszerkezete Kvantummechanikai leírás Ismétlés: Schrödinger egyenlet, hullámfüggvény, hidrogén-atom, spin, Pauli-elv, periódusos rendszer 2 Szilárdtestek egyelektron-modellje a magok


A kovalens kötés elmélete. Kovalens kötésű molekulák geometriája. Molekula geometria. Vegyértékelektronpár taszítási elmélet (VSEPR)

A kovalens kötés elmélete. Kovalens kötésű molekulák geometriája. Molekula geometria. Vegyértékelektronpár taszítási elmélet (VSEPR) 4. előadás A kovalens kötés elmélete Vegyértékelektronpár taszítási elmélet (VSEPR) az atomok kötő és nemkötő elektronpárjai úgy helyezkednek el a térben, hogy egymástól minél távolabb legyenek A központi


Alkalmazás a makrókanónikus sokaságra: A fotongáz

Alkalmazás a makrókanónikus sokaságra: A fotongáz Alkalmazás a makrókanónikus sokaságra: A fotongáz A fotonok az elektromágneses sugárzás hordozó részecskéi. Spinkvantumszámuk S=, tehát kvantumstatisztikai szempontból bozonok. Fotonoknak habár a spinkvantumszámuk,


Termodinamikai bevezető

Termodinamikai bevezető Termodinamikai bevezető Alapfogalmak Termodinamikai rendszer: Az univerzumnak az a részhalmaza, amit egy termodinamikai vizsgálat során vizsgálunk. Termodinamikai környezet: Az univerzumnak a rendszeren


Tartalomjegyzék. Emlékeztetõ. Emlékeztetõ. Spektroszkópia. Fényelnyelés híg oldatokban A fény; Abszorpciós spektroszkópia

Tartalomjegyzék. Emlékeztetõ. Emlékeztetõ. Spektroszkópia. Fényelnyelés híg oldatokban A fény;  Abszorpciós spektroszkópia Tartalomjegyzék PÉCS TUDOMÁNYEGYETEM ÁLTALÁNOS ORVOSTUDOMÁNY KAR A fény; Abszorpciós spektroszkópia Elektromágneses hullám kölcsönhatása anyaggal; (Nyitrai Miklós; 2015 január 27.) Az abszorpció mérése;


CD-spektroszkópia. Az ORD spektroskópia alapja

CD-spektroszkópia. Az ORD spektroskópia alapja CD-spektroszkópia Az ORD spektroskópia alapja - A XIX. század elején Biot megfigyelte, hogy bizonyos, a természetben előforduló szerves anyagok a lineárisan polarizált fény síkját elforgatják. - 1817-ben


MedInProt Szinergia IV. program. Szerkezetvizsgáló módszer a rendezetlen fehérjék szerkezetének és kölcsönhatásainak jellemzésére

MedInProt Szinergia IV. program. Szerkezetvizsgáló módszer a rendezetlen fehérjék szerkezetének és kölcsönhatásainak jellemzésére MedInProt Szinergia IV. program Szerkezetvizsgáló módszer a rendezetlen fehérjék szerkezetének és kölcsönhatásainak jellemzésére Tantos Ágnes MTA TTK Enzimológiai Intézet, Rendezetlen fehérje kutatócsoport


Mérési struktúrák

Mérési struktúrák Mérési struktúrák 2007.02.19. 1 Mérési struktúrák A mérés művelete: a mérendő jellemző és a szimbólum halmaz közötti leképezés megvalósítása jel- és rendszerelméleti aspektus mérési folyamat: a leképezést


= Φ B(t = t) Φ B (t = 0) t

= Φ B(t = t) Φ B (t = 0) t 4. Gyakorlat 32B-3 Egy ellenállású, r sugarú köralakú huzalhurok a B homogén mágneses erőtér irányára merőleges felületen fekszik. A hurkot gyorsan, t idő alatt 180 o -kal átforditjuk. Számitsuk ki, hogy


Fizika A2 Alapkérdések

Fizika A2 Alapkérdések Fizika A2 Alapkérdések Összeállította: Dr. Pipek János, Dr. zunyogh László 20. február 5. Elektrosztatika Írja fel a légüres térben egymástól r távolságban elhelyezett Q és Q 2 pontszer pozitív töltések


Komplex rendszerek vizsgálata hibrid QM/MM molekuladinamikai szimulációkkal

Komplex rendszerek vizsgálata hibrid QM/MM molekuladinamikai szimulációkkal Komplex rendszerek vizsgálata hibrid QM/MM molekuladinamikai szimulációkkal Doktori értekezés tézisei Mones Letif Témavezetők: Dr. Túri László, PhD, DSc és Dr. Fuxreiter Mónika, PhD Elméleti és fizikai


Fehérjeszerkezet, és tekeredés

Fehérjeszerkezet, és tekeredés Fehérjeszerkezet, és tekeredés Futó Kinga 2013.10.08. Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983


Fizika A2 Alapkérdések

Fizika A2 Alapkérdések Fizika A2 Alapkérdések Az elektromágnesség elméletében a vektorok és skalárok (számok) megkülönböztetése nagyon fontos. A következ szövegben a vektorokat a kézírásban is jól használható nyíllal jelöljük


Rezgés, Hullámok. Rezgés, oszcilláció. Harmonikus rezgő mozgás jellemzői

Rezgés, Hullámok. Rezgés, oszcilláció. Harmonikus rezgő mozgás jellemzői Rezgés, oszcilláció Rezgés, Hullámok Fogorvos képzés 2016/17 Szatmári Dávid (david.szatmari@aok.pte.hu) 2016.09.26. Bármilyen azonos időközönként ismétlődő mozgást, periodikus mozgásnak nevezünk. A rezgési


Biológiai membránok fizikája, diffúzió, ozmózis Dr. Nagy László

Biológiai membránok fizikája, diffúzió, ozmózis Dr. Nagy László Biológiai membránok fizikája, diffúzió, ozmózis Dr. Nagy László -Az anyagcsere és a transzportfolyamatok. - Makrotranszport : jelentős anyagmennyiségek transzportja : csöveken, edényeken keresztül : nagyobb


Elektrosztatikai jelenségek

Elektrosztatikai jelenségek Elektrosztatikai jelenségek Ebonit vagy üveg rudat megdörzsölve az az apró tárgyakat magához vonzza. Két selyemmel megdörzsölt üvegrúd között taszítás, üvegrúd és gyapjúval megdörzsölt borostyánkő között


Kvantumos jelenségek lézertérben

Kvantumos jelenségek lézertérben Kvantumos jelenségek lézertérben Atomfizika Benedict Mihály SZTE Elméleti Fizikai Tanszék Az előadást támogatta a TÁMOP-4.2.1/B-09/1/KONV-2010-0005 sz. Kutatóegyetemi Kiválósági Központ létrehozása a Szegedi


Kifejtendő kérdések június 13. Gyakorló feladatok

Kifejtendő kérdések június 13. Gyakorló feladatok Kifejtendő kérdések 2016. június 13. Gyakorló feladatok 1. Adott egy egyenletes térfogati töltéssel rendelkező, R sugarú gömb, melynek felületén a potenciál U 0. Az elektromos potenciál definíciója (1p)


1 Műszaki hőtan Termodinamika. Ellenőrző kérdések-02 1

1 Műszaki hőtan Termodinamika. Ellenőrző kérdések-02 1 1 Műszaki hőtan Termodinamika. Ellenőrző kérdések-02 1 Kérdések. 1. Mit mond ki a termodinamika nulladik főtétele? Azt mondja ki, hogy mindenegyes termodinamikai kölcsönhatáshoz tartozik a TDR-nek egyegy


A Coulomb-törvény : 4πε. ahol, = coulomb = 1C. = a vákuum permittivitása (dielektromos álladója) elektromos térerősség : ponttöltés tere : ( r)

A Coulomb-törvény : 4πε. ahol, = coulomb = 1C. = a vákuum permittivitása (dielektromos álladója) elektromos térerősség : ponttöltés tere : ( r) Villamosságtan A Coulomb-tövény : F 1 = 1 Q1Q 4π ahol, [ Q ] = coulomb = 1C = a vákuum pemittivitása (dielektomos álladója) 1 4π 9 { k} = = 9 1 elektomos téeősség : E ponttöltés tee : ( ) F E = Q = 1 Q


Atomi, illetve molekuláris kölcsönhatások és alkalmazásaik

Atomi, illetve molekuláris kölcsönhatások és alkalmazásaik Atomi, illetve molekuláris kölcsönhatások és alkalmazásaik Bozó Tamás 2012. október 16. Atomi kölcsönhatások Nemesgázok: atomi előfordulás (He, Ne, Ar, Kr, Xe, Rn) Többi elem: molekulákat alkot (pl. H


Termelés- és szolgáltatásmenedzsment

Termelés- és szolgáltatásmenedzsment Termelés- és szolgáltatásmenedzsment egyetemi adjunktus Menedzsment és Vállalatgazdaságtan Tanszék Termelés- és szolgáltatásmenedzsment 13. Előrejelzési módszerek 14. Az előrejelzési modellek felépítése


A Coulomb-törvény : ahol, = coulomb = 1C. = a vákuum permittivitása (dielektromos álladója) k 9 10 F Q. elektromos térerősség : ponttöltés tere :

A Coulomb-törvény : ahol, = coulomb = 1C. = a vákuum permittivitása (dielektromos álladója) k 9 10 F Q. elektromos térerősség : ponttöltés tere : Villamosságtan A Coulomb-tövény : F QQ 4 ahol, Q = coulomb = C = a vákuum pemittivitása (dielektomos álladója) 4 9 k 9 elektomos téeősség : E F Q ponttöltés tee : E Q 4 Az elektosztatika I. alaptövénye


Mágneses mező jellemzése

Mágneses mező jellemzése pólusok dipólus mező mező jellemzése vonalak pólusok dipólus mező vonalak Tartalom, erőhatások pólusok dipólus mező, szemléltetése meghatározása forgatónyomaték méréssel Elektromotor nagysága különböző


11-12. évfolyam. A tantárgy megnevezése: elektrotechnika. Évi óraszám: 69. Tanítási hetek száma: 37 + 32. Tanítási órák száma: 1 óra/hét

11-12. évfolyam. A tantárgy megnevezése: elektrotechnika. Évi óraszám: 69. Tanítási hetek száma: 37 + 32. Tanítási órák száma: 1 óra/hét ELEKTROTECHNIKA (VÁLASZTHATÓ) TANTÁRGY 11-12. évfolyam A tantárgy megnevezése: elektrotechnika Évi óraszám: 69 Tanítási hetek száma: 37 + 32 Tanítási órák száma: 1 óra/hét A képzés célja: Választható tantárgyként


Membránok, nanopórusok, ioncsatornák és elektrokémiai kettősrétegek tulajdonságainak vizsgálata számítógépes szimulációkkal

Membránok, nanopórusok, ioncsatornák és elektrokémiai kettősrétegek tulajdonságainak vizsgálata számítógépes szimulációkkal Membránok, nanopórusok, ioncsatornák és elektrokémiai kettősrétegek tulajdonságainak vizsgálata számítógépes szimulációkkal Cél: A címben felsorolt inhomogén elektrolitikus rendszerek tulajdonságainak


Rendezetlen kondenzált fázisok tulajdonságainak vizsgálata számítógépes szimulációs módszerekkel

Rendezetlen kondenzált fázisok tulajdonságainak vizsgálata számítógépes szimulációs módszerekkel Rendezetlen kondenzált fázisok tulajdonságainak vizsgálata számítógépes szimulációs módszerekkel MTA doktori értekezés Írta: Jedlovszky Pál Eötvös Loránd Tudományegyetem Kémiai Intézet Budapest, 2006.


A T 038239. számú OTKA témapályázat zárójelentése

A T 038239. számú OTKA témapályázat zárójelentése A T 038239. számú OTKA témapályázat zárójelentése A dipólus-dipólus kölcsönhatás folyadékszerkezetre gyakorolt hatásának tanulmányozása ferrokolloidok és elektroreológiai fluidumok kísérleti és számítógépes


Immunszerológia I. Agglutináció, Precipitáció. Immunológiai és Biotechnológiai Intézet PTE-KK

Immunszerológia I. Agglutináció, Precipitáció. Immunológiai és Biotechnológiai Intézet PTE-KK Immunszerológia I. Agglutináció, Precipitáció Immunológiai és Biotechnológiai Intézet PTE-KK Antigén Antitest Alapok Antigén: vvt,, baktérium, latex gyöngy felszínén (µm( m nagyságú partikulum) Antitest:


Elektrosztatika. 1.2. Mekkora két egyenlő nagyságú töltés taszítja egymást 10 m távolságból 100 N nagyságú erővel? megoldás

Elektrosztatika. 1.2. Mekkora két egyenlő nagyságú töltés taszítja egymást 10 m távolságból 100 N nagyságú erővel? megoldás Elektrosztatika 1.1. Mekkora távolságra van egymástól az a két pontszerű test, amelynek töltése 2. 10-6 C és 3. 10-8 C, és 60 N nagyságú erővel taszítják egymást? 1.2. Mekkora két egyenlő nagyságú töltés


Földstatikai feladatok megoldási módszerei

Földstatikai feladatok megoldási módszerei Földstatikai feladatok megoldási módszerei Földstatikai alapfeladatok Földnyomások számítása Általános állékonyság vizsgálata Alaptörés parciális terhelés alatt Süllyedésszámítások Komplex terhelési esetek


Reakciókinetika és katalízis

Reakciókinetika és katalízis Reakciókinetika és katalízis k 4. előadás: 1/14 Különbségek a gázfázisú és az oldatreakciók között: 1 Reaktáns molekulák által betöltött térfogat az oldatreakciónál jóval nagyobb. Nincs akadálytalan mozgás.


Az Általános Relativitáselmélet problémáinak leküzdése alternatív modellek használatával. Ált. Rel. Szondy György ELFT tagja

Az Általános Relativitáselmélet problémáinak leküzdése alternatív modellek használatával. Ált. Rel. Szondy György ELFT tagja Az Általános Relativitáselmélet problémáinak leküzdése alternatív modellek használatával Szondy György ELFT tagja? GPS ELFT Fizikus Vándorgyűlés Szombathely, 2004. Augusztus 24.-27. Ált. Rel. GRAVITÁCIÓ


1) CO 2 hidrolízise a) semleges és b) bázikus körülmények között.

1) CO 2 hidrolízise a) semleges és b) bázikus körülmények között. A 20072011 években az OTKA támogatásával a következő témák indultak el: (A jelen felsorolás eltér attól a csoportosítástól, amit a pályázat megírásakor alkalmaztam, mivel a témák jobban áttekinthetők így.


TANMENET FIZIKA. 10. osztály. Hőtan, elektromosságtan. Heti 2 óra

TANMENET FIZIKA. 10. osztály. Hőtan, elektromosságtan. Heti 2 óra TANMENET FIZIKA 10. osztály Hőtan, elektromosságtan Heti 2 óra 2012-2013 I. Hőtan 1. Bevezetés Hőtani alapjelenségek 1.1. Emlékeztető 2. 1.2. A szilárd testek hőtágulásának törvényszerűségei. A szilárd


ESR-spektrumok különbözı kísérleti körülmények között A számítógépes értékelés alapjai anizotróp kölcsönhatási tenzorok esetén

ESR-spektrumok különbözı kísérleti körülmények között A számítógépes értékelés alapjai anizotróp kölcsönhatási tenzorok esetén ESR-spektrumok különbözı kísérleti körülmények között A számítógépes értékelés alapjai anizotróp kölcsönhatási tenzorok esetén A paraméterek anizotrópiája egykristályok rögzített tengely körüli forgatásakor


Hobbi Elektronika. Bevezetés az elektronikába: Ohm törvény, Kirchoff törvényei, soros és párhuzamos kapcsolás

Hobbi Elektronika. Bevezetés az elektronikába: Ohm törvény, Kirchoff törvényei, soros és párhuzamos kapcsolás Hobbi Elektronika Bevezetés az elektronikába: Ohm törvény, Kirchoff törvényei, soros és párhuzamos kapcsolás 1 Felhasznált irodalom Hodossy László: Elektrotechnika I. Torda Béla: Bevezetés az Elektrotechnikába


Elektromos áramerősség

Elektromos áramerősség Elektromos áramerősség Két különböző potenciálon lévő fémet vezetővel összekötve töltések áramlanak amíg a potenciál ki nem egyenlítődik. Az elektromos áram iránya a pozitív töltéshordozók áramlási iránya.


A mechanika alapjai. A pontszerű testek dinamikája

A mechanika alapjai. A pontszerű testek dinamikája A mechanika alapjai A pontszerű testek dinamikája Horváth András SZE, Fizika Tsz. v 0.6 1 / 26 alapi Bevezetés Newton I. Newton II. Newton III. Newton IV. alapi 2 / 26 Bevezetés alapi Bevezetés Newton



BUDAPESTI MŰSZAKI ÉS GAZDASÁGTUDOMÁNYI EGYETEM Szerves Kémia és Technológia Tanszék BÍRÁLAT BUDAPESTI MŰSZAKI ÉS GAZDASÁGTUDOMÁNYI EGYETEM Szerves Kémia és Technológia Tanszék BÍRÁLAT FUXREITER MÓNIKA A specifikus DNS felismerés molekuláris mechnizmusai című MTA Doktori értekezéséről (Debreceni


Abszorpciós spektroszkópia

Abszorpciós spektroszkópia Tartalomjegyzék Abszorpciós spektroszkópia (Nyitrai Miklós; 2011 február 1.) Dolgozat: május 3. 18:00-20:00. Egész éves anyag. Korábbi dolgozatok nem számítanak bele. Felmentés 80% felett. A fény; Elektromágneses


Mondatkiegészítések június 6.

Mondatkiegészítések június 6. Mondatkiegészítések 2016. június 6. Az alábbi típusú mondatkiegészítések jelentik az elméleti feladatok egy részét. A tapasztalat szerint ezek megoldásához a tárgyi tudás mellett szükség van egyfajta rutinra.


Fizika 2 - Gyakorló feladatok

Fizika 2 - Gyakorló feladatok 2016. május 9. ε o =8.85 10-12 AsV -1 m -1 μ o =4π10-7 VsA -1 m -1 e=1,6 10-19 C m e =9,11 10-31 kg m p =1,67 10-27 kg h=6,63 10-34 Js 1. Egy R sugarú gömbben -ρ állandó töltéssűrűség van. a. Határozza


Kontakt- vagy érintkezési feszültségek

Kontakt- vagy érintkezési feszültségek Kontakt- vagy érintkezési feszültségek A jelenség: Két különböző A felület mentén összeérintett 1. és 2. fém A és B pontjai között U k nagyságú ún. kontakt- vagy érintkezési feszültség lép fel. A kvalitatív



HIDROSZTATIKA, HIDRODINAMIKA HIDROSZTATIKA, HIDRODINAMIKA Hidrosztatika a nyugvó folyadékok fizikájával foglalkozik. Hidrodinamika az áramló folyadékok fizikájával foglalkozik. Folyadékmodell Önálló alakkal nem rendelkeznek. Térfogatuk


Szilárdtestek mágnessége. Mágnesesen rendezett szilárdtestek

Szilárdtestek mágnessége. Mágnesesen rendezett szilárdtestek Szilárdtestek mágnessége Mágnesesen rendezett szilárdtestek 2 Mágneses anyagok Permanens atomi mágneses momentumok: irány A kétféle spin-beállású elektronok betöltöttsége különbözik (spin-polarizáció)


Modellszámításokkal kapcsolatos kutatások bemutatása

Modellszámításokkal kapcsolatos kutatások bemutatása Modellszámításokkal kapcsolatos kutatások bemutatása Dr. Boda Dezső alprojektfelelős Fizikai Kémiai Tanszék Pannon Egyetem boda@almos.vein.hu 2013. május 31. Dr. Boda Dezső (Modellszámítások alprojekt)


Kvázisztatikus határeset Kritikus állapot Couette-teszt

Kvázisztatikus határeset Kritikus állapot Couette-teszt Wacha András Kvázisztatikus határeset Kritikus állapot Couette-teszt 2006. november 9. Kvázisztatikus határeset GDR_MiDi. On dense granular flows. Eur. Phys. J. E 14. pp 341-365 (2004). Dimenziótlan paraméterek
