Enzimek. Enzimek! IUBMB: szisztematikus nevek. Enzimek jellemzése! acetilkolin-észteráz! legalább 10 nagyságrend gyorsulás. szubsztrát-specificitás

Save this PDF as:

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "Enzimek. Enzimek! IUBMB: szisztematikus nevek. Enzimek jellemzése! acetilkolin-észteráz! legalább 10 nagyságrend gyorsulás. szubsztrát-specificitás"


1 Enzimek acetilkolin-észteráz! Enzimek! [s -1 ] enzim víz carbonic anhydrase 6x karbonikus anhidráz acetylcholine esterase 2x10 4 8x10-10 acetilkolin észteráz staphylococcal nuclease x10-14 sztafilokokkusz nukleáz acetilkolin-észteráz! legalább 10 nagyságrend gyorsulás IUBMB: szisztematikus nevek 1. Oxidoreduktázok dehidrogenázok (pl Alkohol:NAD oxido-reduktáz, alkohol dehidrogenáz) oxidázok oxigenázok peroxidázok katalázok 2. Transzferázok aminotranszferázok kinázok mutázok 3. Hidrolázok peptidázok foszfatázok foszfolipázok 4. Liázok dekarboxilázok aldolázok 5. Izomerázok racemázok mutázok epimerázok 6. Ligázok szintetázok karboxilázok reakciók, nagyságrendekkel gyorsabban mint vízben! Enzimek jellemzése! kimotripszin! kötődés reakció-sebesség hatékonyság / 1

2 Enzimek jellemzése! kimotripszin! S195, H57, D102! szubsztrát-kötő zseb aktív centrum katalitikus hely katalitikus aminosavak kémiai szerep v. nagy hozzájárulás! Proteolitikus enzimek A hasított kötés helye szerint: a) endopeptidázok b) exopeptidázok A katalitikus oldallánc alapján: a) szeril proteinázok b) ciszteinil proteinázok c) aszpartil proteinázok d) metalloproteinázok Enzim-mechanizmusok Szerin-proteázok (proteináz,peptidáz) Szerin proteinázok amid-kötés hasítása, hidrolízise (2 lépéses reakció) Kimotripszin! Tripszin! Peptidkötés-hasítás! Kimotripszin! kötődés (szelektivitás) reakció-sebesség hatékonyság / Arg, Lys! 2

3 Peptidkötés-hasítás - hasonló aktív hely más specificitás! Specifikus zseb! Specifikus zseb (sztérikus és elektrosztatikus komplementaritás) hidrofób aromás! pozitív! kis alifás! kimotripszin! tripszin! elasztáz! kimotripszin Enzim-szabászat! egyik specificitás másikba alakítása Tripszin szubsztrátkötő zsebének mutációs analízise Elmélet Asp189 Lys csere várható következménye: Lys, Arg specificitás Asp, Glu specificitás Tapasztalat neutrális (aromás) aminosavak preferenciája Gyenge kimitripszinszerű aktivitás enzim P1 Arg szubsztrát P1 Lys szubsztrát Arg/Lys / / rel. / tripszin szubsztrátkötő zsebének mutációs analízise meglepő eredmények! Gly216, Gly ,9 10 0,1 10 Gly216, Ala226 0, ,0003 0, ,0005 0,5 Ala216, Gly226 0,7 30 0,02 0, , Ala216, Ala226 0, ,0001 0, , A szerin proteinázok működésének alapvető szerkezeti feltételei Szerin-proteinázok - katalízis! P1 Kimotripszin! szubsztrát-kötő zseb P2 aktív centrum katalitikus hely malaria merozoit szerin-proteáz S195, H57, D102! katalitikus aminosavak kémiai szerep v. nagy hozzájárulás! 3

4 Tripszin katalitikus triádjának mutációs analízise Evolúciós viszonyok! divergens evolúció! Ser221 Ala: His64 Asp: Ser221 Ala, His64 Asp < 10-6 / < 10-6 / < 10-6 / érdekes módon 3 Ala közel natív aktivitás mutációkor a víz-szerkezet is átrendeződik Tripszin - kimotripszin - elasztáz Szerin proteázok reakciómechanizmusa Evolúciós viszonyok! konvergens evolúció (nincs szekv. hasonlóság)! Szubtilizin kimotripszin Peptidkötés-hasítás - mechanizmus Ser, His, Asp! Peptidkötés-hasítás - nincs töltésátmenet az Asp/Glu-ra! ROSSZ proton transzfer Asp-ra? charge-relay??? + JÓ elektrosztatikus stabilizáció 4

5 Peptidkötés-hasítás - nincs töltésátmenet az Asp/Glu-ra! acetilkolin-észteráz Aktiválódás (zimogén) Kimotripszinogén - kimotripszin JÓ elektrosztatikus stabilizáció 3 lánc 2 diszulfid híd Aktiválódás (zimogén) Az enzimatikus katalízis Kimotripszinogén - kimotripszin 3 lánc 2 diszulfid híd Mi az átmeneti állapot (transition state)?! nem katalizált legmagasabb energiájú állapot a reakciókoordináta mentén! katalizált egyébként? nyeregpont!!!!! reakciókoordináta Jelentős gát-csökkenés a nem katalizált reakcióhoz képest 5

6 Enzimreakciók Reaktánsok destabilizálása (DRS)! Átmeneti állapot stabilizálása (TSS)! Elméletek! Energia p w R TS P Reakciókoordináta entrópia, sztérikus feszültség,! deszolvatáció Energia w R p TS deszolvatáció P Reakciókoordináta entrópia! sztérikus hatások! dinamikus hatások! deszolvatáció! alacsony energiájú hidrogénkötések! kvantum effektusok (tunneling)! elektrosztatikus effektusok (szolvatáció)! Sztérikus feszültség (Steric strain hypothesis) A katalízis hajtóereje, hogy ez enzim a kindulási anyagok geometriáját destabilizálja és az átmeneti állapothoz hasonlóvá teszi (feszültség) Sztérikus feszültség (Steric strain hypothesis) Lizozim ( oligoszacharidok hidrolízisét katalizálja) ROR + AH ROH + R +A - R + +A - + R OH ROH + AH +R OH Energia TS p w R P TS: kád (sofa) konformáció Alapállapot enzimben: kád (sofa) konformáció csökken ROSSZ Reakciókoordináta vizes közeghez képest csak 150x gyorsulás Acetilkolin-észteráz Deszolvatáció! Orotidin Monofoszfát dekarboxiláz! Hipotézis: aromás oldalláncok szerepe a gázfázis-szerű környezet kialakítása átmeneti állapot stabilizációjának számítása apoláros enzimben destabilizálás antikatalízis ( / )/k non ~ a leghatékonyabb enzim /k w ~ (fehérje-főlánc hidrofil) Lee és Houk (1997) Science 92, pp

7 Deszolvatáció! Orotidin Monofoszfát dekarboxiláz! Deszolvatáció????! Orotidin Monofoszfát dekarboxiláz! Asp-70 és Asp-75 lizin! lizin! NH 3 +! NH 2! gáz???! pre-organizált környezet célja: TS stabilizáció és NEM G.S. destabilizáció ODCase fő katalitikus eleme: az alacsony dielektromos állandójú környezet, mely hasonlóvá teszi a reakciót a gázfázishoz Warshel és mtsai (2000) Biochemistry USA 39, pp A fehérjék úgy evolválódtak, hogy a feltekeredett fehérje aminosavainak dipólusai tökéletes szolvatációt biztosítsanak a katalizált reakció átmeneti állapotának. Mivel pre-orientált dipólusok elrendeződése megfelel a reakció átmeneti állapotának, az enzimkörnyezet kis átalakuláson megy keresztül míg a reakció a reaktánsoktól a végállapotba jut. Ezért az enzimatikus effektus elektrosztatikus hatásokon keresztül fejeződik ki, mely az oldott anyag és a fehérje állandó dipólusai között jön létre. A dipólusok megfelelő elrendeződéséhez szükséges energia a feltekeredés során fektetődik be. Az enzimek tehát az általuk katalizált reakció szuper-oldószerei, mely a TS állapotnak komplementer környezetet biztosít. Annak ellenére, hogy néhány oldallánc kiemelkedő hozzájárulást ad a reakció energiagátjának csökkentéséhez, az aktiválási energia csökkentése nem bontható egyszerűen komponensekre. Evolúciós viszonyok! konvergens evolúció (nincs szekv. hasonlóság)! Szubtilizin 7

Elektrosztatikus számítások. Elektrosztatikus számítások. Elektrosztatikus számítások. Elektrosztatikus számítások Definíciók

Elektrosztatikus számítások. Elektrosztatikus számítások. Elektrosztatikus számítások. Elektrosztatikus számítások Definíciók Jelentősége szubsztrát kötődés szolvatáció ionizációs állapotok (pka) mechanizmus katalízis ioncsatornák szimulációk (szerkezet) all-atom dipolar fluid dipolar lattice continuum Definíciók töltéseloszlás


A glükóz reszintézise.

A glükóz reszintézise. A glükóz reszintézise. A glükóz reszintézise. A reszintézis nem egyszerű megfordítása a glikolízisnek. A glikolízis 3 irrevezibilis lépése más úton játszódik le. Ennek oka egyrészt energetikai, másrészt


Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis

Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis Szerkezet Protein Data Bank (PDB) http://www.rcsb.org/pdb ~ 35 701 szerkezet közepes felbontás 1552 szerkezet d 1.5 Å 160 szerkezet d 1.0 Å 10 szerkezet d 0.8 Å (atomi felbontás) E globális minimum? funkció


Az enzimek katalitikus aktivitású fehérjék. Jellemzőik: bonyolult szerkezet, nagy molekulatömeg, kolloidális sajátságok, alakváltozás, polaritás.

Az enzimek katalitikus aktivitású fehérjék. Jellemzőik: bonyolult szerkezet, nagy molekulatömeg, kolloidális sajátságok, alakváltozás, polaritás. Enzimek Az enzimek katalitikus aktivitású fehérjék Jellemzőik: bonyolult szerkezet, nagy molekulatömeg, kolloidális sajátságok, alakváltozás, polaritás. Az enzim lehet: csak fehérje: Ribonukleáz A, lizozim,



ENZIMSZINTŰ SZABÁLYOZÁS ENZIMEK 1833.: Sörfőzés kapcsán kezdtek el vele foglalkozni (csírázó árpa vizsgálata) valamilyen anyag katalizátorként működik (Berzelius, 1835.) 1850. körül: ez valamilyen N-tartalmú szervesanyag 1874.:


A fehérjék hierarchikus szerkezete

A fehérjék hierarchikus szerkezete Fehérjék felosztása A fehérjék hierarchikus szerkezete Smeller László Semmelweis Egyetem Biofizikai és Sugárbiológiai Intézet Biológiai funkció alapján Enzimek (pl.: tripszin, citokróm-c ) Transzportfehérjék


A polipeptidlánc szabályozott lebontása: mit mondanak a fehérjekristályok? Harmat Veronika ELTE Kémiai Intézet, Szerkezeti Kémia és Biológia Laboratórium MTA-ELTE Fehérjemodellező Kutatócsoport A magyar


Acetil-kolin észteráz

Acetil-kolin észteráz Acetil-kolin észteráz Két izoenzim, különböző enzim aktivitással: vörösvértestben és trombocitákban valódi acetil-kolin észteráz; nagy sebességgel hidrolizálja az acetil-kolint, bizonyos acetil-kolin koncentráció


A fehérjék hierarchikus szerkezete

A fehérjék hierarchikus szerkezete Fehérjék felosztása A fehérjék hierarchikus szerkezete Smeller László Semmelweis Egyetem Biofizikai és Sugárbiológiai Intézet Biológiai funkció alapján Enzimek (pl.: tripszin, citokróm-c ) Transzportfehérjék


Az élelmiszer-tudomány szempontjából legfontosabb enzimek

Az élelmiszer-tudomány szempontjából legfontosabb enzimek Az élelmiszer-tudomány szempontjából legfontosabb enzimek xidoreduktázok: Hidrogén- vagy elektronátvitelt (oxigénbevitelt) katalizálnak. Dehidrogenázok: H-donort oxidálják, H-akceptort redukálják xidázok:


Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek

Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek Hidroxikarbonsavak α-hidroxi karbonsavak -Glikolsav (kézkrémek) - Tejsav (tejtermékek, izomláz, fogszuvasodás) - Citromsav (citrusfélékben,


Kutatási eredményeim a 2014 február 1- augusztus 31. a Varga József Alapítvány Pungor Ernő doktorjelölti ösztöndíjas időszak során

Kutatási eredményeim a 2014 február 1- augusztus 31. a Varga József Alapítvány Pungor Ernő doktorjelölti ösztöndíjas időszak során Kutatási eredményeim a 2014 február 1- augusztus 31. a Varga József Alapítvány Pungor Ernő doktorjelölti ösztöndíjas időszak során 1. projekt Kvaterner ammónium ligandot használó enzimek ligand kötőhelyének


Aminosav anyagcsere. Dr. Vér Ágota Egyetemi docens 2012

Aminosav anyagcsere. Dr. Vér Ágota Egyetemi docens 2012 Aminosav anyagcsere Dr. Vér Ágota Egyetemi docens 2012 A NITROGÉN EGYENSÚLY Esszenciális és nem esszenciális aminosavak 1. Mennyiségi szükséglet Fehérje bevitel: 0,8 g/ts.kg /nap 1,0-1,1 g/ts.kg /nap :


A piruvát-dehidrogenáz komplex. Csala Miklós

A piruvát-dehidrogenáz komplex. Csala Miklós A piruvát-dehidrogenáz komplex Csala Miklós szénhidrátok fehérjék lipidek glikolízis glukóz aminosavak zsírsavak acil-koa szintetáz e - piruvát acil-koa légz. lánc H + H + H + O 2 ATP szint. piruvát H


A fehérjék harmadlagos vagy térszerkezete. Még a globuláris fehérjék térszerkezete is sokféle lehet.

A fehérjék harmadlagos vagy térszerkezete. Még a globuláris fehérjék térszerkezete is sokféle lehet. A fehérjék harmadlagos vagy térszerkezete Még a globuláris fehérjék térszerkezete is sokféle lehet. A ribonukleáz redukciója és denaturálódása Chrisian B. Anfinsen A ribonukleáz renaturálódása 1972 obel-díj


ZSÍRSAVAK OXIDÁCIÓJA. FRANZ KNOOP német biokémikus írta le először a mechanizmusát. R C ~S KoA. a, R-COOH + ATP + KoA R C ~S KoA + AMP + PP i

ZSÍRSAVAK OXIDÁCIÓJA. FRANZ KNOOP német biokémikus írta le először a mechanizmusát. R C ~S KoA. a, R-COOH + ATP + KoA R C ~S KoA + AMP + PP i máj, vese, szív, vázizom ZSÍRSAVAK XIDÁCIÓJA FRANZ KNP német biokémikus írta le először a mechanizmusát 1 lépés: a zsírsavak aktivációja ( a sejt citoplazmájában, rövid zsírsavak < C12 nem aktiválódnak)


Enzim-katalizált (biokatalitikus) reakcióutak tervezése. Schönstein László Enzimtechnológiai Fejlesztő Csoport Debrecen, November 11.

Enzim-katalizált (biokatalitikus) reakcióutak tervezése. Schönstein László Enzimtechnológiai Fejlesztő Csoport Debrecen, November 11. Enzim-katalizált (biokatalitikus) reakcióutak tervezése Schönstein László Enzimtechnológiai Fejlesztő Csoport Debrecen, 2016. November 11. ENANTIOMEREK JELENTŐSÉGE A GYÓGYSZERKUTATÁSBAN Mik az enantiomerek?


Reakciókinetika és katalízis

Reakciókinetika és katalízis Reakciókinetika és katalízis 14. előadás: Enzimkatalízis 1/24 Alapfogalmak Enzim: Olyan egyszerű vagy összetett fehérjék, amelyek az élő szervezetekben végbemenő reakciók katalizátorai. Szubsztrát: A reakcióban


Bioinformatika 2 5.. előad

Bioinformatika 2 5.. előad 5.. előad adás Prof. Poppe László BME Szerves Kémia és Technológia Tsz. Bioinformatika proteomika Előadás és gyakorlat 2009. 03. 21. Fehérje térszerkezet t megjelenítése A fehérjék meglehetősen összetett


9. Előadás Fehérjék Előzmények Peptidkémia Analitikai kémia Protein kémia 1901 E.Fischer : Gly-Gly 1923 F. Pregl : Mikroanalitika 1952 Stein and Moore : Aminosav analizis 1932 Bergman és Zervas : Benziloxikarbonil


OTKA nyilvántartási szám: F Töltéssel rendelkező oldalláncok szerepe retrovirális proteinázok szubsztrát-specificitásában Az elmúlt évtizedek

OTKA nyilvántartási szám: F Töltéssel rendelkező oldalláncok szerepe retrovirális proteinázok szubsztrát-specificitásában Az elmúlt évtizedek Az elmúlt évtizedek intenzív kutatásai ellenére is ma még komoly kihívást jelent az emberiség számára az évről évre egyre több áldozatot szedő betegség a szerzett immunhiányos szindróma (AIDS), amit a


Zsírsav szintézis. Az acetil-coa aktivációja: Acetil-CoA + CO + ATP = Malonil-CoA + ADP + P. 2 i

Zsírsav szintézis. Az acetil-coa aktivációja: Acetil-CoA + CO + ATP = Malonil-CoA + ADP + P. 2 i Zsírsav szintézis Az acetil-coa aktivációja: Acetil-CoA + CO + ATP = Malonil-CoA + ADP + P 2 i A zsírsav szintáz reakciói Acetil-CoA + 7 Malonil-CoA + 14 NADPH + 14 H = Palmitát + 8 CoA-SH + 7 CO 2 + 7


A Ca2+-ion hatása a szarvasmarha kimotripszin aktivitására, stabilitására, mozgékonyságára és szerkezetére

A Ca2+-ion hatása a szarvasmarha kimotripszin aktivitására, stabilitására, mozgékonyságára és szerkezetére Szakdolgozat A Ca2+-ion hatása a szarvasmarha kimotripszin aktivitására, stabilitására, mozgékonyságára és szerkezetére Készítette: Barabás Orsolya Témavezető: Náray-Szabó Gábor 2001 Köszönetnyilvánítás


Kémiai reakciók mechanizmusa számítógépes szimulációval

Kémiai reakciók mechanizmusa számítógépes szimulációval Kémiai reakciók mechanizmusa számítógépes szimulációval Stirling András stirling@chemres.hu Elméleti Kémiai Osztály Budapest Stirling A. (MTA Kémiai Kutatóközpont) Reakciómechanizmus szimulációból 2007.


Fehérjeszerkezet, és tekeredés

Fehérjeszerkezet, és tekeredés Fehérjeszerkezet, és tekeredés Futó Kinga 2013.10.08. Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983


Fémionok szerepe az élő szervezetben: a bioszervetlen kémia alapjainak megismerése

Fémionok szerepe az élő szervezetben: a bioszervetlen kémia alapjainak megismerése Fémionok szerepe az élő szervezetben: a bioszervetlen kémia alapjainak megismerése Előadó: Lihi Norbert Debreceni Egyetem Szervetlen és Analitikai Kémiai Tanszék Bioszervetlen Kémiai Kutatócsoport A bioszervetlen


Kémiai átalakulások. A kémiai reakciók körülményei. A rendszer energiaviszonyai

Kémiai átalakulások. A kémiai reakciók körülményei. A rendszer energiaviszonyai Kémiai átalakulások 9. hét A kémiai reakció: kötések felbomlása, új kötések kialakulása - az atomok vegyértékelektronszerkezetében történik változás egyirányú (irreverzibilis) vagy megfordítható (reverzibilis)


FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest,

FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest, FEHÉRJÉK A MÁGNESEKBEN Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium Alkímia Ma, Budapest, 2013.02.28. I. FEHÉRJÉK: L-α aminosavakból felépülő lineáris polimerek α H 2 N CH COOH amino


Célkitűzés/témák Fehérje-ligandum kölcsönhatások és a kötődés termodinamikai jellemzése

Célkitűzés/témák Fehérje-ligandum kölcsönhatások és a kötődés termodinamikai jellemzése Célkitűzés/témák Fehérje-ligandum kölcsönhatások és a kötődés termodinamikai jellemzése Ferenczy György Semmelweis Egyetem Biofizikai és Sugárbiológiai Intézet Biokémiai folyamatok - Ligandum-fehérje kötődés


Doktori értekezés. Kiss András László 2007. Témavezető: Polgár László professzor. 1. oldal

Doktori értekezés. Kiss András László 2007. Témavezető: Polgár László professzor. 1. oldal Doktori értekezés Kiss András László 2007 Témavezető: Polgár László professzor 1. oldal Acylaminoacyl peptidáz enzimek katalízisének vizsgálata A dolgozatot készítette: Biológia Doktori Iskola Szerkezeti


A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin.

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin. Myoglobin Fehérje-szerkezetek! MGLSDGEWQLVLNVWGKVEADIPGGQEVLIRLFK GPETLEKFDKFKLKSEDEMKASE DLKKGATVLTALGGILKKKGEAEIKPLAQSA TKKIPVKYLEFISECIIQVLQSK PGDFGADAQGAMNKALELFRKDMASNYKELGFQG Fuxreiter Mónika! Debreceni


Több szubsztrátos enzim-reakciókról beszélve két teljesen különbözõ rekció típust kell megismernünk.

Több szubsztrátos enzim-reakciókról beszélve két teljesen különbözõ rekció típust kell megismernünk. .5.Több szubsztrátos reakciók Több szubsztrátos enzim-reakciókról beszélve két teljesen különbözõ rekció típust kell megismernünk. A.) Egy enzim, ahhoz, hogy terméket képezzen, egyszerre több különbözõ


Kinetika. Általános Kémia, kinetika Dia: 1 /53

Kinetika. Általános Kémia, kinetika Dia: 1 /53 Kinetika 15-1 A reakciók sebessége 15-2 Reakciósebesség mérése 15-3 A koncentráció hatása: a sebességtörvény 15-4 Nulladrendű reakció 15-5 Elsőrendű reakció 15-6 Másodrendű reakció 15-7 A reakció kinetika


HŐ (q) és MUNKA (w): energia átmenet közben a rendszer és környezete között. A különböző energiafajták átalakulásukkor végső soron termikus energiává

HŐ (q) és MUNKA (w): energia átmenet közben a rendszer és környezete között. A különböző energiafajták átalakulásukkor végső soron termikus energiává TERMODINAMIKA 1 HŐ (q) és MUNKA (w): energia átmenet közben a rendszer és környezete között. A különböző energiafajták átalakulásukkor végső soron termikus energiává degradálódnak (disszipáció). BELSŐ


Anaerob fermentált szennyvíziszap jellemzése enzimaktivitás-mérésekkel

Anaerob fermentált szennyvíziszap jellemzése enzimaktivitás-mérésekkel Eötvös Loránd Tudományegyetem Természettudományi Kar Környezettudományi Centrum Anaerob fermentált szennyvíziszap jellemzése enzimaktivitás-mérésekkel készítette: Felföldi Edit környezettudomány szakos


Aminosavak általános képlete NH 2. Csoportosítás: R oldallánc szerkezete alapján: Semleges. Esszenciális aminosavak

Aminosavak általános képlete NH 2. Csoportosítás: R oldallánc szerkezete alapján: Semleges. Esszenciális aminosavak Aminosavak 1 Aminosavak általános képlete N 2 soportosítás: oldallánc szerkezete alapján: Apoláris Poláris Bázikus Savas Semleges Esszenciális aminosavak 2 (apoláris) Glicin Név Gly 3 Alanin Ala 3 3 Valin


A fehérjék szerkezete és az azt meghatározó kölcsönhatások

A fehérjék szerkezete és az azt meghatározó kölcsönhatások A fehérjék szerkezete és az azt meghatározó kölcsönhatások 1. A fehérjék szerepe az élõlényekben 2. A fehérjék szerkezetének szintjei 3. A fehérjék konformációs stabilitásáért felelõs kölcsönhatások 4.


A fehérjéket felépítő húsz standard aminosav Fehérjék szerkezetének kialakulása

A fehérjéket felépítő húsz standard aminosav Fehérjék szerkezetének kialakulása A fehérjéket felépítő húsz standard aminosav Fehérjék szerkezetének kialakulása Osváth Szabolcs Semmelweis Egyetem szabolcs.osvath@eok.sote.hu reakció t 1/2 25 ºC-on t 1/2 100 ºC-on DNS hidrolízis Biopolimerek



A METABOLIZMUS ENERGETIKÁJA A METABOLIZMUS ENERGETIKÁJA Futó Kinga 2014.10.01. Metabolizmus Metabolizmus = reakciók együttese, melyek a sejtekben lejátszódnak. Energia nyerés szempontjából vannak fototrófok ill. kemotrófok. szervesanyag


Fehérje szintézis 2. TRANSZLÁCIÓ Molekuláris biológia kurzus 7. hét. Kun Lídia Genetikai, Sejt- és immunbiológiai Intézet

Fehérje szintézis 2. TRANSZLÁCIÓ Molekuláris biológia kurzus 7. hét. Kun Lídia Genetikai, Sejt- és immunbiológiai Intézet Fehérje szintézis 2. TRANSZLÁCIÓ Molekuláris biológia kurzus 7. hét Kun Lídia Genetikai, Sejt- és immunbiológiai Intézet Gén mrns Fehérje Transzkripció Transzláció A transzkriptum : mrns Hogyan mutatható


MEDICINÁLIS ALAPISMERETEK BIOKÉMIA AZ AMINOSAVAK ANYAGCSERÉJE 1. kulcsszó cím: Az aminosavak szerepe a szervezetben

MEDICINÁLIS ALAPISMERETEK BIOKÉMIA AZ AMINOSAVAK ANYAGCSERÉJE 1. kulcsszó cím: Az aminosavak szerepe a szervezetben Modul cím: MEDICINÁLIS ALAPISMERETEK BIOKÉMIA AZ AMINOSAVAK ANYAGCSERÉJE 1. kulcsszó cím: Az aminosavak szerepe a szervezetben A szénhidrátokkal és a lipidekkel ellentétben szervezetünkben nincsenek aminosavakból


A biotranszformációs lépések áttekintése

A biotranszformációs lépések áttekintése A biotranszformációs lépések áttekintése gyógyszermolekula erősen lipofil lipofil poláros hidrofil metabolikusan stabil felhalmozódás (zsírszövet) I. fázis bioaktiváció vagy inaktiváció oxidáció, redukció,


Szentjánosbogár, trópusi halak, sarki fény Mi a közös a természet fénytüneményeiben?

Szentjánosbogár, trópusi halak, sarki fény Mi a közös a természet fénytüneményeiben? Szentjánosbogár, trópusi halak, sarki fény Mi a közös a természet fénytüneményeiben? Szalay Péter egyetemi tanár ELTE, Kémiai Intézet Elméleti Kémiai Laboratórium Van közös bennük? Egy kis történelem


Az élelmiszer-tudomány szempontjából legfontosabb enzimek

Az élelmiszer-tudomány szempontjából legfontosabb enzimek Az élelmiszer-tudomány szempontjából legfontosabb enzimek Oxidoreduktázok NAD és FAD koenzimekkel N HC NH 2 C C C N N CH N H H 2' OH O CH 2 H H OH O OH OH P O P O O O CH 2 H H OH O H C HC C CONH 2 HC +


Élelmiszer-fehérjék átalakulása a feldolgozás és tárolás során

Élelmiszer-fehérjék átalakulása a feldolgozás és tárolás során Élelmiszer-fehérjék átalakulása a feldolgozás és tárolás során Az aminosavak átalakulása a feldolgozás és tárolás során A fehérjék hőkezelése aminosavak deszulfurálódása, dezaminálódása, izomerizációja,



TRIPSZIN TISZTÍTÁSA AFFINITÁS KROMATOGRÁFIA SEGÍTSÉGÉVEL TRIPSZIN TISZTÍTÁSA AFFINITÁS KROMATOGRÁFIA SEGÍTSÉGÉVEL Az egyes biomolekulák izolálása kulcsfontosságú a biológiai szerepük tisztázásához. Az affinitás kromatográfia egyszerűsége, reprodukálhatósága


A biokémia alapjai. Typotex Kiadó. Wunderlich Lívius Szarka András

A biokémia alapjai. Typotex Kiadó. Wunderlich Lívius Szarka András A biokémia alapjai Wunderlich Lívius Szarka András Összefoglaló: A jegyzet elsősorban egészségügyi mérnök MSc. hallgatók részére íródott, de hasznos segítség lehet biomérnök és vegyészmérnök hallgatók


folsav, (a pteroil-glutaminsav vagy B 10 vitamin) dihidrofolsav tetrahidrofolsav N CH 2 N H H 2 N COOH

folsav, (a pteroil-glutaminsav vagy B 10 vitamin) dihidrofolsav tetrahidrofolsav N CH 2 N H H 2 N COOH folsav, (a pteroil-glutaminsav vagy B 10 vitamin) 2 2 2 2 pirimidin rész pirazin rész aminobenzoesav rész glutaminsav rész pteridin rész dihidrofolsav 2 2 2 2 tetrahidrofolsav 2 2 2 2 A dihidrofolát-reduktáz


1. A nitrogén körforgása

1. A nitrogén körforgása 1. A nitrogén körforgása 2. Fehérjék lebontása Táplálékfehérjék lebontása aminosavakká Saját fehérjék lebontása Féléletidő szabályozása Ubikvitin konjugáció Proteaszómális lebontás 3. Aminosavak lebontása


Szalay Péter (ELTE, Kémia Intézet) Szentjánosbogár, trópusi halak, sarki fény Mi a közös a természet fénytüneményeiben?

Szalay Péter (ELTE, Kémia Intézet) Szentjánosbogár, trópusi halak, sarki fény Mi a közös a természet fénytüneményeiben? Szalay Péter (ELTE, Kémia Intézet) Szentjánosbogár, trópusi halak, sarki fény Mi a közös a természet fénytüneményeiben? Boronkay György Műszaki Középiskola és Gimnázium Budapest, 2011. október 27. www.meetthescientist.hu



EGY AGYI SZERIN PROTEÁZ, A HUMÁN TRIPSZIN 4 FUNKCIONÁLIS VIZSGÁLATA EGY AGYI SZERIN PROTEÁZ, A HUMÁN TRIPSZIN 4 FUNKCIONÁLIS VIZSGÁLATA A humán tripszinogén 4 transzkripciójának vizsgálata valamint az enzim aktivációja és működése során bekövetkező szerkezeti átrendeződések


Receptorok és szignalizációs mechanizmusok

Receptorok és szignalizációs mechanizmusok Molekuláris sejtbiológia: Receptorok és szignalizációs mechanizmusok Dr. habil Kőhidai László Semmelweis Egyetem Genetikai, Sejt- és Immunbiológiai Intézet Sejtek szignalizációs kapcsolatai Sejtek szignalizációs


Doktori tézisek. Dr. Szmola Richárd. Semmelweis Egyetem Molekuláris Orvostudományok Doktori Iskola

Doktori tézisek. Dr. Szmola Richárd. Semmelweis Egyetem Molekuláris Orvostudományok Doktori Iskola Szabályozó hatású emésztőenzimek a krónikus pankreatitisz patomechanizmusában Doktori tézisek Dr. Szmola Richárd Semmelweis Egyetem Molekuláris Orvostudományok Doktori Iskola Témavezető: Dr. Sahin-Tóth





Fehérjék szerkezetének kialakulása II

Fehérjék szerkezetének kialakulása II Egy kis fehérje gombolyodása több párhuzamos úton Fehérjék szerkezetének kialakulása II Osváth Szabolcs Semmelweis Egyetem hélix kialakulás és kollapszus több párhuzamos úton további kollapszus és hélix


A sejtfelszíni receptorok három fő kategóriája

A sejtfelszíni receptorok három fő kategóriája A sejtfelszíni receptorok három fő kategóriája 1. Saját enzimaktivitás nélküli receptorok 1a. G proteinhez kapcsolt pl. adrenalin, szerotonin, glukagon, bradikinin receptorok 1b. Tirozin kinázhoz kapcsolt


S-2. Jelátviteli mechanizmusok

S-2. Jelátviteli mechanizmusok S-2. Jelátviteli mechanizmusok A sejtmembrán elválaszt és összeköt. Ez az információ-áramlásra különösen igaz! 2.1. A szignál-transzdukció elemi lépései Hírvivô (transzmitter, hormon felismerése = kötôdés


Engedélyszám: 18211-2/2011-EAHUF Verziószám: 1. 2447-06 Kémiai vizsgálatok követelménymodul szóbeli vizsgafeladatai

Engedélyszám: 18211-2/2011-EAHUF Verziószám: 1. 2447-06 Kémiai vizsgálatok követelménymodul szóbeli vizsgafeladatai 1. feladat Új kollégája a mai napon átveszi Öntől a fehérje ELFO vizsgálatokat. Magyarázza el kollégájának a vizsgálathoz szükséges tudnivalókat! Magyarázatában térjen ki a következőkre: - a szérum fehérje


Az oligopeptidázok szerkezete és működése: katalízis az S9A enzimcsaládban. A doktori értekezés tézisei. Juhász Tünde

Az oligopeptidázok szerkezete és működése: katalízis az S9A enzimcsaládban. A doktori értekezés tézisei. Juhász Tünde Az oligopeptidázok szerkezete és működése: katalízis az S9A enzimcsaládban A doktori értekezés tézisei Juhász Tünde Eötvös Loránd Tudományegyetem Biológia Doktori Iskola Iskolavezető: Prof. Erdei Anna,


3. Sejtalkotó molekulák III.

3. Sejtalkotó molekulák III. 3. Sejtalkotó molekulák III. Fehérjék, fehérjeszintézis (transzkripció, transzláció, posztszintetikus módosítások). Enzimműködés 3.1 Fehérjék A genetikai információ egyik fő manifesztálódása Számos funkció





A Ca 2+ szerepe a tormaperoxidáz enzim aktív szerkezetében. Szigeti Krisztián

A Ca 2+ szerepe a tormaperoxidáz enzim aktív szerkezetében. Szigeti Krisztián A Ca 2+ szerepe a tormaperoxidáz enzim aktív szerkezetében Doktori értekezés Szigeti Krisztián Semmelweis Egyetem Gyógyszertudományok Doktori Iskola Témavezető: Hivatalos Bírálók: Szigorlati Bizottság


Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete

Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete Polipeptidek térszerkezete Tipikus (rendezett) konformerek em tipikus (rendezetlen) konformerek Periodikus vagy homokonformerek Aperiodikus



INFORMATIKA EMELT SZINT% Szövegszerkesztés, prezentáció, grafika, weblapkészítés 1. A fényképezés története Táblázatkezelés 2. Maradékos összeadás Adatbázis-kezelés 3. Érettségi Algoritmizálás, adatmodellezés 4. Fehérje Maximális








Szénhidrátok monoszacharidok formájában szívódnak fel a vékonybélből.

Szénhidrátok monoszacharidok formájában szívódnak fel a vékonybélből. Vércukorszint szabályozása: Szénhidrátok monoszacharidok formájában szívódnak fel a vékonybélből. Szövetekben monoszacharid átalakítás enzimjei: Szénhidrát anyagcserében máj központi szerepű. Szénhidrát


AJÁNLOTT IRODALOM. A tárgy neve BIOKÉMIA I. Meghirdető tanszék(csoport) SZTE TTK, Biokémiai Tanszék Felelős oktató:

AJÁNLOTT IRODALOM. A tárgy neve BIOKÉMIA I. Meghirdető tanszék(csoport) SZTE TTK, Biokémiai Tanszék Felelős oktató: A tárgy neve BIOKÉMIA I. Meghirdető tanszék(csoport) SZTE TTK, Biokémiai Tanszék Felelős oktató: Dr Lehoczki Endréné Kredit 2 Heti óraszám 2 típus Előadás Számonkérés Kollokvium Teljesíthetőség feltétele


Tartalmi követelmények kémia tantárgyból az érettségin K Ö Z É P S Z I N T

Tartalmi követelmények kémia tantárgyból az érettségin K Ö Z É P S Z I N T 1. Általános kémia Atomok és a belőlük származtatható ionok Molekulák és összetett ionok Halmazok A kémiai reakciók A kémiai reakciók jelölése Termokémia Reakciókinetika Kémiai egyensúly Reakciótípusok


A sejtek élete. 5. Robotoló törpék és óriások Az aminosavak és fehérjék R C NH 2. C COOH 5.1. A fehérjeépítőaminosavak általános

A sejtek élete. 5. Robotoló törpék és óriások Az aminosavak és fehérjék R C NH 2. C COOH 5.1. A fehérjeépítőaminosavak általános A sejtek élete 5. Robotoló törpék és óriások Az aminosavak és fehérjék e csak nézd! Milyen protonátmenetes reakcióra képes egy aminosav? R 2 5.1. A fehérjeépítőaminosavak általános képlete 5.2. A legegyszerűbb


kutatás során legfőbb eredményeinket a szerin proteázok aktiválódásának mechanizmusával és az aktiválódás fiziológiai következményeinek

kutatás során legfőbb eredményeinket a szerin proteázok aktiválódásának mechanizmusával és az aktiválódás fiziológiai következményeinek Fehérjék konformációs flexibilitása mint a biomolekuláris felismerés és a jeltovábbítás alapvető eleme (OTKA NK 77978) Zárójelentés (2009. ápr. 1-től 2013. márc. 31-ig) A biológiai rendszerek önszerveződésének



BUDAPESTI MŰSZAKI ÉS GAZDASÁGTUDOMÁNYI EGYETEM Szerves Kémia és Technológia Tanszék BÍRÁLAT BUDAPESTI MŰSZAKI ÉS GAZDASÁGTUDOMÁNYI EGYETEM Szerves Kémia és Technológia Tanszék BÍRÁLAT FUXREITER MÓNIKA A specifikus DNS felismerés molekuláris mechnizmusai című MTA Doktori értekezéséről (Debreceni


NMR a peptid- és fehérje-kutatásban

NMR a peptid- és fehérje-kutatásban NMR a peptid- és fehérje-kutatásban A PDB adatbázisban megtalálható NMR alapú fehérjeszerkezetek számának alakulása az elmúlt évek során 4000 3500 3000 2500 2000 1500 1000 500 0 1987 1988 1989 1990 1991


Az oligopeptidázok szerkezete és működése: katalízis az S9A enzimcsaládban

Az oligopeptidázok szerkezete és működése: katalízis az S9A enzimcsaládban Az oligopeptidázok szerkezete és működése: katalízis az S9A enzimcsaládban Doktori értekezés Juhász Tünde Eötvös Loránd Tudományegyetem Biológia Doktori Iskola Iskolavezető: Prof. Erdei Anna, MTA levelező



A BIOLÓGIAI JELENSÉGEK FIZIKAI HÁTTERE Zimányi László A BIOLÓGIAI JELENSÉGEK FIZIKAI HÁTTERE Zimányi László Összefoglalás A négy alapvető fizikai kölcsönhatás közül az elektromágneses kölcsönhatásnak van fontos szerepe a biológiában. Atomi és molekuláris


, mitokondriumban (peroxiszóma) citoplazmában

, mitokondriumban (peroxiszóma) citoplazmában -helye: máj, zsírszövet, vese, agy, tüdő, stb. - nem a β-oxidáció megfordítása!!! β-oxidáció Zsírsav-szintézis -------------------------------------------------------------------------------------------


(neutrális lipidek) glicerofoszfolipidek szfingolipidek galactolipidek

(neutrális lipidek) glicerofoszfolipidek szfingolipidek galactolipidek TRIGLICERIDEK MEMBRÁN LIPIDEK (neutrális lipidek) FSZFLIPIDEK GLIKLIPIDEK glicerofoszfolipidek szfingolipidek galactolipidek MEMBRÁN LIPIDEK SZEREPE A legtöbb foszfolipid Foszfatidil-kolin Foszfatidil-kolin


DNS replikáció. DNS RNS Polipeptid Amino terminus. Karboxi terminus. Templát szál

DNS replikáció. DNS RNS Polipeptid Amino terminus. Karboxi terminus. Templát szál DNS replikáció DNS RNS Polipeptid Amino terminus Templát szál Karboxi terminus Szuper-csavarodott prokarióta cirkuláris DNS Hisztonok komplexe DNS hisztonokra történő felcsvarodása Hiszton-kötött negatív


A lektin út aktivációs modelljének korrigálása irányított evolúcióval létrehozott, monospecifikus MASP inhibitorok segítségével

A lektin út aktivációs modelljének korrigálása irányított evolúcióval létrehozott, monospecifikus MASP inhibitorok segítségével A lektin út aktivációs modelljének korrigálása irányított evolúcióval létrehozott, monospecifikus MASP inhibitorok segítségével Doktori (PhD) értekezés Héja Dávid Szerkezeti Biokémia Program, Biológia


1. Piroszőlősavvá bomló aminosavak

1. Piroszőlősavvá bomló aminosavak A szénlánc sorsa Lebontási sorozatok 1. Piroszőlősav csoport 2. Acetoacetil-CoA csoport 3. α- keto-glutársav csoport 4. Szukcinil-CoA csoport 5. Fumársav csoport 6. Oxálecetsav csoport 1. Piroszőlősavvá



Készült: Tananyag címe: Transzaminázok vizsgálata Szerző: Dr. Mótyán János András, egyetemi tanársegéd Biokémiai és Molekuláris Biológiai Intézet Általános Orvostudományi Kar Debreceni Egyetem Készült: 2014.12.01-2015.01.31.


4. FEHÉRJÉK. 2. Vázanyagok. Az izmok alkotórésze (pl.: a miozin). Inak, izületek, csontok szerves komponensei, az ún. vázfehérjék (szkleroproteinek).

4. FEHÉRJÉK. 2. Vázanyagok. Az izmok alkotórésze (pl.: a miozin). Inak, izületek, csontok szerves komponensei, az ún. vázfehérjék (szkleroproteinek). 4. FEÉRJÉK 4.0. Bevezetés A fehérjék elsısorban α-l-aminosavakból felépülı biopolimerek. A csak α-laminosavakat tartalmazó fehérjék a proteinek. evüket a görög proteios szóból kapták, ami elsırangút jelent.


Kolloidstabilitás. Berka Márta 2010/2011/II

Kolloidstabilitás. Berka Márta 2010/2011/II Kolloidstabilitás Berka Márta 2010/2011/II Kolloid stabilitáshoz taszítás kell. Sztérikus stabilizálás V R V S sztérikus stabilizálás: liofil kolloidok alkalmazása védőhatás adszorpció révén (természetes


Kémiai átalakulások. A kémiai reakciók körülményei. Általános és szervetlen kémia 9. hét. Elızı héten elsajátítottuk, hogy

Kémiai átalakulások. A kémiai reakciók körülményei. Általános és szervetlen kémia 9. hét. Elızı héten elsajátítottuk, hogy Általános és szervetlen kémia 9. hét Elızı héten elsajátítottuk, hogy a határfelületi jelenségeket és a kolloid rendszereket milyen sajátságok jellemzik Mai témakörök a kémiai reakciók csoportosítása,


Receptorok, szignáltranszdukció jelátviteli mechanizmusok

Receptorok, szignáltranszdukció jelátviteli mechanizmusok Receptorok, szignáltranszdukció jelátviteli mechanizmusok Sántha Péter 2016.09.16. A sejtfunkciók szabályozása - bevezetés A sejtek közötti kommunikáció fő típusai: Endokrin Parakrin - Autokrin Szinaptikus


Fehérjék szerkezetének kialakulása II. Semmelweis Egyetem. Osváth Szabolcs

Fehérjék szerkezetének kialakulása II. Semmelweis Egyetem. Osváth Szabolcs Fehérjék szerkezetének kialakulása II Osváth Szabolcs Semmelweis Egyetem szabolcs.osvath@eok.sote.hu Egy kis fehérje gombolyodása több párhuzamos úton hélix kialakulás és kollapszus több párhuzamos úton


CO 2 aktiválás - a hidrogén tárolásban

CO 2 aktiválás - a hidrogén tárolásban CO 2 aktiválás a hidrogén tárolásban PAPP Gábor 1, HORVÁTH Henrietta 1, PURGEL Mihály 1, BARANYI Attila 2, JOÓ Ferenc 1,2 1 MTADE Homogén Katalízis és Reakciómechanizmusok Kutatócsoport, 4032 Debrecen,


Integráció. Csala Miklós. Semmelweis Egyetem Orvosi Vegytani, Molekuláris Biológiai és Patobiokémiai Intézet

Integráció. Csala Miklós. Semmelweis Egyetem Orvosi Vegytani, Molekuláris Biológiai és Patobiokémiai Intézet Integráció Csala Miklós Semmelweis Egyetem Orvosi Vegytani, Molekuláris Biológiai és Patobiokémiai Intézet Anyagcsere jóllakott állapotban Táplálékkal felvett anyagok sorsa szénhidrátok fehérjék lipidek


Biopolimer 12/7/09. Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. DNS. Polimerek. Kardos Roland DNS elsődleges szerkezete

Biopolimer 12/7/09. Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. DNS. Polimerek. Kardos Roland DNS elsődleges szerkezete Biopolimerek Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. Osztódó sejt magorsófonala Kardos Roland 2009.10.29. Dohány levél epidermális sejtjének aktin hálózat Bakteriofágból kiszabaduló



POSZTTRANSZLÁCIÓS MÓDOSÍTÁSOK: GLIKOZILÁLÁSOK POSZTTRANSZLÁCIÓS MÓDOSÍTÁSOK: GLIKOZILÁLÁSOK Dr. Pécs Miklós Budapesti Műszaki és Gazdaságtudományi Egyetem, Alkalmazott Biotechnológia és Élelmiszertudomány Tanszék 1 Glikozilálás A rekombináns fehérjék


Gáspári Zoltán. Élő molekulák az élet molekulái

Gáspári Zoltán. Élő molekulák az élet molekulái Gáspári Zoltán Élő molekulák az élet molekulái Invokáció Kajtár Márton 1929-1991 www.eotvoskiado.hu Élő és élettelen? Élő és élettelen: a kemoton Élő kémiai rendszer, de nem élőlény (Gánti, 1975) Autokatalitikus


7. Fehérjeszekvenciák és térszerkezetek analízise.

7. Fehérjeszekvenciák és térszerkezetek analízise. 7. Fehérjeszekvenciák és térszerkezetek analízise. 1. Egyszerû elemzések 2. Térszerkezet predikció 2.1. A probléma bonyolultsága 2.2. A predikció szintjei 2.3. 1D predikciók (másodlagos szerkezet, hozzáférhetõség,


Lehninger et al.: Principles of Biochemistry 3 rd ed (2000); Worth Publ. Voet et al.: Fundamentals of Biochemistry 1 st ed (1999); John Wiley

Lehninger et al.: Principles of Biochemistry 3 rd ed (2000); Worth Publ. Voet et al.: Fundamentals of Biochemistry 1 st ed (1999); John Wiley 1 TANKÖNYVEK Stryer et al.: Biochemistry 5 th ed. (2002); W.H Freeman ISBN: 0716746840 Lehninger et al.: Principles of Biochemistry 3 rd ed (2000); Worth Publ. Garrett & Grisham: Biochemistry 2 nd ed (1998);


Bioinformatika előadás

Bioinformatika előadás Bioinformatika 2 11. előadás Prof. Poppe László BME Szerves Kémia és Technológia Tsz. Bioinformatika proteomika Előadás és gyakorlat 2016.11.28. Bioinformatics Szerkezeti genomika, proteomika, biológia


Mária. A pirimidin-nukleotidok. nukleotidok anyagcseréje

Mária. A pirimidin-nukleotidok. nukleotidok anyagcseréje Prof.. Sasvári Mária A pirimidin-nukleotidok nukleotidok anyagcseréje 1 A nukleobázisok szerkezete Nitrogéntartalmú, heterociklusos vegyületek; szubsztituált purin- és pirimidin-származékok purin Adenin


Pórusos polimer gélek szintézise és vizsgálata és mi a közük a sörgyártáshoz

Pórusos polimer gélek szintézise és vizsgálata és mi a közük a sörgyártáshoz Pórusos polimer gélek szintézise és vizsgálata és mi a közük a sörgyártáshoz Póta Kristóf Eger, Dobó István Gimnázium Témavezető: Fodor Csaba és Szabó Sándor "AKI KÍVÁNCSI KÉMIKUS" NYÁRI KUTATÓTÁBOR MTA



KARBONSAV-SZÁRMAZÉKOK KABNSAV-SZÁMAZÉKK Karbonsavszármazékok Karbonsavak H X Karbonsavszármazékok X Halogén Savhalogenid l Alkoxi Észter ' Amino Amid N '' ' Karboxilát Anhidrid Karbonsavhalogenidek Tulajdonságok: - színtelen,





Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Azonosító szám: TÁMOP-4.1.2-08/1/A-2009-0011 Az orvosi


A genetikai lelet értelmezése monogénes betegségekben

A genetikai lelet értelmezése monogénes betegségekben A genetikai lelet értelmezése monogénes betegségekben Tory Kálmán Semmelweis Egyetem, I. sz. Gyermekklinika A ~20 ezer fehérje-kódoló gén a 23 pár kromoszómán A kromoszómán található bázisok száma: 250M
