A Proteomika Szolgáltató Laboratóriumban elérhető szolgáltatások

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "A Proteomika Szolgáltató Laboratóriumban elérhető szolgáltatások"

Átírás

1 A Proteomika Szolgáltató Laboratóriumban elérhető szolgáltatások Dr. Csősz Éva

2 Proteomika Szolgáltató Laboratórium műszerpark MALDI-TOF (ABSciex) PSZL ESI-4000 QTRAP (ABSciex) Kétdimenziós elektroforézis rendszer (Bio-Rad) BioPlex (Bio-Rad)

3 I. Szekvencia alapú fehérje azonosítás - MS/MS spektrumokon alapuló fehérjeazonosítás - A spektrumok segítségével fehérje szekvencia részlet azonosítása történik, majd a megfelelő fehérje hozzárendelése az egyre bővülő adatbázisokból - ProteinPilot 4.0 (ABSciex) illetve Mascot keresőprogramok segítségével, az eredmények manuális értékelésével nagy biztonsággal történik a fehérje azonosítás

4 I. Szekvencia alapú fehérje azonosítás Fehérjét tartalmazó foltok/sávok kivágása 2DE Enzimes (tripszin) emésztés A sejt lízise Fehérjék azonosítása Tömegspektrometriás analízis

5 II. Fehérje kvantitálás metabolikus jelölést követően intenzitás SILAC Stable isotope labelling with amino acids in cell culture Tápfolyadék normál Arg-el (könnyű Arg) Tápfolyadék 13 C tartalmú Arg-el (nehéz Arg) Sejtek lízise és homogenizálása Minta összekeverése Sejtek lízise és homogenizálása MS/MS 6 Da m/z

6 III. Fehérje kvantitálás kémiai jelölést követően intenzitás intenzitás itraq (isobaric tag for relative and absolute quantitation) 114 B R 115 B R 116 B R 117 B R Kontroll Kezelt sejt 60 min Kezelt sejt 120 min Kezelt sejt 240 min Sejtek feltárása, összekeverése MS m/z jelölés MS/MS 115 Fehérje mennyiségi adat a görbe alatti területből számolva m/z

7 Fehérje kvantitálás metabolikus (SILAC) vagy kémiai (itraq) jelölést követően Metabolikus jelölés Előny 100%-os jelölést biztosítanak Egyazon rendszerben vizsgálható a két minta Hátrány Csak sejtkultúrákra alkalmazható Bizonyos sejtek kiemelt figyelmet igényelnek (speciális tápfolyadék stb.) Kémiai jelölés Előny Tetszőleges mintán alkalmazható Egyazon rendszerben vizsgálható 2-8 minta Hátrány A jelölés hatékonysága soha sem 100% Jelölés nem teljesen specifikus

8 Könnyfehérjék kvantitálása itraq jelölést követően Csosz et. al. (2012) J. Proteomics

9 IV. Fehérjék kvantitálása MRM/SRM módszer segítségével Q1 analizátor Ütközési cella Q3 analizátor Peptid kiválasztása Peptid fragmentálása Fragmens kiválasztása Detektálás

10 IV. Fehérjék kvantitálása MRM módszer segítségével MRM módszer kidolgozása szöveti fehérjékre AALVLAQAPAALADVLEGDSSEDRAFRVRIAG DAPLQGVLGGALTIPCHVHLRPPPSRRAVLG SPRVKWTFLSRGREAEVLVARGVRVKVNEAY RFRVALPAYPASLTDVSLARCEVQHGIDDSSD AVEVKVKGVVFLYREGSARYAFSFSGAQEAC TPEQLYAAYLGGYEQCDAGWLSDQTV Fehérje szekvencia Elméleti tripszin hasítás BLASTp MRM spektrum MRM átmenetek tervezése Csak a fehérjére jellemző szekvenciák kiválogatása

11 V. Aminosav analízis un. intelligens reagensek segítségével

12 V. Aminosav analízis un. intelligens reagensek segítségével

13 VI. Proteomikai profil változás vizsgálata kétdimenziós gélelektroforézis segítségével Alkalmas a proteomikai profilban bekövetkezett változások kimutatására, nyomon követésére A Minta B Minta gélanalízis kvalitatív és kvantitatív különbségek

14 VI. Proteomikai profil változás vizsgálata kétdimenziós gélelektroforézis segítségével A proliferatív vitreoretinopátiára (PVR) jellemző fehérje profil vizsgálata Dispase TG2 KO egér TG2 KO PVR egér

15 VII. Gélanalízis Kétdimenziós gélelemzés

16 VII. Gélanalízis Géldokumentáció Gélanalízis Master gél Expressziós különbségek

17 VII. Gélanalízis Egydimenziós gélelemzés QuantityOne (BioRad) szoftverrel M H1 AD1 AD2 AD3 H2 240 kda 165 kda 125 kda 93 kda 72 kda 63 kda 42 kda 35 kda H1 H2 AD2 AD3 25 kda 20 kda kda

18 VIII. Szkennelés Quantity One 1-D PDQuest Delta2D szoftverek PharosFX Plus System gélek blottok microplate-ek agar-agar lemezek szkennelése

19 VIII. Szkennelés Fluorescens szkennelés: 488 nm 532 nm 635 nm lézerek Telepszámlálás agar-agar lemezen

20 Összefoglalás Vállalt szolgáltatások: Szekvencia alapú (MS/MS) fehérjeazonosítás Fehérje kvantitálás (SILAC, itraq) MRM alapú fehérje azonosítás és kvantitálás Gyors aminosav analízis 1D és 2D elektroforézisek kivitelezése Géldokumentáció Gélanalízis Fluoreszcens szkennelés Fehérje profilok változásának vizsgálata

21 Elérhetőségek Honlap: Cím: DE OEC Elméleti Tömb, 204. Személyes kapcsolat: Dr. Tőzsér József Dr. Csősz Éva Köszönöm a figyelmet!

Proteomika az élelmiszer-előállításában

Proteomika az élelmiszer-előállításában DEBRECENI EGYETEM Proteomika az élelmiszer-előállításában Czeglédi Levente Gulyás Gabriella Csősz Éva 2014., korrig 2015. TÁMOP-4.1.1.C-12/1/KONV-2012-0014 Élelmiszerbiztonság és gasztronómia vonatkozású

Részletesebben

Bioinformatikai és proteomikai módszerek fejlesztése és alkalmazása a glikoproteomikai kutatásokban

Bioinformatikai és proteomikai módszerek fejlesztése és alkalmazása a glikoproteomikai kutatásokban Bioinformatikai és proteomikai módszerek fejlesztése és alkalmazása a glikoproteomikai kutatásokban Doktori Értekezés Ozohanics Olivér okleveles vegyész Eötvös Loránd Tudományegyetem, Természettudományi

Részletesebben

A proteomika új tudománya és alkalmazása a rákdiagnosztikában

A proteomika új tudománya és alkalmazása a rákdiagnosztikában BIOTECHNOLÓGIAI FEJLESZTÉSI POLITIKA, KUTATÁSI IRÁNYOK A proteomika új tudománya és alkalmazása a rákdiagnosztikában Tárgyszavak: proteom; proteomika; rák; diagnosztika; molekuláris gyógyászat; biomarker;

Részletesebben

2012/1. 18 O-t tartalmazó reagenssel való

2012/1. 18 O-t tartalmazó reagenssel való VIZSGÁLATI MÓDSZEREK TESTING METHODS STABIL IZOTÓPPAL JELÖLT REAGENSEK ALKALMAZÁSA A KVANTITATÍV PROTEOMIKÁBAN APPLYING STABLE ISOTOPE LABELLING REAGENTS IN THE QUANTITATIVE PROTEOMIC LOVRITY ZITA, EMMER

Részletesebben

Proteomika Peptid szekvenálás. Dr. Csősz Éva Debreceni Egyetem ÁOK Biokémiai és Molekuláris Biológiai Intézet Proteomika Szolgáltató Laboratórium

Proteomika Peptid szekvenálás. Dr. Csősz Éva Debreceni Egyetem ÁOK Biokémiai és Molekuláris Biológiai Intézet Proteomika Szolgáltató Laboratórium Proteomika Peptid szekvenálás Dr. Csősz Éva Debreceni Egyetem ÁOK Biokémiai és Molekuláris Biológiai Intézet Proteomika Szolgáltató Laboratórium Fókuszterületek Omikák, rendszerbiológia hipotézis vezérelt

Részletesebben

A tömegspektrometria kvalitatív és kvantitatív proteomikai alkalmazása. Szájli Emília

A tömegspektrometria kvalitatív és kvantitatív proteomikai alkalmazása. Szájli Emília A tömegspektrometria kvalitatív és kvantitatív proteomikai alkalmazása Ph.D. értekezés tézisei Szájli Emília Témavezető: Dr. Medzihradszky-Fölkl Katalin Kémia Doktori Iskola Szegedi Tudományegyetem Magyar

Részletesebben

Extracelluláris vezikulum fehérjék tömegspektrometriai vizsgálata

Extracelluláris vezikulum fehérjék tömegspektrometriai vizsgálata Extracelluláris vezikulum fehérjék tömegspektrometriai vizsgálata Doktori értekezés dr. Turiák Lilla Semmelweis Egyetem Gyógyszertudományok Doktori Iskola Témavezető: Hivatalos bírálók: Dr. Vékey Károly

Részletesebben

Genetikai panel kialakítása a hazai tejhasznú szarvasmarha állományok hasznos élettartamának növelésére

Genetikai panel kialakítása a hazai tejhasznú szarvasmarha állományok hasznos élettartamának növelésére Genetikai panel kialakítása a hazai tejhasznú szarvasmarha állományok hasznos élettartamának növelésére Dr. Czeglédi Levente Dr. Béri Béla Kutatás-fejlesztés támogatása a megújuló energiaforrások és agrár

Részletesebben

Bioinformatika 2 5.. előad

Bioinformatika 2 5.. előad 5.. előad adás Prof. Poppe László BME Szerves Kémia és Technológia Tsz. Bioinformatika proteomika Előadás és gyakorlat 2009. 03. 21. Fehérje térszerkezet t megjelenítése A fehérjék meglehetősen összetett

Részletesebben

Sciex X500R készülék bemutatása a SWATH alkalmazásai tükrében. Szabó Pál, MTA TTK

Sciex X500R készülék bemutatása a SWATH alkalmazásai tükrében. Szabó Pál, MTA TTK Sciex X500R készülék bemutatása a SWATH alkalmazásai tükrében Szabó Pál, MTA TTK Hagyományos QTOF rendszer Aggályok: Termetes Bonyolultnak tűnő Nem rutin feladatokra való Következmény: Nem merjük megvenni

Részletesebben

Fehérjebiotechnológia Emri, Tamás Csősz, Éva Tőzsér, József Szerkesztette Tőzsér, József, Debreceni Egyetem

Fehérjebiotechnológia Emri, Tamás Csősz, Éva Tőzsér, József Szerkesztette Tőzsér, József, Debreceni Egyetem Fehérjebiotechnológia Emri, Tamás Csősz, Éva Tőzsér, József Szerkesztette Tőzsér, József, Debreceni Egyetem Fehérjebiotechnológia írta Emri, Tamás, Csősz, Éva, Tőzsér, József, Tőzsér, József, és Szerzői

Részletesebben

Peptidek LC-MS/MS karakterisztikájának javítása fluoros kémiai módosítással, proteomikai alkalmazásokhoz

Peptidek LC-MS/MS karakterisztikájának javítása fluoros kémiai módosítással, proteomikai alkalmazásokhoz Peptidek LC-MS/MS karakterisztikájának javítása fluoros kémiai módosítással, proteomikai alkalmazásokhoz Dr. Schlosser Gitta tudományos munkatárs MTA-ELTE Peptidkémiai Kutatócsoport MedInProt Tavaszi Konferencia

Részletesebben

Németh Anikó 1,2, Kosáry Judit 1, Fodor Péter 1, Dernovics Mihály 1

Németh Anikó 1,2, Kosáry Judit 1, Fodor Péter 1, Dernovics Mihály 1 Németh Anikó 1,2, Kosáry Judit 1, Fodor Péter 1, Dernovics Mihály 1 1 Budapesti Corvinus Egyetem Élelmiszertudomány Kar, Alkalmazott Kémia Tanszék 2 Wessling Hungary Kft., Élelmiszervizsgáló Laboratórium

Részletesebben

Komplex fehérjeanalitikai módszerek alkalmazása. a Proteomika Szolgáltató Laboratóriumban - a. teljes proteomikai munkafolyamat kivitelezése

Komplex fehérjeanalitikai módszerek alkalmazása. a Proteomika Szolgáltató Laboratóriumban - a. teljes proteomikai munkafolyamat kivitelezése Komplex fehérjeanalitikai módszerek alkalmazása a Proteomika Szolgáltató Laboratóriumban - a teljes proteomikai munkafolyamat kivitelezése Dr. Csősz Éva Proteomika Szolgáltató Laboratórium Biokémiai és

Részletesebben

Bioinformatika 2 10.el

Bioinformatika 2 10.el 10.el őadás Prof. Poppe László BME Szerves Kémia és Technológia Tsz. Bioinformatika proteomika Előadás és gyakorlat 2009. 04. 24. Genomikavs. proteomika A genomika módszereivel nem a tényleges fehérjéket

Részletesebben

Proteomkutatás egy új tudományág születése

Proteomkutatás egy új tudományág születése BIOTECHNOLÓGIAI FEJLESZTÉSI POLITIKA, KUTATÁSI IRÁNYOK Proteomkutatás egy új tudományág születése Tárgyszavak: humán genom; genomika; proteomika; kutatás; fehérjeszerkezet; háromdimenziós szerkezet; gyógyszeripar.

Részletesebben

A humán tripszinogén 4 expressziója és eloszlási mintázata az emberi agyban

A humán tripszinogén 4 expressziója és eloszlási mintázata az emberi agyban A humán tripszinogén 4 expressziója és eloszlási mintázata az emberi agyban Doktori (PhD) értekezés Siklódi Erika Rozália Biológia Doktori Iskola Iskolavezető: Prof. Erdei Anna, tanszékvezető egyetemi

Részletesebben

INTERFERONI GAMMA-1B SOLUTIO CONCENTRATA. Tömény gamma-1b-interferon-oldat

INTERFERONI GAMMA-1B SOLUTIO CONCENTRATA. Tömény gamma-1b-interferon-oldat 01/2008:1440 javított 7.0 INTERFERONI GAMMA-1B SOLUTIO CONCENTRATA Tömény gamma-1b-interferon-oldat C 734 H 1166 N 204 O 216 S 5 M r 16 465 DEFINÍCIÓ A tömény gamma-1b-interferon-oldat a gamma interferon

Részletesebben

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Azonosító szám: TÁMOP-4.1.2-08/1/A-2009-0011 Az orvosi

Részletesebben

BIOTECHNOLÓGIÁK EGYÉB IPARÁGAKBAN. Pókselyemfehérjék előállítása dohányban és burgonyában

BIOTECHNOLÓGIÁK EGYÉB IPARÁGAKBAN. Pókselyemfehérjék előállítása dohányban és burgonyában BIOTECHNOLÓGIÁK EGYÉB IPARÁGAKBAN Pókselyemfehérjék előállítása dohányban és burgonyában Tárgyszavak: selyemfehérje; transzgénikus növény; szintetikus pókselyem; selyemfehérjegén. A Nephila clavipes pók

Részletesebben

Biomolekuláris kölcsönhatások vizsgálata felületi plazmonrezonancia elvén működő Biacore keszülékkel

Biomolekuláris kölcsönhatások vizsgálata felületi plazmonrezonancia elvén működő Biacore keszülékkel Biomolekuláris kölcsönhatások vizsgálata felületi plazmonrezonancia elvén működő Biacore keszülékkel Biomolekuláris interakciók Fehérje-fehérje Fehérje-ligand Fehérje-DNS/RNS fehérje/ligand-lipid Alegység-kölcsönhatások,

Részletesebben

Ph.D. értekezés tézisei. Dürgő Hajnalka. Témavezető: Dr. Medzihradszky-Fölkl Katalin. Biológia Doktori Iskola. MTA SZBK Biokémiai Intézet SZTE TTIK

Ph.D. értekezés tézisei. Dürgő Hajnalka. Témavezető: Dr. Medzihradszky-Fölkl Katalin. Biológia Doktori Iskola. MTA SZBK Biokémiai Intézet SZTE TTIK Gümő-specifikus NCR peptidek azonosítása, vad és mutáns Medicago truncatula gyökérgümők összehasonlító fehérjeanalízise, és az NCR247 lehetséges bakteriális interakciós partnereinek felderítése Ph.D. értekezés

Részletesebben

POSEIDON DNS PRÓBÁK. Felhasználói Kézikönyv. Használati útmutató. Használati útmutató

POSEIDON DNS PRÓBÁK. Felhasználói Kézikönyv. Használati útmutató. Használati útmutató POSEIDON DNS PRÓBÁK Felhasználói Kézikönyv Használati útmutató Használati útmutató A Poseidon fluoreszcensen jelölt próbáinak használata A fluoreszcens in situ hibridizáció (FISH) genomi célszekvenciákat

Részletesebben

Genomadatbázisok Ld. Entrez Genome: Összes ismert genom, hierarchikus szervezésben (kromoszóma, térképek, gének, stb.)

Genomadatbázisok Ld. Entrez Genome: Összes ismert genom, hierarchikus szervezésben (kromoszóma, térképek, gének, stb.) Genomika Új korszak, paradigmaváltás, forradalom: a teljes genomok ismeretében a biológia adatokban gazdag tudománnyá válik. Új kutatási módszerek, új szemlélet. Hajtóerõk: Genomszekvenálási projektek

Részletesebben

Lumineszcencia alapjelenségek

Lumineszcencia alapjelenségek Lumineszcencia alapjelenségek (Nyitrai Miklós; 211 február 7.) Lumineszcencia Definíció: Egyes anyagok spontán fénykibocsátása, a termikus fényemissziótól függetlenül, elektrongerjesztést követően. Lumineszcens

Részletesebben

Gázfázisú biokatalízis

Gázfázisú biokatalízis Gázfázisú biokatalízis Szerző: Papp Lejla, Biomérnöki B.Sc. I. évfolyam Témavezető: Dr. Tóth Gábor, tudományos munkatárs Munka helyszíne: PE-MK, Biomérnöki, Membrántechnológiai és Energetikai Kutató Intézet

Részletesebben

SZTE-ELTE PROTEOMIKAI INNOVÁCIÓ: KONCEPCIÓ, EREDMÉNYEK, JÖVŐKÉP

SZTE-ELTE PROTEOMIKAI INNOVÁCIÓ: KONCEPCIÓ, EREDMÉNYEK, JÖVŐKÉP SZTE-ELTE PROTEOMIKAI INNOVÁCIÓ: KONCEPCIÓ, EREDMÉNYEK, JÖVŐKÉP Minden elméletet úgy is meg lehet alkotni, hogy az általa sugallt kísérletek csak magát az elméletet erősítsék meg Konrad Lorenz A SEJTMŰKÖDÉS

Részletesebben

KÖRNYEZETI TÉNYEZŐK HATÁSÁNAK VIZSGÁLATA AZ ÁRPÁBAN PROTEOMIKAI MÓDSZEREKKEL

KÖRNYEZETI TÉNYEZŐK HATÁSÁNAK VIZSGÁLATA AZ ÁRPÁBAN PROTEOMIKAI MÓDSZEREKKEL BUDAPESTI CORVINUS EGYETEM DOKTORI ÉRTEKEZÉS KÖRNYEZETI TÉNYEZŐK HATÁSÁNAK VIZSGÁLATA AZ ÁRPÁBAN PROTEOMIKAI MÓDSZEREKKEL Süle Andrea Központi Élelmiszer-tudományi Kutatóintézet Budapesti Corvinus Egyetem

Részletesebben

PÉCSI TUDOMÁNYEGYETEM ÁLTALÁNOS ORVOSTUDOMÁNYI KAR Áramlási citometria, sejtszeparálás ÁRAMLÁSI CITOMETRIA, SEJTSZEPARÁLÁS BIOFIZIKA 2. 2015. március 3. Dr. Bugyi Beáta Biofizikai Intézet ÁRAMLÁSI folyadékáramban

Részletesebben

Detektorok tulajdonságai

Detektorok tulajdonságai DETEKTOROK A detektor feladata a kiáramló eluensben mérni az összetevő pillanatnyi koncentrációját. A közvetlenül mért detektorjel általában nem maga a koncentráció, hanem annak valamilyen függvénye. Detektor

Részletesebben

Analizátorok. Cél: Töltött részecskék szétválasztása

Analizátorok. Cél: Töltött részecskék szétválasztása Analizátorok Cél: Töltött részecskék szétválasztása Analizátor típusok: mágnes (B) elektrosztatikus (ESA) kvadrupol (Q) ioncsapda (trap) repülési idő (TOF) lineáris ioncsapda (LIT) Fourier transzformációs

Részletesebben

Agilent MassHunter szoftvercsalád

Agilent MassHunter szoftvercsalád Agilent MassHunter szoftvercsalád A szoftver szerepe a tömegspektrometriában Tölgyesi László Applikációs mérnök Kromat Kft. HPLC/MS Szeminárium Hotel Hélia 2010. január 14. Tartalom I. Rész MS Szoftver

Részletesebben

A fehérjék harmadlagos vagy térszerkezete. Még a globuláris fehérjék térszerkezete is sokféle lehet.

A fehérjék harmadlagos vagy térszerkezete. Még a globuláris fehérjék térszerkezete is sokféle lehet. A fehérjék harmadlagos vagy térszerkezete Még a globuláris fehérjék térszerkezete is sokféle lehet. A ribonukleáz redukciója és denaturálódása Chrisian B. Anfinsen A ribonukleáz renaturálódása 1972 obel-díj

Részletesebben

A tömegspektrometria kvalitatív és kvantitatív proteomikai alkalmazása

A tömegspektrometria kvalitatív és kvantitatív proteomikai alkalmazása A tömegspektrometria kvalitatív és kvantitatív proteomikai alkalmazása Ph.D. értekezés Szájli Emília Dr. Medzihradszky-Fölkl Katalin Témavezető Kémia Doktori Iskola SZTE TTIK Magyar Tudományos Akadémia,

Részletesebben

mintasepcifikus mikrokapilláris elektroforézis Lab-on-Chip elektroforézis / elektrokinetikus elven DNS, RNS, mirns 12, fehérje 10, sejtes minta 6

mintasepcifikus mikrokapilláris elektroforézis Lab-on-Chip elektroforézis / elektrokinetikus elven DNS, RNS, mirns 12, fehérje 10, sejtes minta 6 Agilent 2100 Bioanalyzer mikrokapilláris gélelektroforézis rendszer G2943CA 2100 Bioanalyzer system forgalmazó: Kromat Kft. 1112 Budapest Péterhegyi u. 98. t:36 (1) 248-2110 www.kromat.hu bio@kromat.hu

Részletesebben

A basidiomycota élesztőgomba, a Filobasidium capsuligenum IFM 40078 törzse egy olyan

A basidiomycota élesztőgomba, a Filobasidium capsuligenum IFM 40078 törzse egy olyan A basidiomycota élesztőgomba, a Filobasidium capsuligenum IFM 40078 törzse egy olyan fehérjét (FC-1 killer toxint) választ ki a tápközegbe, amely elpusztítja az opportunista patogén Cryptococcus neoformans-t.

Részletesebben

Röntgendiffrakció, tömegspektrometria, infravörös spektrometria.

Röntgendiffrakció, tömegspektrometria, infravörös spektrometria. A biomolekuláris szerkezet és dinamika vizsgálómódszerei: Röntgendiffrakció, tömegspektrometria, infravörös spektrometria. Smeller László A molekuláris szerkezet és dinamika vizsgáló módszereinek áttekintése

Részletesebben

Hatóanyag-tartalmú peptid-konjugátumok előállítása és in vitro tumorellenes hatása

Hatóanyag-tartalmú peptid-konjugátumok előállítása és in vitro tumorellenes hatása ORBÁN ERIKA Hatóanyag-tartalmú peptid-konjugátumok előállítása és in vitro tumorellenes hatása DOKTORI ÉRTEKEZÉS TÉZISEI Témavezető: Dr. Hudecz Ferenc tanszékvezető egyetemi tanár, kutatócsoport vezető,

Részletesebben

Egressy-Molnár Orsolya

Egressy-Molnár Orsolya Ph.D. értekezés tézisei LC-MS MÓDSZEREK FEJLESZTÉSE TERMÉSZETES ÉS SZERVES SZINTÉZIS EREDETŰ SZELÉNVEGYÜLETEK AZONOSÍTÁSÁRA Egressy-Molnár Orsolya Témavezető: Dernovics Mihály Készült: Budapesti Corvinus

Részletesebben

Minőségbiztosítás, validálás

Minőségbiztosítás, validálás Minőségbiztosítás, validálás Előzetes tanulmányok (BSc): Műszeres analitika gyakorlatok inorg.unideb.hu/oktatas Kapcsolódó tanulmányok (MSc): Minőségbiztosítás című előadás Tételek: 1. Minőségbiztosítási

Részletesebben

EGYETEMI DOKTORI (PhD) ÉRTEKEZÉS TÉZISEI NRRL B-2682-ES TÖRZSBEN. Készítette: Dr. Bartalné Deák Eleonóra Biológus, gyógyszerész

EGYETEMI DOKTORI (PhD) ÉRTEKEZÉS TÉZISEI NRRL B-2682-ES TÖRZSBEN. Készítette: Dr. Bartalné Deák Eleonóra Biológus, gyógyszerész EGYETEMI DOKTORI (PhD) ÉRTEKEZÉS TÉZISEI A BÉTA-LAKTAMÁZ ENZIM SZEREPÉNEK ÉS A BÉTA-LAKTÁM ANTIBIOTIKUMOK HATÁSÁNAK VIZSGÁLATA A STREPTOMYCES GRISEUS NRRL B-2682-ES TÖRZSBEN Készítette: Dr. Bartalné Deák

Részletesebben

Szerves kémiai analízis TANTÁRGYI KOMMUNIKÁCIÓS DOSSZIÉ

Szerves kémiai analízis TANTÁRGYI KOMMUNIKÁCIÓS DOSSZIÉ BSC ANYAGMÉRNÖK SZAK VEGYIPARI TECHNOLÓGIAI SZÁMÁRA KÖTELEZŐ TANTÁRGYI KOMMUNIKÁCIÓS DOSSZIÉ MISKOLCI EGYETEM MŰSZAKI ANYAGTUDOMÁNYI KAR KÉMIAI INTÉZET Miskolc, 2016 1 Tartalomjegyzék 1. Tantárgyleírás,

Részletesebben

Az AT 1A -angiotenzinreceptor G-fehérjétől független jelátvitelének vizsgálata C9 sejtekben. Doktori tézisek. Dr. Szidonya László

Az AT 1A -angiotenzinreceptor G-fehérjétől független jelátvitelének vizsgálata C9 sejtekben. Doktori tézisek. Dr. Szidonya László Az AT 1A -angiotenzinreceptor G-fehérjétől független jelátvitelének vizsgálata C9 sejtekben Doktori tézisek Dr. Szidonya László Semmelweis Egyetem Molekuláris Orvostudományok Doktori Iskola Témavezető:

Részletesebben

A 9,9 -biantril különleges fluoreszcenciája

A 9,9 -biantril különleges fluoreszcenciája A 9,9 -biantril különleges fluoreszcenciája Témavezetők: Demeter Attila és Harangozó József Az oldatok színe attól függ, hogy az oldott molekula a látható színkép mely hullámhossz tartományában nyeli el

Részletesebben

DNS, RNS, Fehérjék. makromolekulák biofizikája. Biológiai makromolekulák. A makromolekulák TÖMEG szerinti mennyisége a sejtben NAGY

DNS, RNS, Fehérjék. makromolekulák biofizikája. Biológiai makromolekulák. A makromolekulák TÖMEG szerinti mennyisége a sejtben NAGY makromolekulák biofizikája DNS, RNS, Fehérjék Kellermayer Miklós Tér Méret, alak, lokális és globális szerkezet Idő Fluktuációk, szerkezetváltozások, gombolyodás Kölcsönhatások Belső és külső kölcsöhatások,

Részletesebben

(11) Lajstromszám: E 008 257 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA

(11) Lajstromszám: E 008 257 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU00000827T2! (19) HU (11) Lajstromszám: E 008 27 (13) T2 MAGYAR KÖZTÁRSASÁG Szellemi Tulajdon Nemzeti Hivatala EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 0 727848 (22) A bejelentés

Részletesebben

54/2005. (XI. 23.) EüM rendelet. az egyes egészségügyi szakképesítések szakmai és vizsgakövetelményeinek kiadásáról

54/2005. (XI. 23.) EüM rendelet. az egyes egészségügyi szakképesítések szakmai és vizsgakövetelményeinek kiadásáról 54/2005. (XI. 23.) EüM rendelet az egyes egészségügyi szakképesítések szakmai és vizsgakövetelményeinek kiadásáról A szakképzésrıl szóló 1993. évi LXXVI. törvény 5. -a (1) bekezdésének a) pontjában foglalt

Részletesebben

PROTEOMIKAI MÓDSZEREK ALKALMAZÁSA KÜLÖNBÖZŐ EREDETŰ FEHÉRJÉK VIZSGÁLATÁRA

PROTEOMIKAI MÓDSZEREK ALKALMAZÁSA KÜLÖNBÖZŐ EREDETŰ FEHÉRJÉK VIZSGÁLATÁRA BUDAPESTI CORVINUS EGYETEM DOKTORI ÉRTEKEZÉS PROTEOMIKAI MÓDSZEREK ALKALMAZÁSA KÜLÖNBÖZŐ EREDETŰ FEHÉRJÉK VIZSGÁLATÁRA HORVÁTHNÉ SZANICS ENIKŐ Központi Élelmiszer-tudományi Kutatóintézet Táplálkozástudományi

Részletesebben

Gyógyszerek és DNS mutációk kimutatása vérből

Gyógyszerek és DNS mutációk kimutatása vérből Gyógyszerek és DNS mutációk kimutatása vérből AKI kíváncsi kémikus kutatótábor Kolostyák Zsuzsanna, Békés Márta, Varga Bálint 2010. Július 2. Enzimek; metabolizmus - A legtöbb biokémiai lépést enzimek

Részletesebben

Nemenzimatikus glikáció vizsgálata új bioanalitikai módszerekkel

Nemenzimatikus glikáció vizsgálata új bioanalitikai módszerekkel Nemenzimatikus glikáció vizsgálata új bioanalitikai módszerekkel Doktori értekezés Böddi Katalin Gyógyszertudományi Doktori Iskola Témavezető: Prof. Dr. Ohmacht Róbert Társ-témavezető: Dr. Szabó Zoltán

Részletesebben

A KALPAIN ÉS A PROTEIN KINÁZ/FOSZFATÁZ RENDSZEREK VIZSGÁLATA

A KALPAIN ÉS A PROTEIN KINÁZ/FOSZFATÁZ RENDSZEREK VIZSGÁLATA EGYETEMI DOKTORI (Ph.D.) ÉRTEKEZÉS TÉZISEI A KALPAIN ÉS A PROTEIN KINÁZ/FOSZFATÁZ RENDSZEREK VIZSGÁLATA Kölcsönhatás a posztszintetikus fehérje módosító rendszerek között Kovács László DEBRECENI EGYETEM

Részletesebben

10. Genomika 2. Microarrayek és típusaik

10. Genomika 2. Microarrayek és típusaik 10. Genomika 2. 1. Microarray technikák és bioinformatikai vonatkozásaik Microarrayek és típusaik Korrelált génexpresszió mint a funkcionális genomika eszköze 2. Kombinált megközelítés a funkcionális genomikában

Részletesebben

Intelligens fotometria. Célba jutni okosan. Áttekinthető ikonok a komplikált listák helyett

Intelligens fotometria. Célba jutni okosan. Áttekinthető ikonok a komplikált listák helyett Célba jutni okosan Áttekinthető ikonok a komplikált listák helyett A MACHEREY-NAGEL cég az új NANOCOLOR VIS II és a NANOCOLOR UV / VIS II spektrofotométerekkel forradalmasítja a napi laboratóriumi munkát,

Részletesebben

A proteomikai módszerek fejlõdési irányai

A proteomikai módszerek fejlõdési irányai A proteomikai módszerek fejlõdési irányai Janáky Tamás Orvosi Vegytani Intézet, Szegedi Tudományegyetem 360 Degree CEO Perspective Of The Global Healthcare Industry 2008 Frost & Sullivan. All rights reserved.

Részletesebben

Az örökítőanyag. Az élőlények örökítőanyaga minden esetben nukleinsav (DNS,RNS) (1)Griffith, (2)Avery, MacLeod and McCarty (3)Hershey and Chase

Az örökítőanyag. Az élőlények örökítőanyaga minden esetben nukleinsav (DNS,RNS) (1)Griffith, (2)Avery, MacLeod and McCarty (3)Hershey and Chase SZTE, Orv. Biol. Int., Mol- és Sejtbiol. Gyak., VIII. Az örökítőanyag Az élőlények örökítőanyaga minden esetben nukleinsav (DNS,RNS) (1)Griffith, (2)Avery, MacLeod and McCarty (3)Hershey and Chase Ez az

Részletesebben

(11) Lajstromszám: E 008 532 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA

(11) Lajstromszám: E 008 532 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU00000832T2! (19) HU (11) Lajstromszám: E 008 32 (13) T2 MAGYAR KÖZTÁRSASÁG Szellemi Tulajdon Nemzeti Hivatala EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 03 783231 (22) A bejelentés

Részletesebben

A fehérje-fehérje kölcsönhatás szerkezeti alapjai és biológiai szerepük: multidiszciplináris megközelítés (zárójelentés)

A fehérje-fehérje kölcsönhatás szerkezeti alapjai és biológiai szerepük: multidiszciplináris megközelítés (zárójelentés) A fehérje-fehérje kölcsönhatás szerkezeti alapjai és biológiai szerepük: multidiszciplináris megközelítés (zárójelentés) Az ELTE Biokémiai Tanszék tudományos kutatásainak tengelyében évtizedek óta a fehérjék

Részletesebben

CHIP-TECHNOLÓGIA ALKALMAZÁSA A HUMÁN IN VITRO FERTILIZÁCIÓ EREDMÉNYESSÉGÉNEK JAVÍTÁSÁBAN

CHIP-TECHNOLÓGIA ALKALMAZÁSA A HUMÁN IN VITRO FERTILIZÁCIÓ EREDMÉNYESSÉGÉNEK JAVÍTÁSÁBAN CHIP-TECHNOLÓGIA ALKALMAZÁSA A HUMÁN IN VITRO FERTILIZÁCIÓ EREDMÉNYESSÉGÉNEK JAVÍTÁSÁBAN MINTACÍM SZERKESZTÉSE AZ EMBRIÓ ÉLETKÉPESSÉGÉNEK ÚJ MOLEKULÁRIS INDIKÁTORAI A legtöbb fejlett országban egyre csökken

Részletesebben

Abszorbciós spektroszkópia

Abszorbciós spektroszkópia Abszorbciós spektroszkópia (Nyitrai Miklós; 2011 január 31.) A fény Elektromágneses hullám kölcsönhatása anyaggal Az abszorbció definíciója Az abszorpció mérése Speciális problémák, esetek Alkalmazások

Részletesebben

(11) Lajstromszám: E 007 017 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA

(11) Lajstromszám: E 007 017 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000007017T2! (19) HU (11) Lajstromszám: E 007 017 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 07 7232 (22) A bejelentés napja:

Részletesebben

Részletes kutatási jelentés. 1/ A szintetikus Aβ-aggregátumok jellemzése

Részletes kutatási jelentés. 1/ A szintetikus Aβ-aggregátumok jellemzése Részletes kutatási jelentés A 4 éves projekt a következő célkitűzésekkel indult: 1, Szintetikus, neurotoxikus Aβ-peptid aggregátumok előállítása és sokoldalú fizikokémiai jellemzése. 2, Az Aβ oligomerekkel,

Részletesebben

BD Vacutainer Molekuláris Diagnosztikai termékei

BD Vacutainer Molekuláris Diagnosztikai termékei BD Vacutainer Molekuláris Diagnosztikai termékei Andrea Süle, PhD Termékspecialista BD Diagnostics, Preanalytical Systems MOLSZE XI. Nagygyőlés, Pécs, 2009 augusztus 27-29. BD A BD egy orvostechnológiai

Részletesebben

A közeli infravörös tartományban végzett spektroszkópia felhasználása a minőségbiztosításban

A közeli infravörös tartományban végzett spektroszkópia felhasználása a minőségbiztosításban TERMELÉSI FOLYAMAT MINÕSÉGKÉRDÉSEI, VIZSGÁLATOK 2.5 2.2 2.3 A közeli infravörös tartományban végzett spektroszkópia felhasználása a minőségbiztosításban Tárgyszavak: közeli infravörös spektroszkópia (KIS);

Részletesebben

Mikroszerkezet: szerkezet az atomokon túl, ami a mindennapjainkban olyan fontos. Ungár Tamás. ELTE, Fizikai Intézet, Anyagfizikai Tanszék

Mikroszerkezet: szerkezet az atomokon túl, ami a mindennapjainkban olyan fontos. Ungár Tamás. ELTE, Fizikai Intézet, Anyagfizikai Tanszék Mikroszerkezet: szerkezet az atomokon túl, ami a mindennapjainkban olyan fontos Ungár Tamás ELTE, Fizikai Intézet, Anyagfizikai Tanszék Az atomoktól a csillagokig, Atomcsill előadás sorozat 2008. november

Részletesebben

PROTEOMIKA Darula Zsuzsa, Gulyás Éva, Klement Éva és Medzihradszky-Fölkl Katalin 1

PROTEOMIKA Darula Zsuzsa, Gulyás Éva, Klement Éva és Medzihradszky-Fölkl Katalin 1 PROTEOMIKA Darula Zsuzsa, Gulyás Éva, Klement Éva és Medzihradszky-Fölkl Katalin 1 Napjainkig a tudományos kutatás általában úgy folyt, hogy a kutatók felállítottak egy hipotézist, ennek alapján kísérleteket

Részletesebben

10. CSI. A molekuláris biológiai technikák alkalmazásai

10. CSI. A molekuláris biológiai technikák alkalmazásai 10. CSI. A molekuláris biológiai technikák alkalmazásai A DNS mint azonosító 3 milliárd bázispár az emberi DNS-ben (99.9%-ban azonos) 0.1%-nyi különbség elegendő az egyedek megkülönböztetéséhez Genetikai

Részletesebben

Az aminoxidázok és a NADPH-oxidáz szerepe az ér- és neuronkárosodások kialakulásában (patomechanizmus és gyógyszeres befolyásolás)

Az aminoxidázok és a NADPH-oxidáz szerepe az ér- és neuronkárosodások kialakulásában (patomechanizmus és gyógyszeres befolyásolás) Az aminoxidázok és a NADPH-oxidáz szerepe az ér- és neuronkárosodások kialakulásában (patomechanizmus és gyógyszeres befolyásolás) Az aminoxidázok két nagy csoportjának, a monoamin-oxidáznak (MAO), valamint

Részletesebben

MTA TTK Műszercentrum árszabás és hozzáférési lehetőség

MTA TTK Műszercentrum árszabás és hozzáférési lehetőség MTA TTK Műszercentrum árszabás és hozzáférési lehetőség Az MTA Természettudományi Kutatóközpont (MTA TTK) működésében, és ezen belül a nagyműszeres kutatások finanszírozásával kapcsolatban lényeges változásokra

Részletesebben

Érzékenység vs dwell time

Érzékenység vs dwell time Érzékenység vs dwell time analyte peak area [cps] 3.000.000 2.500.000 2.000.000 1.500.000 1.000.000 500.000 0 0 20 40 60 80 100 dwell time [ms] 25ms dwell time alatt számottevő a csökkenés (API 2000 LC/MS/MS

Részletesebben

Tantárgy tematikája: I. Félév

Tantárgy tematikája: I. Félév Képzés: BSc Tantárgy kódja és neve: TBBE0571, TBBE0572 + TBBL0572, Biomérnöki műveletek és folyamatok I-II Kredit: 3, 3+2 Tantárgyfelelős: Dr. Karaffa Levente Oktatók: Dr. Karaffa Levente, Dr. Fekete Erzsébet

Részletesebben

Eszközszükséglet: Szükséges anyagok: tojás, NaCl, ammónium-szulfát, réz-szulfát, ólom-acetát, ecetsav, sósav, nátrium-hidroxid, desztillált víz

Eszközszükséglet: Szükséges anyagok: tojás, NaCl, ammónium-szulfát, réz-szulfát, ólom-acetát, ecetsav, sósav, nátrium-hidroxid, desztillált víz A kísérlet, megnevezés, célkitűzései: Fehérjék tulajdonságainak, szerkezetének vizsgálata. Környezeti változások hatásának megfigyelése a fehérjék felépítésében. Eszközszükséglet: Szükséges anyagok: tojás,

Részletesebben

Szegedi Tudományegyetem Általános Orvostudományi Kar Multidiszciplináris Orvostudományok Doktori Iskola

Szegedi Tudományegyetem Általános Orvostudományi Kar Multidiszciplináris Orvostudományok Doktori Iskola Szegedi Tudományegyetem Általános Orvostudományi Kar Multidiszciplináris Orvostudományok Doktori Iskola Polimerizált 3D mikroszerkezetek funkcionalizálása biológiai alkalmazásokhoz Ph.D. értekezés tézisei

Részletesebben

Foszfolipidek mint biomarkerek

Foszfolipidek mint biomarkerek Foszfolipidek mint biomarkerek Berkecz Róbert, Kovács Nóra és Janáky Tamás Szegedi Tudományegyetem, rvosi Vegytani Intézet, Lipidek csoportosítása Nyitray László, Pál Gábor, 2013 Lipidek csoportosítása

Részletesebben

Hogyan segíti a MALDI-TOF MS az aerob baktériumok gyors species identifikálását. Kardos Gábor DEOEC Orvosi Mikrobiológiai Intézet

Hogyan segíti a MALDI-TOF MS az aerob baktériumok gyors species identifikálását. Kardos Gábor DEOEC Orvosi Mikrobiológiai Intézet Hogyan segíti a MALDI-TOF MS az aerob baktériumok gyors species identifikálását Kardos Gábor DEOEC Orvosi Mikrobiológiai Intézet Módszerek Biokémiai profil csöves biokémia ID kitek (API, Cristal, Biolog,

Részletesebben

Lendület Napok: mozgásban a hazai tudomány MTA 2013. december 16. és 18.

Lendület Napok: mozgásban a hazai tudomány MTA 2013. december 16. és 18. Buday László Állványfehérjék szerepe a jelátvitelben MTA TTK EI Lendület Jelátviteli Kutatócsoport MTA Természettudományi Kutatóközpont, Enzimológiai Intézet, Lendület jelátviteli munkacsoport, vezetője:

Részletesebben

A nyugalmi potenciál megváltozása

A nyugalmi potenciál megváltozása Akciós potenciál történelem A nyugalmi potenciál megváltozása 2. A membrán aktív elektromos tulajdonságai 1780: Luigi Galvani elektromos vezetés és izomösszehúzódás kapcsolata 1843: Emil Dubois-Reymond

Részletesebben

CINtec PLUS Cytology Kit

CINtec PLUS Cytology Kit CINtec PLUS Cytology Kit 605-100 06889565001 100 1. ábra: Cervicalis epithelialis sejt, p16 INK4a pozitív (barna citoplazmás festődés) és Ki-67 pozitív (piros magfestődés) FELHASZNÁLÁSI TERÜLET A CINtec

Részletesebben

2. program: Versenyképes agrár-biotechnológia megalapozása a Debreceni Egyetem vonzáskörzetében: összefogás a genomikától a termékig.

2. program: Versenyképes agrár-biotechnológia megalapozása a Debreceni Egyetem vonzáskörzetében: összefogás a genomikától a termékig. Tar talomjegyzék Küldetésnyilatkozat, átfogó célok 3 Vezetői összefoglaló 3 A GENOMNANOTECH DEBRECEN RET szervezeti felépítése és a menedzsment 7 Ipari partnerek 9 1. program: Új eljárások a legjelentősebb

Részletesebben

Az anti-apoptózis mechanizmus vizsgálata agyi ischaemia/hypoxia modellekben

Az anti-apoptózis mechanizmus vizsgálata agyi ischaemia/hypoxia modellekben OTKA T-037887 zárójelentés Az anti-apoptózis mechanizmus vizsgálata agyi ischaemia/hypoxia modellekben Az ischaemias stroke-ot követően az elzáródott ér ellátási területének centrumában percek, órák alatt

Részletesebben

Új temékek az UD-GenoMed Kft. kínálatában!

Új temékek az UD-GenoMed Kft. kínálatában! Új temékek az UD-GenMed Kft. kínálatában! Műanyag termékek: SARSTEDT műanyag termékek teljes választéka Egyszer használats labratóriumi műanyag eszközök szövet és sejttenyésztéshez Vérvételi és diagnsztikai

Részletesebben

Nyomás a dugattyúerők meghatározásához 6,3 bar. Nyersanyag:

Nyomás a dugattyúerők meghatározásához 6,3 bar. Nyersanyag: Dugattyúrúd nélküli hengerek Siklóhengerek 16-80 mm Csatlakozások: M7 - G 3/8 Kettős működésű mágneses dugattyúval Integrált 1 Üzemi nyomás min/max 2 bar / 8 bar Környezeti hőmérséklet min./max. -10 C

Részletesebben

A fehérjék szerkezete és az azt meghatározó kölcsönhatások

A fehérjék szerkezete és az azt meghatározó kölcsönhatások A fehérjék szerkezete és az azt meghatározó kölcsönhatások 1. A fehérjék szerepe az élõlényekben 2. A fehérjék szerkezetének szintjei 3. A fehérjék konformációs stabilitásáért felelõs kölcsönhatások 4.

Részletesebben

Szakképesítés-ráépülés: 55 524 03 Műszeres analitikus Szóbeli vizsgatevékenység A vizsgafeladat megnevezése: Analitikai elemző módszerek

Szakképesítés-ráépülés: 55 524 03 Műszeres analitikus Szóbeli vizsgatevékenység A vizsgafeladat megnevezése: Analitikai elemző módszerek A vizsgafeladat ismertetése: A szóbeli központilag összeállított vizsga kérdései a 4. Szakmai követelmények fejezetben megadott modulhoz tartozó témakörök mindegyikét tartalmazzák. Amennyiben a tétel kidolgozásához

Részletesebben

(11) Lajstromszám: E 007 952 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA

(11) Lajstromszám: E 007 952 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU00000792T2! (19) HU (11) Lajstromszám: E 007 92 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 04 73892 (22) A bejelentés napja:

Részletesebben

Lumineszcencia Fényforrások

Lumineszcencia Fényforrások Kiegészítés: színkeverés Lumineszcencia Fényforrások Alapszinek additív keverése Alapszinek kiegészítő szineinek keverése: Szubtraktív keverés Fidy udit Egyetemi tanár 2015, November 5 Emlékeztető.. Abszorpciós

Részletesebben

2016 Q1 AKCIÓ Érv.: a készletig, de legkésőbb 2016.03.31-IG

2016 Q1 AKCIÓ Érv.: a készletig, de legkésőbb 2016.03.31-IG DCD731C2-QW 14.4V-OS XR FÚRÓ-CSAVAROZÓ 10 mm-es, egykezes működtetésű gyorstokmány automatikus tengelyrögzítővel 2 mechanikus sebességfokozat, elektronikus fordulatszám szabályozás, forgásirány váltás

Részletesebben

Hantavírus (Puumala) IgG/IgM-ELISA. 4. Szükséges anyagok és reagensek, amelyeket a teszt nem tartalmaz. Használati Utasítás /Instruction Sheet/

Hantavírus (Puumala) IgG/IgM-ELISA. 4. Szükséges anyagok és reagensek, amelyeket a teszt nem tartalmaz. Használati Utasítás /Instruction Sheet/ Hantavírus (Puumala) IgG/IgM- Enzimes immunvizsgálat az IgG és az IgM Puumala szerotipusú antitestek meghatározására. Kódszám: Tartalom: Tárolás: PR59156 96 teszt +2-8ºC Használati Utasítás /Instruction

Részletesebben

KIS MOLEKULATÖMEGŰ ANYAGOK SZERKEZETFELDERÍTÉSE LÁGYIONIZÁCIÓS TÖMEGSPEKTROMETRIAI MÓDSZEREKKEL

KIS MOLEKULATÖMEGŰ ANYAGOK SZERKEZETFELDERÍTÉSE LÁGYIONIZÁCIÓS TÖMEGSPEKTROMETRIAI MÓDSZEREKKEL ar s Te r Te ud zett omán és y l o n óg iai K ch ié m KIS MOLEKULATÖMEGŰ AYAGOK SZERKEZETFELDERÍTÉSE LÁGYIOIZÁCIÓS TÖMEGSPEKTROMETRIAI MÓDSZEREKKEL Doktori (Ph.D.) értekezés agy Lajos Témavezető: Dr. Kéki

Részletesebben

Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete

Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete Polipeptidek térszerkezete Tipikus (rendezett) konformerek em tipikus (rendezetlen) konformerek Periodikus vagy homokonformerek Aperiodikus

Részletesebben

Az áramlási citométer és sejtszorter felépítése és működése, diagnosztikai alkalmazásai

Az áramlási citométer és sejtszorter felépítése és működése, diagnosztikai alkalmazásai Az áramlási citométer és sejtszorter felépítése és működése, diagnosztikai alkalmazásai Az áramlási citométer és sejtszorter felépítése és működése Kereskedelmi forgalomban kapható készülékek 1 Fogalmak

Részletesebben

Európai Közösségek - Árubeszerzésre irányuló szerződések - Szerződés odaítélése. HU-Kaposvár: Laboratóriumi bútor 2010/S 17-022566

Európai Közösségek - Árubeszerzésre irányuló szerződések - Szerződés odaítélése. HU-Kaposvár: Laboratóriumi bútor 2010/S 17-022566 /2 Ez a hirdetmény a TED weboldalán: http://ted.europa.eu/udl?uri=ted:notice:22566-200:text:hu:html HU-Kaposvár: Laboratóriumi bútor 200/S 7-022566 SZERZŐDÉS ODAÍTÉLÉSÉRŐL SZÓLÓ HIRDETMÉNY Árubeszerzés

Részletesebben

NMR a peptid- és fehérje-kutatásban

NMR a peptid- és fehérje-kutatásban NMR a peptid- és fehérje-kutatásban A PDB adatbázisban megtalálható NMR alapú fehérjeszerkezetek számának alakulása az elmúlt évek során 4000 3500 3000 2500 2000 1500 1000 500 0 1987 1988 1989 1990 1991

Részletesebben

Endogén szteroidprofil vizsgálata folyadékkromatográfiával és tandem tömegspektrométerrel. Karvaly Gellért

Endogén szteroidprofil vizsgálata folyadékkromatográfiával és tandem tömegspektrométerrel. Karvaly Gellért Endogén szteroidprofil vizsgálata folyadékkromatográfiával és tandem tömegspektrométerrel Karvaly Gellért Miért hasznos a vegyületprofilok vizsgálata? 1 mintából, kis mintatérfogatból, gyorsan nyerhető

Részletesebben

Genomika. Mutációk (SNP-k) és vizsgálatuk egyszerű módszerekkel. DNS szekvenálási eljárások. DNS ujjlenyomat (VNTR)

Genomika. Mutációk (SNP-k) és vizsgálatuk egyszerű módszerekkel. DNS szekvenálási eljárások. DNS ujjlenyomat (VNTR) Genomika (A genom, génállomány vizsgálata) Mutációk (SNP-k) és vizsgálatuk egyszerű módszerekkel DNS szekvenálási eljárások DNS ujjlenyomat (VNTR) DNS chipek statikus és dinamikus információk vizsgálata

Részletesebben

Székhelye: H-6771 Szeged, Szerb u. 59. Telefon/fax: 36 62 406-012 Telefon: 36 62 406-011, 36 62 655-873 Adószám: 10224409-2-06

Székhelye: H-6771 Szeged, Szerb u. 59. Telefon/fax: 36 62 406-012 Telefon: 36 62 406-011, 36 62 655-873 Adószám: 10224409-2-06 The Green Company LUMI-HOD 107-B fólia Javaslatok az alkalmazásokra LUMI-HOD 107-B fólia Az LN egy új osztálya az újonnan kifejlesztett foszforeszkáló (sötétben világító) pigmenteknek, nagymértékben különböznek

Részletesebben

Ph. D. ÉRTEKEZÉS TÉZISEI. Szabó Erzsébet

Ph. D. ÉRTEKEZÉS TÉZISEI. Szabó Erzsébet Ph. D. ÉRTEKEZÉS TÉZISEI Szabó Erzsébet Okl. biomérnök Enzimes hidrolízis, nem termikus, új tartósítási eljárás és környezeti változások hatása élelmiszerfehérjék mintázatára és immunreaktív jellegére

Részletesebben

Fűtési rendszerek energiahatékonysági osztályba sorolása

Fűtési rendszerek energiahatékonysági osztályba sorolása Viessmann Fűtéstechnika Kft. 2045 Törökbálint, Süssen u. 3. Tel: 36 334-334 Fa: 36 334-339 www.viessmann.hu Fűtési rendszerek energiahatékonysági osztályba sorolása 7543417 Vitodens 100-W, B1K Minden

Részletesebben

AQUA PURIFICATA. Tisztított víz. Letöltetlen, tisztított víz

AQUA PURIFICATA. Tisztított víz. Letöltetlen, tisztított víz Aqua purificata Ph.Hg.VIII. Ph.Eur.6.3-1 AQUA PURIFICATA Tisztított víz 01/2009:0008 H 2 O M r 18,02 DEFINÍCIÓ A tisztított víz indokolt és engedélyezett esetek kivételével azon gyógyszerek előállítására

Részletesebben

Fehérjék színreakciói

Fehérjék színreakciói A kísérlet, mérés megnevezése, célkitűzései: Fehérjéket felépítő aminosavak és a köztük lévő peptid kötés kimutatása Eszközszükséglet: Szükséges anyagok: tej, burgonya, víz, nátrium-hidroxid-oldat, réz(ii)-szulfát,

Részletesebben