Tubulin, mikrotubuláris rendszer és mikrotubulus asszociált fehérjék

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "Tubulin, mikrotubuláris rendszer és mikrotubulus asszociált fehérjék"

Átírás

1 Tubulin, mikrotubuláris rendszer és mikrotubulus asszociált fehérjék Talián Csaba Gábor PTE ÁOK, Biofizika Intézet február 22. Transzmissziós elektronmikroszkópos felvétel egy Heliozoa axopódiumának keresztmetszetéről spirálisan elrendezett microtubulusokkal. Nagyítás- 65,000x.(Wikipedia)

2 Mikrotubulusok A három citoszkeletális filamentum egyike Harris, első mikroszkópos felvételek Üreges, hengeres, merev cső, általában hosszú és egyenes Kisméretű fehérjealegységekből felépülő polimer Köztük vég-vég és oldalirányú, másodlagos kötőerők Dinamikus rendszer: folyamatos fel- és leépülés, alegységek állandó cseréje Számos fehérje kapcsolódik hozzá: működés szabályozása Membránorganellumok pozícionálása, intracelluláris transzport, mitotikus orsó, csilló/ostor, sejtalak meghatározása

3 Tubulin Globuláris fehérje, emberben aminosav, 50-55kDa Emberben 5 fő típus Mikrotubulusokban leginkább α és β Centroszóma és poláris test: γ mikrotubulus nukleáció Centriolum és magorsó: δ és ε Számos gén β3 tubulin pl. csak neuronokban Igen nagyfokú hasonlóság, C-terminális változékonyabb Kopolimerizálnak, de specifikus sejten belüli eloszlás is Prokariótákban evolúciós rokon fehérje: FtsZ sejtosztódásban fontos

4 Dimerizáció Heterodimer képződés α és β tubulin csak együtt, komplexben fordul elő polarizált: - és + vég GTP kötőhely Alegységek közti mindig GTP nem kicserélhető β-alegységen hidrolizálható lehet GTP vagy GDP kicserélhető - α β +

5 Szerkezeti felépülés Protofilamentumok α(-) β(+) típusú kapcsolódás hasonló a dimeren belülihez, erős kötés Szomszédos protofilamentumok α-α és β-β egységek közti kapcsolatok Mikrotubulus 13 párhuzamos protofilamentum 20-30nm külső átmérő 14nm belső átmérő hossza 200 nm-25 µm Minden dimer és protofilamentum azonos irányban áll szerkezeti polaritás

6 A képződés lépései Protofilamentumok felépülése dimerekből hosszirányban Lapok kialakulása protofilamentumokból oldalirányban Lapok begörbülése, csővé záródás Szabad végekhez további dimerek kapcsolódása Az egyes protofilamentum végek többé-kevésbé eltérő hosszúak lehetnek

7 Filamentum növekedés A két vég növekedési sebessége elvileg egyforma (szabadenergia változás és kritikus koncentráció megegyezik) k off /k on ugyanakkora, de k + onés k + off külön lehet eltérő (k - onés k - offis) a szerkezeti polaritás miatt gyorsabban változó vég a +, a lassabban változó a Valóságban GTP-hidrolízis a filamentumban sokkal gyorsabb! A hidrolízis során felszabaduló energia a fehérje-gdp komplexben marad, és csak leváláskor adódik le ez nagyobb szabadenergia-változást jelent, mint a GTP forma leválása GDP GDP GDP GTP GTP GTP Ezért: K = k / k > K = k / k illetve C GDP c > C GTP c D off on D off on Egyensúlyban: df / dt = k N c + k N = 0 ezért + + C c = k / k

8 Treadmilling Szabad alegységek többnyire GTP-kötött állapotban az alegység beépülésének és a GTP hidrolízis sebességének a mértékétől függ, hogy a végen milyen nukleotid van: a + végen az előbbi gyorsabb: GTP-sapka alakul ki a végen gyorsabb a hidrolízis: GDP-tartalmú alegységek A +vég kritikus koncentrációja kisebb, mint a végé köztes koncentrációkon a + vég növekszik, a vég lebomlik TREADMILLING A folyamatot a GTP hidrolízis energiája hajtja

9 steady-state treadmilling

10 Ha az egyik végen a polimerizáció és a hidrolízis sebessége hasonló, akkor növekedés közben is elveszhet a GTP-sapka Random és hirtelen folyamat, valószínűsége függ a dimerkoncentrációtól Az ilyen végek gyorsan elkezdenek lebomlani Később újra kialakulhat a GTP-sapka, és megint beindul a növekedés lebomló és felépülő állapotok váltakozása: katasztrófa és megmentés Dinamikus instabilitás Mikrotubulus egyik vége általában rögzített: dinamikus instabilitás jellemző

11 Dinamikus instabilitás Relaxáció egy görbültebb GDP filamentum-konformációba

12 Mi a dinamikus viselkedés haszna? Mikrotubulusok percenként többször is változtatják a hosszukat, ez fénymikroszkóppal is követhető Nagy mennyiségű energiát igényel Az alegységek gyorsan diffundálnak, könnyen eljutnak a nukleációs helyekre ez a sebességmeghatározó lépés 1. A sejt folyamatosan monitorozza a sejtvázat 2. Elég a nukleációs helyeket szabályozni 3. Csak a hasznos struktúrákat stabilizálja 4.Nagyfokú tér-és időbeli flexibilitás 5. Külső hatásokra gyorsan képes változni

13 Toxinok Taxol a mikrotubulusokhoz kötve azokat stabilizálja, befagy a sejtváz Colchicin a monomerekhez kötve gátolja a polimerizációt Vinblasztin szintén polimerizációgátló Antimitotikus, daganatellenes szerek

14 Mikrotubuluskötő fehérjék 1. Motorfehérjék Dineinek: - vég motorok, legnagyobb és leggyorsabb (14μm/s) Citoplazmatikus: homodimer, vezikulatranszport, Golgi-apparátus rögzítése Axonémális: heterodimer vagy -trimer, csilló és ostor Kinezinek: +vég motorok, miozinhoz hasonló szerkezet, 2-2 nehéz és könnyű lánc, két globuláris fej, megnyúlt coiled-coil farok

15 Mikrotubuluskötő fehérjék 2. Mikrotubulus asszociált proteinek (MAP) Szerkezeti funkciók: Stabilizálás Destabilizálás Keresztkötés

16 I. Típus kb. 100nm, pálcikaszerű, MT-kötő domén az N-terminálison Számos (Lys-Lys-Glu-X) ismétlődés; A:11, B:21 C-terminális projekciós domén: kiáll a felszínről: távtartás, kötegképzés polimerizációt serkentik (C c -t csökkentik), stabilizálnak II. Típus MT-kötő domén a C-terminális felől (+ töltésű), több is lehet N-terminális projekciós domén változatos hosszúságú Számos kináz fehérje dokkoló helye Sok foszforilálható hely (~40) - MAP-kinázok foszforiláció csökkenti az affinitást a mikrotubulusokhoz Sok PEST (Pro-Glu-Ser-Thr) szekvencia: proteolitikusan érzékeny Tau: hiperfoszforiláltformája kóros neurodegeneratívfolyamatokban (pl. Alzheimer-kór) lerakódik páros helikális filamentumok

17 Filamentumvég dinamika Stathmin két dimert szekvesztrál, csökkenti a szabad alegységkoncentrációt, fokozza a depolimerizációt és a dinamikus instabilitást Katanin mikrotubulusokat elhasítja gyors depolimerizálódás szabályozása a sejtosztódás során Mikrotubulus dokkolás

18 Mikrotubulus organizáló központ (MITOK) Mikrotubulus nukleáció γ-tubulint tartalmaz, számos MAP fehérjével egy gyűrűkomplexet képez, ehhez kapcsolódik az α-tubulin vége Centroszóma Csillagszerű, membránmentes organellum A mikrotubulusok szervezésének helye a sejtben Centroszóma mátrixból és gyűrűkomplexekből áll Gombákban és növényekben a magmembránhoz kapcsolódik Állati sejtekben egy pár centriólumot is tartalmaz Egymásra merőlegesen állnak 9 rövid mikrotubulus-triplet Egymáshoz kapcsolódó A, B és C gyűrűk A két utóbbit csak 10 protofilamentum alkotja

19

20 Csilló/ostor Keskeny, mozgékony sejtnyúlványok Központi része az axonéma, amelyet membrán borít

A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA

A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA 2013.10.09. CITOSZKELETON - DEFINÍCIÓ Fehérjékből felépülő, a sejt vázát alkotó intracelluláris rendszer. Eukarióta és prokarióta sejtekben egyaránt megtalálható.

Részletesebben

A citoszkeleton Eukarióta sejtváz

A citoszkeleton Eukarióta sejtváz A citoszkeleton Eukarióta sejtváz - Alak és belső szerkezet - Rugalmas struktúra sejt izomzat - Fehérjékből épül fel A citoszkeleton háromféle filamentumból épül fel Intermedier filamentum mikrotubulus

Részletesebben

Citoszkeleton. Sejtek rugalmassága. Polimer mechanika: Hooke-rugalmasság. A citoszkeleton filamentumai. Fogászati anyagtan fizikai alapjai 12.

Citoszkeleton. Sejtek rugalmassága. Polimer mechanika: Hooke-rugalmasság. A citoszkeleton filamentumai. Fogászati anyagtan fizikai alapjai 12. Fogászati anyagtan fizikai alapjai 12. Sejtek rugalmassága Citoszkeleton Eukariota sejtek dinamikus vázrendszere Három fő filamentum-osztály: A. Vékony (aktin) B. Intermedier C. Mikrotubulus Polimerizáció:

Részletesebben

A citoszkeletális rendszer

A citoszkeletális rendszer A citoszkeletális rendszer Az eukarióta sejtek dinamikus fehérje-vázrendszere, amely specifikus fehérjepolimer filamentumokból épül fel. Mikrofilamentumok Mikrotubulusok Intermedier filamentumok Aktin

Részletesebben

A biológiai mozgás molekuláris mechanizmusai

A biológiai mozgás molekuláris mechanizmusai BIOLÓGIAI MOZGÁSOK A biológiai mozgás molekuláris mechanizmusai Kollektív mozgás Szervezet mozgása ( Az évszázad ugrása ) Szerv mozgás BIOLÓGIAI MOZGÁSOK BIOLÓGIAI MOZGÁSOK Ritmusosan összehúzódó szívizomsejt

Részletesebben

Citoszkeleton Sejtmozgás

Citoszkeleton Sejtmozgás Citoszkeleton Sejtmozgás Citoszkeleton funkciói Sejtalak meghatározása Organellumok kihorgonyzása Organellumok mozgatása Húzószilárdság Kromoszóma mozgatás Sejtpolaritás Motilitás Citoszkeleton Mikrofilamentumok

Részletesebben

Sejtmozgás és adhézió Molekuláris biológia kurzus 8. hét. Kun Lídia Genetikai, Sejt és Immunbiológiai Intézet

Sejtmozgás és adhézió Molekuláris biológia kurzus 8. hét. Kun Lídia Genetikai, Sejt és Immunbiológiai Intézet Sejtmozgás és adhézió Molekuláris biológia kurzus 8. hét Kun Lídia Genetikai, Sejt és Immunbiológiai Intézet Sejtmozgás -amőboid - csillós - kontrakció Sejt adhézió -sejt-ecm -sejt-sejt MOZGÁS A sejtmozgás

Részletesebben

A citoszkeletális rendszer, a harántcsíkolt izom biofizikája.

A citoszkeletális rendszer, a harántcsíkolt izom biofizikája. A citoszkeletális rendszer, a harántcsíkolt izom biofizikája. SCIENCE PHOTO LIBRARY Kupi Tünde 2010. 10. 19. Citoszkeleton: eukarióta sejtek dinamikus fehérjevázrendszere Három fı filamentum-osztály: A.

Részletesebben

Biofizika I 2013-2014 2014.12.02.

Biofizika I 2013-2014 2014.12.02. ÁTTEKINTÉS AZ IZOM TÍPUSAI: SZERKEZET és FUNKCIÓ A HARÁNTCSÍKOLT IZOM SZERKEZETE MŰKÖDÉSÉNEK MOLEKULÁRIS MECHANIZMUSA IZOM MECHANIKA Biofizika I. -2014. 12. 02. 03. Dr. Bugyi Beáta PTE ÁOK Biofizikai Intézet

Részletesebben

Sejtciklus. Sejtciklus. Centriólum ciklus (centroszóma ciklus) A sejtosztódás mechanizmusa. Mikrotubulusok és motor fehérjék szerepe a mitózisban

Sejtciklus. Sejtciklus. Centriólum ciklus (centroszóma ciklus) A sejtosztódás mechanizmusa. Mikrotubulusok és motor fehérjék szerepe a mitózisban A sejtosztódás mechanizmusa Mikrotubulusok és motor fehérjék szerepe a mitózisban 2010.03.23. Az M fázis alatti események: mag osztódása (mitózis) mitotikus orsó: MT + MAP (pl. motorfehérjék) citoplazma

Részletesebben

A citoszkeleton. A citoszkeleton, a motorfehérjék, az izom és működésének szabályozása. A citoszkeleton. A citoszkeleton.

A citoszkeleton. A citoszkeleton, a motorfehérjék, az izom és működésének szabályozása. A citoszkeleton. A citoszkeleton. , a motorfehérjék, az izom és működésének szabályozása PTE ÁOK Biofizikai Intézet Ujfalusi Zoltán 2012. január-február Eukarióta sejtek dinamikus vázrendszere Három fő filamentum-osztály: 1. Intermedier

Részletesebben

A centriólum és a sejtek mozgási organellumai

A centriólum és a sejtek mozgási organellumai A centriólum A centriólum és a sejtek mozgási organellumai Egysejtű eukarióta sejtekben,soksejtű állatok sejtjeiben 9x3-triplet A,B és C tubulus alegységek hengerpalástszerű helyezkedéssel Hossza 0,3mm

Részletesebben

A citoszkeleton. A citoszkeleton, a motorfehérjék, az izom és működésének szabályozása. A citoszkeleton. A citoszkeleton. Az aktin.

A citoszkeleton. A citoszkeleton, a motorfehérjék, az izom és működésének szabályozása. A citoszkeleton. A citoszkeleton. Az aktin. , a motorfehérjék, az izom és működésének szabályozása PTE ÁOK Biofizikai Intézet Ujfalusi Zoltán 2011. január-február Eukarióta sejtek dinamikus vázrendszere Három fő filamentum-osztály: 1. Intermedier

Részletesebben

A sejtváz. Mikrotubulusok (25 nm átmérő) Mikrofilamentumok (7 nm átmérő) Intermedier filamentumok (8-12 nm átmérő)

A sejtváz. Mikrotubulusok (25 nm átmérő) Mikrofilamentumok (7 nm átmérő) Intermedier filamentumok (8-12 nm átmérő) A sejtváz A citoszkeleton, vagy sejtváz kötegek hálózatából felépülő struktúra, mely a sejt szilárdításán, alakjának biztosításán túl, a mozgásban, a szállításban is szerepet játszik. Három molekuláris

Részletesebben

2. AKTIN-KÖTŐ FEHÉRJÉK

2. AKTIN-KÖTŐ FEHÉRJÉK A CITOSZKELETÁLIS RENDSZER 2011. 02. 15. Bugyi Beáta PTE ÁOK, Biofizikai Intézet 2. AKTIN-KÖTŐ FEHÉRJÉK Citoszkeletális aktin HEp-2 sejtekben - rodamin-falloidin jelölés forrás: Nyitrai Miklós, Grama László,

Részletesebben

Biomolekulák nanomechanikája A biomolekuláris rugalmasság alapjai

Biomolekulák nanomechanikája A biomolekuláris rugalmasság alapjai Fogorvosi Anyagtan Fizikai Alapjai Biomolekulák nanomechanikája A biomolekuláris rugalmasság alapjai Mártonfalvi Zsolt Biofizikai és Sugárbiológiai Intézet Semmelweis Egyetem Budapest Biomolekulák mint

Részletesebben

SEJTBIOLÓGIA biomérnök hallgatók számára

SEJTBIOLÓGIA biomérnök hallgatók számára SEJTBIOLÓGIA biomérnök hallgatók számára Kilencedik rész: A citoszkeleton Novák Béla docens Proofreading: Sveiczer Ákos ösztöndíjas kutató 1994. december 16. Copyright 1994 BME, Mezõgazdasági Kémiai Technológia

Részletesebben

A biológiai mozgások. A biológiai mozgás molekuláris mechanizmusai. Motorfehérjék. Motorfehérjék közös tulajdonságai

A biológiai mozgások. A biológiai mozgás molekuláris mechanizmusai. Motorfehérjék. Motorfehérjék közös tulajdonságai A biológiai mozgások Molekuláris mozgás A biológiai mozgás molekuláris mechanizmusai Celluláris mozgás Mártonfalvi Zsolt Bakteriális flagellum Szervezet mozgása Keratocita mozgása felületen 1 Motorfehérjék

Részletesebben

Dinamikus fehérjerendszerek a sejtben. Kellermayer Miklós

Dinamikus fehérjerendszerek a sejtben. Kellermayer Miklós Dinamikus fehérjerendszerek a sejtben Kellermayer Miklós BIOLÓGIAI MOZGÁSOK Ritmusosan összehúzódó szívizomsejt Osztódó sejt Axon (neurit) növekedés Mozgó spermatociták BIOLÓGIAI MOZGÁSOK Tovakúszó keratinocita

Részletesebben

Sejtváz Sejtek mozgása

Sejtváz Sejtek mozgása Sejtváz Sejtek mozgása Sejtváz: Az eukarióta sejtekben vékony fonálszerű struktúra 3 fő alrendszer alkotja: Mikrofilamentumok: 7-9 nm átmérőjű aktinfonalakból áll; Intermedier filamentumok: 10 nm átmérőjűek;

Részletesebben

Motorfehérjék november 30.; Nyitrai

Motorfehérjék november 30.; Nyitrai Motorfehérjék 2011. november 30.; Nyitrai Molekuláris gépek A molekuláris mozgások alapját gyakran motor fehérjék biztosítják. Megértésük a biológia egyik súlyponti kérdése; Gépek a mikro/nano-világban

Részletesebben

Vezikuláris transzport

Vezikuláris transzport Molekuláris Sejtbiológia Vezikuláris transzport Dr. habil KŐHIDAI László Semmelweis Egyetem, Genetikai, Sejt- és Immunbiológiai Intézet 2005. november 3. Intracelluláris vezikul uláris transzport Kommunikáció

Részletesebben

Sejtváz, aktin mikrofilamentumok, motor fehérjék

Sejtváz, aktin mikrofilamentumok, motor fehérjék Sejtváz, aktin mikrofilamentumok, motor fehérjék Sejtváz Az eukarióta sejtek citoplazmájában található, fehérjefonalakból álló hálózat. (~citoszkeleton) Feladatai: -strukturális vázat alkotva, meghatározza

Részletesebben

Sejt. Aktin működés, dinamika plus / barbed end pozitív / szakállas vég 1. nukleáció 2. elongáció (hosszabbodás) 3. dinamikus egyensúly

Sejt. Aktin működés, dinamika plus / barbed end pozitív / szakállas vég 1. nukleáció 2. elongáció (hosszabbodás) 3. dinamikus egyensúly Biofizikai módszerek a citoszkeleton vizsgálatára I: Kinetikai és steady-state spektroszkópiai módszerek Sejt Citoszkeletális rendszerek Orbán József, 2014 április Institute of Biophysics Citoszkeleton:

Részletesebben

A Földön előforduló sejtek (pro- és eukarioták) közös és eltérő tulajdonságai. A sejtes szerveződés evolúciója.

A Földön előforduló sejtek (pro- és eukarioták) közös és eltérő tulajdonságai. A sejtes szerveződés evolúciója. A tárgy neve: Sejtbiológia előadás 1. Jellege: Törzs Gazda tanszék: Állattani és Sejtbiológiai Tanszék Felelős oktató: Dr. Gulya Károly Kredit: 2 Heti óraszám: 2 Típus: előadás Számonkérés: K A Földön

Részletesebben

Biofizika I

Biofizika I ÁTTEKINTÉS AZ IZOM 9. A HARÁNTCSÍKOLT IZOM SZERKEZETE ÉS MECHANIKÁJA 10. AZ IZOMMŰKÖDÉS ÉS SZABÁLYOZÁS MOLEKULÁRIS ALAPJAI TÍPUSAI: SZERKEZET és FUNKCIÓ MŰKÖDÉSÉNEK MOLEKULÁRIS MECHANIZMUSAI MECHANIKAI

Részletesebben

Biofizika I 2013-2014 2014.12.03.

Biofizika I 2013-2014 2014.12.03. Biofizika I. -2014. 12. 02. 03. Dr. Bugyi Beáta PTE ÁOK Biofizikai Intézet A KERESZTHÍD CIKLUSHOZ KAPCSOLÓDÓ ERŐKIEJTÉS egy kereszthíd ciklus során a miozin II fej elmozdulása: í ~10 nm 10 10 egy kereszthíd

Részletesebben

Makromolekulák. Fehérjetekeredé. rjetekeredés. Biopolimer. Polimerek

Makromolekulák. Fehérjetekeredé. rjetekeredés. Biopolimer. Polimerek Biopolimerek Makromolekulá Makromolekulák. Fehé Fehérjetekeredé rjetekeredés. Osztódó sejt magorsófonala 2011. November 16. Huber Tamá Tamás Dohány levél epidermális sejtjének aktin hálózata Bakteriofágból

Részletesebben

A rendezetlen TPPP/p25 szerkezeti sokfélesége és funkciói

A rendezetlen TPPP/p25 szerkezeti sokfélesége és funkciói A rendezetlen TPPP/p25 szerkezeti sokfélesége és funkciói Doktori (Ph.D) értekezés Zotter Ágnes Okleveles vegyész Témavezetı: Prof. Ovádi Judit, az MTA doktora, tudományos tanácsadó ELTE TTK Biológia Doktori

Részletesebben

A biológiai mozgások. Motorfehérjék. Motorfehérjék közös tulajdonságai 4/22/2015. A biológiai mozgás molekuláris mechanizmusai. Szerkezeti homológia

A biológiai mozgások. Motorfehérjék. Motorfehérjék közös tulajdonságai 4/22/2015. A biológiai mozgás molekuláris mechanizmusai. Szerkezeti homológia A biológiai mozgások Molekuláris mozgás A biológiai mozgás molekuláris mechanizmusai. Celluláris mozgás Mártonfalvi Zsolt Bakteriális flagellum Szervezet mozgása Keratocita mozgása felületen Motorfehérjék

Részletesebben

DNS, RNS, Fehérjék. makromolekulák biofizikája. Biológiai makromolekulák. A makromolekulák TÖMEG szerinti mennyisége a sejtben NAGY

DNS, RNS, Fehérjék. makromolekulák biofizikája. Biológiai makromolekulák. A makromolekulák TÖMEG szerinti mennyisége a sejtben NAGY makromolekulák biofizikája DNS, RNS, Fehérjék Kellermayer Miklós Tér Méret, alak, lokális és globális szerkezet Idő Fluktuációk, szerkezetváltozások, gombolyodás Kölcsönhatások Belső és külső kölcsöhatások,

Részletesebben

A glükóz reszintézise.

A glükóz reszintézise. A glükóz reszintézise. A glükóz reszintézise. A reszintézis nem egyszerű megfordítása a glikolízisnek. A glikolízis 3 irrevezibilis lépése más úton játszódik le. Ennek oka egyrészt energetikai, másrészt

Részletesebben

Elektronmikroszkópos képek gyűjteménye az ÁOK-s hallgatók részére

Elektronmikroszkópos képek gyűjteménye az ÁOK-s hallgatók részére Prof. Dr. Röhlich Pál Dr. L. Kiss Anna Dr. H.-inkó Krisztina Elektronmikroszkópos képek gyűjteménye az ÁOK-s hallgatók részére Semmelweis Egyetem, Humánmorfológiai és Fejlődésbiológiai Intézet ny n N L

Részletesebben

Tudjunk Egymásról Bugyi Beáta 22/11/2012

Tudjunk Egymásról Bugyi Beáta 22/11/2012 Listeria monocytogenes Loisel, Boujemaa et al. Nature 1999 Összetett aktin hálózatok Spire/formin szinergia Reymann et al. Nature Materials 1 ADF/aktin Bosch, Bugyi B et al. Molecular Cell 7 Reymann et

Részletesebben

2007/11/05 Molekuláris biológia előadások - Putnoky 1-1

2007/11/05 Molekuláris biológia előadások - Putnoky 1-1 1-1 Fehérje transzportmechanizmusok az eukariota sejtben: 1) transzmembrán transzport kitekert formában, egyedi fehérjék transzportja célzottan - citoszol ER, citoszol MT 2) póruson keresztüli transzport

Részletesebben

NÖVÉNYGENETIKA. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP /1/A

NÖVÉNYGENETIKA. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP /1/A NÖVÉNYGENETIKA Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 A NÖVÉNYI TÁPANYAG TRANSZPORTEREK az előadás áttekintése A tápionok útja a növényben Növényi tápionok passzív és

Részletesebben

TPPP, EGY ÚJ FEHÉRJE CSALÁD: HOMOLÓG SZEKVENCIÁK ELTÉRŐ SZERKEZETI ÉS FUNKCIONÁLIS SAJÁTSÁGOKKAL

TPPP, EGY ÚJ FEHÉRJE CSALÁD: HOMOLÓG SZEKVENCIÁK ELTÉRŐ SZERKEZETI ÉS FUNKCIONÁLIS SAJÁTSÁGOKKAL TPPP, EGY ÚJ FEHÉRJE CSALÁD: HOMOLÓG SZEKVENCIÁK ELTÉRŐ SZERKEZETI ÉS FUNKCIONÁLIS SAJÁTSÁGOKKAL Vincze Orsolya Eötvös Loránd Tudományegyetem Biológia Doktori Iskola (Iskolavezető: Dr. Erdei Anna) Molekuláris

Részletesebben

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Azonosító szám: TÁMOP-4.1.2-08/1/A-2009-0011 Az orvosi

Részletesebben

Az élő sejt fizikai Biológiája:

Az élő sejt fizikai Biológiája: Az élő sejt fizikai Biológiája: Modellépítés, biológiai rendszerek skálázódása Kellermayer Miklós Fizikai biológia Ma már nem csak kvalitatív megfigyeléseket, hanem kvantitatív méréseket végzünk (biológiai

Részletesebben

Fehérje szintézis 2. TRANSZLÁCIÓ Molekuláris biológia kurzus 7. hét. Kun Lídia Genetikai, Sejt- és immunbiológiai Intézet

Fehérje szintézis 2. TRANSZLÁCIÓ Molekuláris biológia kurzus 7. hét. Kun Lídia Genetikai, Sejt- és immunbiológiai Intézet Fehérje szintézis 2. TRANSZLÁCIÓ Molekuláris biológia kurzus 7. hét Kun Lídia Genetikai, Sejt- és immunbiológiai Intézet Gén mrns Fehérje Transzkripció Transzláció A transzkriptum : mrns Hogyan mutatható

Részletesebben

EGY ÚJ DROSOPHILA FORMIN SZÖVETSPECIFIKUS FUNKCIÓINAK GENETIKAI, SEJTBIOLÓGIAI, ÉS BIOKÉMIAI VIZSGÁLATA. Ph.D. értekezés

EGY ÚJ DROSOPHILA FORMIN SZÖVETSPECIFIKUS FUNKCIÓINAK GENETIKAI, SEJTBIOLÓGIAI, ÉS BIOKÉMIAI VIZSGÁLATA. Ph.D. értekezés EGY ÚJ DROSOPHILA FORMIN SZÖVETSPECIFIKUS FUNKCIÓINAK GENETIKAI, SEJTBIOLÓGIAI, ÉS BIOKÉMIAI VIZSGÁLATA Ph.D. értekezés Készítette: Matusek Tamás Témavezető: Dr. Mihály József Magyar Tudományos Akadémia

Részletesebben

MULTICELLULÁRIS SZERVEZŐDÉS: SEJT-SEJT (SEJT-MÁTRIX) KÖLCSÖNHATÁSOK 1. Bevezetés (2.)Extracelluláris mátrix (ECM) (Kollagén, hialuron sav,

MULTICELLULÁRIS SZERVEZŐDÉS: SEJT-SEJT (SEJT-MÁTRIX) KÖLCSÖNHATÁSOK 1. Bevezetés (2.)Extracelluláris mátrix (ECM) (Kollagén, hialuron sav, MULTICELLULÁRIS SZERVEZŐDÉS: SEJT-SEJT (SEJT-MÁTRIX) KÖLCSÖNHATÁSOK 1. Bevezetés (2.)Extracelluláris mátrix (ECM) (Kollagén, hialuron sav, proteoglikánok) (3.)Multiadhéziós fehérjék és sejtfelszíni receptorok

Részletesebben

TRANSZPORTFOLYAMATOK 1b. Fehérjék. 1b. FEHÉRJÉK TRANSZPORTJA A MEMBRÁNONOKBA ÉS A SEJTSZERVECSKÉK BELSEJÉBE ÁLTALÁNOS

TRANSZPORTFOLYAMATOK 1b. Fehérjék. 1b. FEHÉRJÉK TRANSZPORTJA A MEMBRÁNONOKBA ÉS A SEJTSZERVECSKÉK BELSEJÉBE ÁLTALÁNOS 1b. FEHÉRJÉK TRANSZPORTJA A MEMBRÁNONOKBA ÉS A SEJTSZERVECSKÉK BELSEJÉBE ÁLTALÁNOS DIA 1 Fő fehérje transzport útvonalak Egy tipikus emlős sejt közel 10,000 féle fehérjét tartalmaz (a test pedig összesen

Részletesebben

S-2. Jelátviteli mechanizmusok

S-2. Jelátviteli mechanizmusok S-2. Jelátviteli mechanizmusok A sejtmembrán elválaszt és összeköt. Ez az információ-áramlásra különösen igaz! 2.1. A szignál-transzdukció elemi lépései Hírvivô (transzmitter, hormon felismerése = kötôdés

Részletesebben

MOTORENZIMEK MŰKÖDÉSÉNEK SOKFÉLESÉGE

MOTORENZIMEK MŰKÖDÉSÉNEK SOKFÉLESÉGE MOTORENZIMEK MŰKÖDÉSÉNEK SOKFÉLESÉGE MTA doktori értekezés Kovács Mihály Eötvös Loránd Tudományegyetem Természettudományi Kar Biológiai Intézet Biokémiai Tanszék 2010 Tartalomjegyzék 1. Összefoglalás 4

Részletesebben

FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest,

FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest, FEHÉRJÉK A MÁGNESEKBEN Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium Alkímia Ma, Budapest, 2013.02.28. I. FEHÉRJÉK: L-α aminosavakból felépülő lineáris polimerek α H 2 N CH COOH amino

Részletesebben

Tropomiozin és nehéz meromiozin hatása a formin által nukleált aktin filamentumok flexibilitására

Tropomiozin és nehéz meromiozin hatása a formin által nukleált aktin filamentumok flexibilitására Tropomiozin és nehéz meromiozin hatása a formin által nukleált aktin filamentumok flexibilitására Ujfalusi Zoltán Témavezető: PROF. DR. N YITRAI MIKLÓS Doktori iskola: I n t e r d i s z c i p l i n á r

Részletesebben

Növény : látszólag könnyű definiálni antropomorf megközelítés, tudományos ill. tudományos hagyományok Élő a növény?

Növény : látszólag könnyű definiálni antropomorf megközelítés, tudományos ill. tudományos hagyományok Élő a növény? MI A NÖVÉNY? (1) Növény : látszólag könnyű definiálni antropomorf megközelítés, tudományos ill. tudományos hagyományok Élő a növény? Helyhez kötött, nem mozog. Nem reagál a külső (mechanikai) ingerekre.

Részletesebben

Fehérje-fehérje kölcsönhatások és kölcsönhatási hálózatok. Szilágyi András

Fehérje-fehérje kölcsönhatások és kölcsönhatási hálózatok. Szilágyi András Fehérje-fehérje kölcsönhatások és kölcsönhatási hálózatok Szilágyi András Vázlat Fehérje-fehérje kölcsönhatások Kölcsönhatási hálózatok Kísérleti módszerek Bioinformatikai vonatkozások adatbázisok szerkezetfüggetlen

Részletesebben

Natív antigének felismerése. B sejt receptorok, immunglobulinok

Natív antigének felismerése. B sejt receptorok, immunglobulinok Natív antigének felismerése B sejt receptorok, immunglobulinok B és T sejt receptorok A B és T sejt receptorok is az immunglobulin fehérje család tagjai A TCR nem ismeri fel az antigéneket, kizárólag az

Részletesebben

Sejtadhézió. Sejtkapcsoló struktúrák

Sejtadhézió. Sejtkapcsoló struktúrák Sejtadhézió Sejtkapcsoló struktúrák Sejtadhézió jelentősége: Sejtlemezek kialakulása Sejtadhézió jelentősége: Többrétegű sejtsorok kialakulása Limfociták kilépése az endotélen Rolling Adhézió Belépés homing

Részletesebben

Izomműködés. Az izommozgás. az állati élet legszembetűnőbb külső jele a mozgás amőboid, ostoros ill. csillós és izomösszehúzódással

Izomműködés. Az izommozgás. az állati élet legszembetűnőbb külső jele a mozgás amőboid, ostoros ill. csillós és izomösszehúzódással Izomműködés Az izommozgás az állati élet legszembetűnőbb külső jele a mozgás amőboid, ostoros ill. csillós és izomösszehúzódással történő mozgás van Galenus id. II.szd. - az idegekből animal spirit folyik

Részletesebben

Immunológia alapjai előadás. Az immunológiai felismerés molekuláris összetevői.

Immunológia alapjai előadás. Az immunológiai felismerés molekuláris összetevői. Immunológia alapjai 3 4. előadás Az immunológiai felismerés molekuláris összetevői. Az antigén fogalma. Antitestek, T- és B- sejt receptorok: molekuláris szerkezet, funkciók, alcsoportok Az antigén meghatározása

Részletesebben

A SEJTOSZTÓDÁS Halasy Katalin

A SEJTOSZTÓDÁS Halasy Katalin 1 A SEJTOSZTÓDÁS Halasy Katalin Az élő sejtek anyagcseréjük során növekednek, genetikailag meghatározott élettartamuk van, elhasználódnak, elöregednek, majd elpusztulnak. Az elpusztult sejtek pótlására

Részletesebben

A kemotaxis biológiai és klinikai

A kemotaxis biológiai és klinikai A kemotaxis biológiai és klinikai jelentősége - Válogatott fejezetek A kemotaxis biológiai és klinikai jelentősége - Válogatott fejezetek - Írta: Kőhidai László Szakmailag ellenőrizte: Csaba György Láng

Részletesebben

Receptorok és szignalizációs mechanizmusok

Receptorok és szignalizációs mechanizmusok Molekuláris sejtbiológia: Receptorok és szignalizációs mechanizmusok Dr. habil Kőhidai László Semmelweis Egyetem Genetikai, Sejt- és Immunbiológiai Intézet Sejtek szignalizációs kapcsolatai Sejtek szignalizációs

Részletesebben

A dezmin nanomechanikai vizsgálata

A dezmin nanomechanikai vizsgálata A dezmin nanomechanikai vizsgálata Doktori értekezés Dr. Kiss Balázs Semmelweis Egyetem Elméleti Orvostudományok Doktori Iskola Témavezető: Dr. Kellermayer Miklós egyetemi tanár, az orvostudományok doktora

Részletesebben

JELUTAK 2. A Jelutak Komponensei

JELUTAK 2. A Jelutak Komponensei JELUTAK 2. A Jelutak Komponensei TARTALOM - 1. Előadás: A jelutak komponensei 1. Egy egyszerű jelösvény 2. Jelmolekulák 3. Receptorok 4. Intracelluláris jelmolekulák 1 1.1. Egy tipikus jelösvény sémája

Részletesebben

1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói

1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói 1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói Plazmamembrán Membrán funkciói: sejt integritásának fenntartása állandó hő, energia, és információcsere biztosítása homeosztázis

Részletesebben

A SEJTOSZTÓDÁS Halasy Katalin

A SEJTOSZTÓDÁS Halasy Katalin A SEJTOSZTÓDÁS Halasy Katalin Összefoglalás A fejezet tartalmazza a sejtciklus fázisainak (G 1, S, G 2, M, ill.g 0 ) leírását, majd a testi sejtek keletkezési módját, a számtartó mitotikus osztódás lépéseinek

Részletesebben

A harántcsíkolt izom struktúrája általános felépítés

A harántcsíkolt izom struktúrája általános felépítés harántcsíkolt izom struktúrája általános felépítés LC-2 Izom LC1/3 Izom fasciculus LMM S-2 S-1 HMM rod Miozin molekula S-1 LMM HMM S-2 S-1 Izomrost H Band Z Disc csík I csík M Z-Szarkomér-Z Miofibrillum

Részletesebben

Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek

Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek Hidroxikarbonsavak α-hidroxi karbonsavak -Glikolsav (kézkrémek) - Tejsav (tejtermékek, izomláz, fogszuvasodás) - Citromsav (citrusfélékben,

Részletesebben

Fehérjeszerkezet, és tekeredés

Fehérjeszerkezet, és tekeredés Fehérjeszerkezet, és tekeredés Futó Kinga 2013.10.08. Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983

Részletesebben

Flagellin alapú filamentáris nanoszerkezetek létrehozása

Flagellin alapú filamentáris nanoszerkezetek létrehozása Flagellin alapú filamentáris nanoszerkezetek létrehozása Vonderviszt Ferenc PE MÜKKI Bio-Nanorendszerek Laboratórium MTA Enzimológiai Intézete MTA MFA Bakteriális flagellumok Flagelláris filamentum: ~10

Részletesebben

Fehérjeszerkezet, és tekeredés. Futó Kinga

Fehérjeszerkezet, és tekeredés. Futó Kinga Fehérjeszerkezet, és tekeredés Futó Kinga Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983 H 211861 N

Részletesebben

Új könnyűlánc diagnosztika. Dr. Németh Julianna Országos Gyógyintézeti Központ Immundiagnosztikai Osztály MLDT-MIT Továbbképzés 2006

Új könnyűlánc diagnosztika. Dr. Németh Julianna Országos Gyógyintézeti Központ Immundiagnosztikai Osztály MLDT-MIT Továbbképzés 2006 Új könnyűlánc diagnosztika Dr. Németh Julianna Országos Gyógyintézeti Központ Immundiagnosztikai Osztály MLDT-MIT Továbbképzés 2006 1845 Bence Jones Protein vizelet fehérje 1922 BJP I-II típus 1956 BJP

Részletesebben

Eukariota állati sejt

Eukariota állati sejt Eukariota állati sejt SEJTMEMBRÁN A sejtek működéséhez egyszerre elengedhetetlen a környezettől való elhatárolódás és a környezettel való kapcsolat kialakítása. A sejtmembrán felelős többek közt azért,

Részletesebben

Intracelluláris ion homeosztázis I.-II. Február 15, 2011

Intracelluláris ion homeosztázis I.-II. Február 15, 2011 Intracelluláris ion homeosztázis I.II. Február 15, 2011 Ca 2 csatorna 1 Ca 2 1 Ca 2 EC ~2 mm PLAZMA Na /Ca 2 cserélő Ca 2 ATPáz MEMBRÁN Ca 2 3 Na ATP ADP 2 H IC ~100 nm citoszol kötött Ca 2 CR CSQ SERCA

Részletesebben

MEDICINÁLIS ALAPISMERETEK BIOKÉMIA AZ IZOMMŰKÖDÉS 1. kulcsszó cím: A SZERVEZETBEN ELŐFORDULÓ IZOM- SZÖVETEK TÍPUSAI 1. képernyő cím: Sima izomszövet

MEDICINÁLIS ALAPISMERETEK BIOKÉMIA AZ IZOMMŰKÖDÉS 1. kulcsszó cím: A SZERVEZETBEN ELŐFORDULÓ IZOM- SZÖVETEK TÍPUSAI 1. képernyő cím: Sima izomszövet Modul cím: MEDICINÁLIS ALAPISMERETEK BIOKÉMIA AZ IZOMMŰKÖDÉS 1. kulcsszó cím: A SZERVEZETBEN ELŐFORDULÓ IZOM- SZÖVETEK TÍPUSAI 1. képernyő cím: Sima izomszövet G001 akaratunktól függetlenül működik; lassú,

Részletesebben

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Azonosító szám: TÁMOP-4.1.2-08/1/A-2009-0011 Az orvosi

Részletesebben

Szerkezet és funkció kapcsolata a membránműködésben. Folyadékkristályok típusai (1) Dr. Voszka István

Szerkezet és funkció kapcsolata a membránműködésben. Folyadékkristályok típusai (1) Dr. Voszka István MODELLMEMBRÁNOK (LIPOSZÓMÁK) ORVOSI, GYÓGYSZERÉSZI ALKALMAZÁSA 2012/2013 II. félév II. 7. Szerkezet és funkció kapcsolata a membránműködésben Dr. Voszka István II. 21. Liposzómák előállítási módjai Dr.

Részletesebben

Endocitózis - Exocitózis

Endocitózis - Exocitózis Molekuláris sejtbiológia Endocitózis - Exocitózis Dr. habil.. Kőhidai László Semmelweis Egyetem Genetikai, Sejt- és Immnubiológiai Intézet Budapest Endocitózis Fagocitózis szilárd fázishoz közel álló

Részletesebben

-Két fő korlát: - asztrogliák rendkívüli morfológiája -Ca szignálok értelmezési nehézségei

-Két fő korlát: - asztrogliák rendkívüli morfológiája -Ca szignálok értelmezési nehézségei Nature reviewes 2015 - ellentmondás: az asztrociták relatív lassú és térben elkent Ca 2+ hullámokkal kommunikálnak a gyors és pontos neuronális körökkel - minőségi ugrás kell a kísérleti és analitikai

Részletesebben

Beadási határidő: 2009.11.22. (éjfél). Beadandó: a program, valamint teljes dokumentáció szövegszerkesztővel

Beadási határidő: 2009.11.22. (éjfél). Beadandó: a program, valamint teljes dokumentáció szövegszerkesztővel 1. Készítsen programot, amely meghatározza a leghosszabb harmadfokú árvízvédelmi készültségű folyószakaszt! 2. Készítsen programot, amely meghatározza a legmagasabb vízállást tartalmazó árvízvédelmi készültségű

Részletesebben

A kemotaxis biológiai és. klinikai jelentősége. Kőhidai László

A kemotaxis biológiai és. klinikai jelentősége. Kőhidai László A kemotaxis biológiai és klinikai jelentősége Kőhidai László Budapest - 2008 Tartalom 1. Bevezetés 2. A kemotaxis biológiai jelentősége 3. Alapfogalmak 3.1 3.1.1 Migráció 3.1.2 Kemokinezis 3.1.3 Ortokinezis

Részletesebben

Az emberi sejtek általános jellemzése

Az emberi sejtek általános jellemzése Sejttan (cytológia) Az emberi sejtek általános jellemzése A sejtek a szervezet alaki és működési egységei Alakjuk: nagyon változó. Meghatározza: Sejtek funkciója Felületi feszültség Sejtplazma sűrűsége

Részletesebben

A sejtváz. Mikrotubulusok (25 nm átmérő) Mikrofilamentumok (7 nm átmérő) Intermedier filamentumok (8-12 nm átmérő)

A sejtváz. Mikrotubulusok (25 nm átmérő) Mikrofilamentumok (7 nm átmérő) Intermedier filamentumok (8-12 nm átmérő) A sejtváz A citoszkeleton, vagy sejtváz kötegek hálózatából felépülő struktúra, mely a sejt szilárdításán, alakjának biztosításán túl, a mozgásban, a szállításban is szerepet játszik. Három molekuláris

Részletesebben

Szerkezet és funkció kapcsolata a membránműködésben. Folyadékkristályok típusai (1) Dr. Voszka István

Szerkezet és funkció kapcsolata a membránműködésben. Folyadékkristályok típusai (1) Dr. Voszka István MODELLMEMBRÁNOK (LIPOSZÓMÁK) ORVOSI, GYÓGYSZERÉSZI ALKALMAZÁSA 2015/2016 II. félév Időpont: szerda 17 30-19 00 Helyszín Elméleti Orvostudományi Központ Szent-Györgyi Albert előadóterme II. 3. Szerkezet

Részletesebben

A stresszválasz és a membránok kapcsolata emlıs sejtekben

A stresszválasz és a membránok kapcsolata emlıs sejtekben A stresszválasz és a membránok kapcsolata emlıs sejtekben DOKTORI (PhD) ÉRTEKEZÉS Szegedi Tudományegyetem Biológia Doktori Iskola Készítette: Nagy Enikı Témavezetı: Prof. Dr. Vígh László Magyar Tudományos

Részletesebben

Nanomedicina Szimpózium, 2008. Nanomechanika: Egyedi Biomolekulák Manipulálása. Kellermayer Miklós

Nanomedicina Szimpózium, 2008. Nanomechanika: Egyedi Biomolekulák Manipulálása. Kellermayer Miklós Nanomedicina Szimpózium, 28 Nanomechanika: Egyedi Biomolekulák Manipulálása Kellermayer Miklós Semmelweis Egyetem Általános Orvostudományi Kar Biofizikai és Sugárbiológiai Intézet ÉLŐ SEJTBEN: BONYOLULT

Részletesebben

Biopolimer 12/7/09. Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. DNS. Polimerek. Kardos Roland DNS elsődleges szerkezete

Biopolimer 12/7/09. Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. DNS. Polimerek. Kardos Roland DNS elsődleges szerkezete Biopolimerek Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. Osztódó sejt magorsófonala Kardos Roland 2009.10.29. Dohány levél epidermális sejtjének aktin hálózat Bakteriofágból kiszabaduló

Részletesebben

A jel-molekulák útja változó hosszúságú lehet. A jelátvitel. hírvivő molekula (messenger) elektromos formában kódolt információ

A jel-molekulák útja változó hosszúságú lehet. A jelátvitel. hírvivő molekula (messenger) elektromos formában kódolt információ A jelátvitel hírvivő molekula (messenger) elektromos formában kódolt információ A jel-molekulák útja változó hosszúságú lehet 1. Endokrin szignalizáció: belső elválasztású mirigy véráram célsejt A jelátvitel:

Részletesebben

Nanotechnológia. Vonderviszt Ferenc. Veszprémi Egyetem Nanotechnológia Tanszék

Nanotechnológia. Vonderviszt Ferenc. Veszprémi Egyetem Nanotechnológia Tanszék Nanotechnológia Vonderviszt Ferenc Veszprémi Egyetem Nanotechnológia Tanszék Ősi technológiák Mikroelektronika Technológia: képesség az anyag szerkezetének, az anyagot felépítő részecskék elrendeződésének

Részletesebben

Az élő sejt fizikai Biológiája: motorfehérjék, egyensúlytól távoli folyamatok

Az élő sejt fizikai Biológiája: motorfehérjék, egyensúlytól távoli folyamatok Tematika Az élő sejt fizikai Biológiája: motorfehérjék, egyensúlytól távoli folyamatok Kellermayer Miklós Motorfehérjék működése. A munkaciklus Egyensúlytól távoli folyamatok. Erővezérelt fehérjegombolyodás.

Részletesebben

FLAGELLINALAPÚ MOLEKULÁRIS OBJEKTUMOK LÉTREHOZÁSA. Sebestyén Anett

FLAGELLINALAPÚ MOLEKULÁRIS OBJEKTUMOK LÉTREHOZÁSA. Sebestyén Anett Pannon Egyetem Műszaki Informatikai Kar Nanotechnológia Tanszék FLAGELLINALAPÚ MOLEKULÁRIS OBJEKTUMOK LÉTREHOZÁSA Doktori (PhD) értekezés tézisei Sebestyén Anett Környezettudományok Doktori Iskola Témavezető:

Részletesebben

1. Előadás Membránok felépítése, mebrán raftok

1. Előadás Membránok felépítése, mebrán raftok 1. Előadás Membránok felépítése, mebrán raftok Plazmamembrán Membrán funkciói: sejt integritásának fenntartása állandó hő, energia, és információcsere biztosítása homeosztázis biztosítása Klasszikus folyadékmozaik

Részletesebben

A fehérjék harmadlagos vagy térszerkezete. Még a globuláris fehérjék térszerkezete is sokféle lehet.

A fehérjék harmadlagos vagy térszerkezete. Még a globuláris fehérjék térszerkezete is sokféle lehet. A fehérjék harmadlagos vagy térszerkezete Még a globuláris fehérjék térszerkezete is sokféle lehet. A ribonukleáz redukciója és denaturálódása Chrisian B. Anfinsen A ribonukleáz renaturálódása 1972 obel-díj

Részletesebben

Izomszövet eredetű aktin izoformák termodinamikai és spektroszkópiai vizsgálata

Izomszövet eredetű aktin izoformák termodinamikai és spektroszkópiai vizsgálata Izomszövet eredetű aktin izoformák termodinamikai és spektroszkópiai vizsgálata PhD értekezés Készítette: Orbán József Témavezetők: DR. LŐRINCZY DÉNES DR. HILD GÁBOR Doktori Iskola: Doktori Iskola vezető:

Részletesebben

ANATÓMIA FITNESS AKADÉMIA

ANATÓMIA FITNESS AKADÉMIA ANATÓMIA FITNESS AKADÉMIA sejt szövet szerv szervrendszer sejtek általános jellemzése: az élet legkisebb alaki és működési egysége minden élőlény sejtes felépítésű minden sejtre jellemző: határoló rendszer

Részletesebben

Biológiai makromolekulák szerkezete

Biológiai makromolekulák szerkezete Biológiai makromolekulák szerkezete Biomolekuláris nemkovalens kölcsönhatások Elektrosztatikus kölcsönhatások (sóhidak: 4-6 kcal/m, dipól-dipól: ~10-1 kcal/m Diszperziós erők (~10-2 kcal/m) Hidrogén hidak

Részletesebben

AZ EMBERI TEST FELÉPÍTÉSE

AZ EMBERI TEST FELÉPÍTÉSE AZ EMBERI TEST FELÉPÍTÉSE Szalai Annamária ESZSZK GYITO Általános megfontolások anatómia-élettan: az egészséges emberi szervezet felépítésével és működésével foglalkozik emberi test fő jellemzői: kétoldali

Részletesebben

Fehérje expressziós rendszerek. Gyógyszerészi Biotechnológia

Fehérje expressziós rendszerek. Gyógyszerészi Biotechnológia Fehérje expressziós rendszerek Gyógyszerészi Biotechnológia Expressziós rendszerek Cél: rekombináns fehérjék előállítása nagy tisztaságban és nagy mennyiségben kísérleti ill. gyakorlati (therapia) felhasználásokra

Részletesebben

Immunológiai módszerek a klinikai kutatásban

Immunológiai módszerek a klinikai kutatásban Immunológiai módszerek a klinikai kutatásban 3. előadás Az immunrendszer molekuláris elemei: antigén, ellenanyag, Ig osztályok Az antigén meghatározása Detre László: antitest generátor - Régi meghatározás:

Részletesebben

ÚJ TÁVLATOK AZ S100 FEHÉRJÉK SZERKEZETI BIOLÓGIÁJÁBAN. Doktori (Ph.D.) értekezés. Kiss Bence

ÚJ TÁVLATOK AZ S100 FEHÉRJÉK SZERKEZETI BIOLÓGIÁJÁBAN. Doktori (Ph.D.) értekezés. Kiss Bence ÚJ TÁVLATOK AZ S100 FEHÉRJÉK SZERKEZETI BIOLÓGIÁJÁBAN Doktori (Ph.D.) értekezés Kiss Bence Eötvös Loránd Tudományegyetem, Természettudományi Kar, Biológia Doktori Iskola Doktori Iskola vezetője: Prof.

Részletesebben

OZMÓZIS, MEMBRÁNTRANSZPORT

OZMÓZIS, MEMBRÁNTRANSZPORT OZMÓZIS, MEMBRÁNTRANSZPORT Vig Andrea PTE ÁOK Biofizikai Intézet 2014.10.28. ÁTTEKINTÉS DIFFÚZIÓ BROWN-MOZGÁS a részecskék rendezetlen hőmozgása DIFFÚZIÓ a részecskék egyenletlen (inhomogén) eloszlásának

Részletesebben

Daganat immunterápia molekuláris markereinek tanulmányozása biofizikai módszerekkel. Áramlási és képalkotó citometria

Daganat immunterápia molekuláris markereinek tanulmányozása biofizikai módszerekkel. Áramlási és képalkotó citometria Daganat immunterápia molekuláris markereinek tanulmányozása biofizikai módszerekkel. Áramlási és képalkotó citometria Szöllősi János, Vereb György Biofizikai és Sejtbiológiai Intézet Orvos- és Egészségtudományi

Részletesebben

A kromoszómák kialakulása előtt a DNS állomány megkettőződik. A két azonos információ tartalmú DNS egymás mellé rendeződik és egy kromoszómát alkot.

A kromoszómák kialakulása előtt a DNS állomány megkettőződik. A két azonos információ tartalmú DNS egymás mellé rendeződik és egy kromoszómát alkot. Kromoszómák, Gének A kromoszóma egy hosszú DNS szakasz, amely a sejt életének bizonyos szakaszában (a sejtosztódás előkészítéseként) tömörödik, így fénymikroszkóppal láthatóvá válik. A kromoszómák két

Részletesebben

Kötések kialakítása - oktett elmélet

Kötések kialakítása - oktett elmélet Kémiai kötések Az elemek és vegyületek halmazai az atomok kapcsolódásával - kémiai kötések kialakításával - jönnek létre szabad atomként csak a nemesgázatomok léteznek elsődleges kémiai kötések Kötések

Részletesebben

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin.

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin. Myoglobin Fehérje-szerkezetek! MGLSDGEWQLVLNVWGKVEADIPGGQEVLIRLFK GPETLEKFDKFKLKSEDEMKASE DLKKGATVLTALGGILKKKGEAEIKPLAQSA TKKIPVKYLEFISECIIQVLQSK PGDFGADAQGAMNKALELFRKDMASNYKELGFQG Fuxreiter Mónika! Debreceni

Részletesebben

Egy idegsejt működése

Egy idegsejt működése 2a. Nyugalmi potenciál Egy idegsejt működése A nyugalmi potenciál (feszültség) egy nem stimulált ingerelhető sejt (neuron, izom, vagy szívizom sejt) membrán potenciálját jelenti. A membránpotenciál a plazmamembrán

Részletesebben