A citoszkeleton. A citoszkeleton, a motorfehérjék, az izom és működésének szabályozása. A citoszkeleton. A citoszkeleton.

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "A citoszkeleton. A citoszkeleton, a motorfehérjék, az izom és működésének szabályozása. A citoszkeleton. A citoszkeleton."


1 , a motorfehérjék, az izom és működésének szabályozása PTE ÁOK Biofizikai Intézet Ujfalusi Zoltán január-február Eukarióta sejtek dinamikus vázrendszere Három fő filamentum-osztály: 1. Intermedier filamentumok 2. Mikrotubulusok 3. Mikrofilamentumok Szubcelluláris, celluláris szintű mozgások ATP-t (energiát) igényel Intracelluláris mozgások Filamentumok kialakulása és lebomlása (mikrofilamentumok és mikrotubulusok) Motor fehérjék számára biztosítanak pályát retrakció Aktin dús kéreg álláb szubsztrát fokális kontaktusok aktin polimerizáció és álláb kitüremkedés nem polimerizált aktin mozgása álláb további növekedése Az aktin A sejtváz és kontraktilis rendszer három fő összetevőből áll: tubulin fehérjékből felépülő, ~24 nm átmérőjű mikrotubulusokból, aktin fehérjékből, valamint a velük társult proteinekből álló és ~6 nm átmérőjű mikrofilamentumokból, a sejtenként nagyon eltérő minőségű, a sejtekre jellemző, ~10 nm átmérőjű köztes (intermedier) filamentumokból. Alegység: globuláris (G-) aktin MW: 42,3 kda, 375 aminosav, 1 molekula kötött adenozin nukleotid (ATP vagy ADP) Szubdomének (4) 4 3 nukleotid 2 1 1

2 Az aktin Az aktin citoszkeleton A mikrotubulusok Alegység: tubulin MW: ~50 kda, a- és b-tubulin -> heterodimér 1 molekula kötött guanozin nukleotid (GTP vagy GDP); kicserélhető (b), ill. nem kicserélhető (mindig GTP) (a) ~24 nm vastag, üreges 13 párhuzamos protofilamentum építi fel jobbmenetes rövidmenetű helix balmenetes hosszúmenetű helix Merev polimerlánc (perzisztenciahossz: néhány mm!) Szerkezeti polarizáció: +vég: polimerizáció gyors, -vég: polimerizáció lassú GTP-sapka a b Intermedier filamentumok Szövetspecifikus intermedier filamentum típusok Nukleáris laminok A, B, C laminok (65-75kDa) Vimentin típus Vimentin (54kDa) Desmin (53kDa) Peripherin (66kDa) Keratinok I típusú (savanyú) (40-70kDa) II típusú (neutrális/bázikus) (40-70kDa) Neuronális IF neurofilamentum fehérjék (60-130kDa) Fibrózus monomer jellemzi őket (nem globuláris, mint az aktin vagy a tubulin). Az intermedier filamentum alegysége: coiled-coil dimer Intermedier filamentumok polimerizációja A sejtben teljesen polimerizált állapotban (nem dinamikus egyensúly) Centrális rudak (a-hélix) hidrofób-hidrofób kölcsönhatása -> colied-coil dimer 2 dimer -> tetramer (antiparallel elrendezôdés, szerkezeti apolaritás) protofilamentum Tetramerek longitudinális sorozata -> protofilamentum filamentum Vimentin dimer szalagdiagramja 8 protofilamentum -> filamentum 2

3 A motorfehérjék 1. Specifikus citoszkeletális filamentumhoz kapcsolódnak 2. A filamentum mentén elmozdulnak, illetve erőt fejtenek ki 3. ATP-t bontanak Motorfehérjék közös tulajdonságai N 1. Szerkezet N-terminális globuláris fej: - motor domén, nukleotidot köt és hasít C - specifikus kötőhely a megfelelő citoszkeletális polimer számára C-terminálisan: funkcionalitást biztosító kötőhely 2. Mechanika, működés Alapelv: ciklusos működés Motor -> kötődés a polimerhez -> húzás -> disszociáció -> relaxáció 1 mechanikai ciklusban 1 molekula ATP hidrolizálódik. A mechanikai ciklusban elmozdulás (izotóniás viszonyok) vagy erőkifejlődés (izometriás viszonyok) történik. A motorfehérjék típusai A miozin fehérje szupercsalád 1. Aktin-alapú: miozin fehérjecsalád. Konvencionális (miozin II) és nemkonvencionális miozinok Miozin I-XVIII osztályok 2. Mikrotubulus alapú a. Dinein Ciliáris (flagelláris) és citoplazmás dineinek. MW ~500kDa A mikrotubuluson a minusz vég irányába mozognak b. Kinezin Neuronokban, axonális vezikulum transzportért felelősek Kinezin fehérjecsalád: konvencionális kinezinek + izoformák. MW ~110 kda A mikrotubuluson a plusz vég irányába mozognak 3. Nukleinsav alapú DNS és RNS polimerázok A DNS szál mentén mozognak és erőt fejtenek ki Aktin-miozin kapcsolatok Kinezin és Dinein Fej motor domén Filamentumhoz való kapcsolódás (mikrotubulus) dimer ATP-kötő hely Farok Szállítmány ( cargo ) kötő domén Központi összekötő domén A dinein húzási ciklusa. A motorfehérje két szomszédos mikrotubulushoz kötődik, és így a két mikrotubulus relatív elmozdulását hozza létre (axonemal dinein). Egy rugalmas összekötő fehérje, a nexin, a relatív elmozdulást elhajlásba, görbülésbe viszi át. A miozin az aktin plusz vége felé mozog. 3

4 Erő Miért van szükség molekuláris motorokra? A harántcsíkolt izom szerkezete, az izomműködés és szabályozás molekuláris alapjai endocytosis exocytosis transzport Kromoszómák pozícionálása sejtosztódásnál Vezikula transzport a citoplazmába/n (élelem bekebelezése, salakanyagok kiürítése, fehérjék szállítása) Az izom citoszkeletális filamentumok és motorfehérjék rendezett összeszerveződéséből álló szövet, amely kémiai energiát nagy hatásfokkal alakít át mechanikai munkává. Vázizom (harántcsíkolt) Szívizom Simaizom Több 10 cm hosszú, μm vastag Multinukleáris (syncitiumok) Harántcsíkolat Izomtípusok 100 µm hosszú, 10 µm vastag Mononukleáris miociták hálózata Funkcionális syncitium Harántcsíkolat μm, 2-10 μm vastag Mononukleáris orsó alakú sejtek Nincsenek miofibrillumok, csak miofilamentumok nincs harántcsíkolat Akaratlagos Nem akaratlagos Nem akaratlagos A harántcsíkolt izom felépítése Harántcsíkolt izom Izomrost köteg Miofilamentumok Izomrost Miofibrillum Vastag filamentumok Vékony filamentumok Szarkomer Szarkomer A harántcsíkolt izom szerkezeti és működési egysége. A harántcsíkolt izom működése Izomkontrakció Elektromos impulzussal ingerelünk egy izomköteget Összehúzódás, elernyedés Izomrángás Inkomplett tetanusz Komplett tetanusz Elektronmikroszkópos felvétel Idő (ms) Periodikus ingerlés 4

5 Izometriás kontrakció Izotóniás kontrakció Izom hossza állandó Erő állandó Az izom addig húzódik össze, amíg a súllyal megegyező erőt nem fejt ki. Erő tetanusz G erő + - rángás hossz Idő G Idő Csúszófilamentum elmélet Nyugalmi Szarkomer A-csík változatlan, míg az I-csík rövidül Nem változik sem az aktin, sem a miozin filamentumok hossza Z-lemez H-zóna I-csík A-vonal Z-lemez H.E. Huxley és A.F. Huxley egymástól függetlenül állították fel a csúszó filamentum elméletet: az aktin és miozin elcsúszik egymáson (A.F. Huxley and Niedergerke (1954), H.E. Huxley and Hanson (1954)) Legjobb bizonyíték a hossz-feszülés viszony, minél nagyobb az átfedés, annál H-zóna rövidül I-csík rövidül A-vonal változatlan nagyobb feszülés Az elcsúszást a filamentumok közötti kereszthidak elmozdulása okozza A kontrakciót a SR-ból felszabaduló Ca 2+ ionok indítják be Kontrahált Rövidült szarkomer Vastag filamentum Vékony filamentum A harántcsíkolt izom teljesítménye Izomteljesítmény: Mi szabályozza az izmok működését? P=F*v Max. kifejtett erő (1,7pN/1 miozin kereszthíd): Aktin-miozin közötti kémiai kötések energiája szab határt Max. sebesség( 6000nm/s): ATP elhasítási sebesség max. értékével függ össze Váz és szívizomban: Simaizomban: 1. Tropomiozin 2. Troponin komplex 3. Ca 2+ A könnyű lánc foszforilációja A vázizom erő-sebesség diagramja Max. teljesítmény: A sebesség 1/3-nál Kagylóizomban: Az izom a befektetett kémiai energiát több, mint 50%-os hatékonysággal hasznosítja! Kálcium kötődése a miozinhoz 5

6 Tropomiozin A troponin komplex Minden 7 aktin monomerből és egy tropomiozinból álló fehérjekomplexhez egy troponin komplex kapcsolódik. Troponin T - MW 37 kda a tropomiozinhoz és a többi troponin fehérjéhez kötődik, stabilizálja a fehérjerendszert. A tropomiozin két molekula egymásba csavarodásával kialakuló coiled-coil dimer, mely 7 aktin protomerrel van kölcsönhatásban. A tandem módon elhelyezkedő tropomiozin dimerek a teljes aktin filamentumon végighúzódnak. Troponin I - MW 22 kda részt vesz az akto-miozin kölcsönhatás meggátolásában. Troponin C- MW 18 kda Kálcium hatására a szerkezetében bekövetkező konformációs változás az izom szabályozásának a kulcslépése. A troponin komplex nagy része a tropomiozin dimer közepén helyezkedik el. Az izomműködés szabályozása Az izom aktiválásához szabad kálciumionra van szükség. Idegi szabályozásra a szarkoplazmatikus retikulumból felszabaduló kálcium a citoplazma [Ca 2+ ]-t 1 μm felé emeli. 1. TnC Ca-t köt 2. Konformációváltozás a TnC egységben 3. TnC affinitása nő a TnI-hez 4. A TnI leválik az aktinról 5. Tropomiozin elmozdul, ezért már nem fedi le a miozinkötő helyet 6. Be tud kötni a miozin A szabályozás további lépései Rigor állapot +ATP -Ca 2+ Nyugalmi állapot + Ca 2+ Aktivált állapot, gyenge kölcsönhatás Leválik P i Aktivált állapot, erőgenerálás ADP leválik Rigor állapot Köszönöm a figyelmet! 6

A citoszkeleton. A citoszkeleton, a motorfehérjék, az izom és működésének szabályozása. A citoszkeleton. A citoszkeleton. Az aktin.

A citoszkeleton. A citoszkeleton, a motorfehérjék, az izom és működésének szabályozása. A citoszkeleton. A citoszkeleton. Az aktin. , a motorfehérjék, az izom és működésének szabályozása PTE ÁOK Biofizikai Intézet Ujfalusi Zoltán 2011. január-február Eukarióta sejtek dinamikus vázrendszere Három fő filamentum-osztály: 1. Intermedier


A citoszkeletális rendszer, a harántcsíkolt izom biofizikája.

A citoszkeletális rendszer, a harántcsíkolt izom biofizikája. A citoszkeletális rendszer, a harántcsíkolt izom biofizikája. SCIENCE PHOTO LIBRARY Kupi Tünde 2010. 10. 19. Citoszkeleton: eukarióta sejtek dinamikus fehérjevázrendszere Három fı filamentum-osztály: A.



A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA 2013.10.09. CITOSZKELETON - DEFINÍCIÓ Fehérjékből felépülő, a sejt vázát alkotó intracelluláris rendszer. Eukarióta és prokarióta sejtekben egyaránt megtalálható.


Biofizika I 2013-2014 2014.12.02.



A biológiai mozgások. Motorfehérjék. Motorfehérjék közös tulajdonságai 4/22/2015. A biológiai mozgás molekuláris mechanizmusai. Szerkezeti homológia

A biológiai mozgások. Motorfehérjék. Motorfehérjék közös tulajdonságai 4/22/2015. A biológiai mozgás molekuláris mechanizmusai. Szerkezeti homológia A biológiai mozgások Molekuláris mozgás A biológiai mozgás molekuláris mechanizmusai. Celluláris mozgás Mártonfalvi Zsolt Bakteriális flagellum Szervezet mozgása Keratocita mozgása felületen Motorfehérjék


A biológiai mozgás molekuláris mechanizmusai

A biológiai mozgás molekuláris mechanizmusai BIOLÓGIAI MOZGÁSOK A biológiai mozgás molekuláris mechanizmusai Kollektív mozgás Szervezet mozgása ( Az évszázad ugrása ) Szerv mozgás BIOLÓGIAI MOZGÁSOK BIOLÓGIAI MOZGÁSOK Ritmusosan összehúzódó szívizomsejt


A biológiai mozgások. A biológiai mozgás molekuláris mechanizmusai. Motorfehérjék. Motorfehérjék közös tulajdonságai

A biológiai mozgások. A biológiai mozgás molekuláris mechanizmusai. Motorfehérjék. Motorfehérjék közös tulajdonságai A biológiai mozgások Molekuláris mozgás A biológiai mozgás molekuláris mechanizmusai Celluláris mozgás Mártonfalvi Zsolt Bakteriális flagellum Szervezet mozgása Keratocita mozgása felületen 1 Motorfehérjék


Citoszkeleton. Sejtek rugalmassága. Polimer mechanika: Hooke-rugalmasság. A citoszkeleton filamentumai. Fogászati anyagtan fizikai alapjai 12.

Citoszkeleton. Sejtek rugalmassága. Polimer mechanika: Hooke-rugalmasság. A citoszkeleton filamentumai. Fogászati anyagtan fizikai alapjai 12. Fogászati anyagtan fizikai alapjai 12. Sejtek rugalmassága Citoszkeleton Eukariota sejtek dinamikus vázrendszere Három fő filamentum-osztály: A. Vékony (aktin) B. Intermedier C. Mikrotubulus Polimerizáció:


A harántcsíkolt izom struktúrája általános felépítés

A harántcsíkolt izom struktúrája általános felépítés harántcsíkolt izom struktúrája általános felépítés LC-2 Izom LC1/3 Izom fasciculus LMM S-2 S-1 HMM rod Miozin molekula S-1 LMM HMM S-2 S-1 Izomrost H Band Z Disc csík I csík M Z-Szarkomér-Z Miofibrillum





Biofizika I



Biofizika I 2013-2014 2014.12.03.

Biofizika I 2013-2014 2014.12.03. Biofizika I. -2014. 12. 02. 03. Dr. Bugyi Beáta PTE ÁOK Biofizikai Intézet A KERESZTHÍD CIKLUSHOZ KAPCSOLÓDÓ ERŐKIEJTÉS egy kereszthíd ciklus során a miozin II fej elmozdulása: í ~10 nm 10 10 egy kereszthíd


A citoszkeleton Eukarióta sejtváz

A citoszkeleton Eukarióta sejtváz A citoszkeleton Eukarióta sejtváz - Alak és belső szerkezet - Rugalmas struktúra sejt izomzat - Fehérjékből épül fel A citoszkeleton háromféle filamentumból épül fel Intermedier filamentum mikrotubulus


A citoszkeletális rendszer

A citoszkeletális rendszer A citoszkeletális rendszer Az eukarióta sejtek dinamikus fehérje-vázrendszere, amely specifikus fehérjepolimer filamentumokból épül fel. Mikrofilamentumok Mikrotubulusok Intermedier filamentumok Aktin


Izomműködés. Az izommozgás. az állati élet legszembetűnőbb külső jele a mozgás amőboid, ostoros ill. csillós és izomösszehúzódással

Izomműködés. Az izommozgás. az állati élet legszembetűnőbb külső jele a mozgás amőboid, ostoros ill. csillós és izomösszehúzódással Izomműködés Az izommozgás az állati élet legszembetűnőbb külső jele a mozgás amőboid, ostoros ill. csillós és izomösszehúzódással történő mozgás van Galenus id. II.szd. - az idegekből animal spirit folyik


Dinamikus fehérjerendszerek a sejtben. Kellermayer Miklós

Dinamikus fehérjerendszerek a sejtben. Kellermayer Miklós Dinamikus fehérjerendszerek a sejtben Kellermayer Miklós BIOLÓGIAI MOZGÁSOK Ritmusosan összehúzódó szívizomsejt Osztódó sejt Axon (neurit) növekedés Mozgó spermatociták BIOLÓGIAI MOZGÁSOK Tovakúszó keratinocita


Motorfehérjék november 30.; Nyitrai

Motorfehérjék november 30.; Nyitrai Motorfehérjék 2011. november 30.; Nyitrai Molekuláris gépek A molekuláris mozgások alapját gyakran motor fehérjék biztosítják. Megértésük a biológia egyik súlyponti kérdése; Gépek a mikro/nano-világban


Sejtmozgás és adhézió Molekuláris biológia kurzus 8. hét. Kun Lídia Genetikai, Sejt és Immunbiológiai Intézet

Sejtmozgás és adhézió Molekuláris biológia kurzus 8. hét. Kun Lídia Genetikai, Sejt és Immunbiológiai Intézet Sejtmozgás és adhézió Molekuláris biológia kurzus 8. hét Kun Lídia Genetikai, Sejt és Immunbiológiai Intézet Sejtmozgás -amőboid - csillós - kontrakció Sejt adhézió -sejt-ecm -sejt-sejt MOZGÁS A sejtmozgás


Jellemzői: általában akaratunktól függően működik, gyors, nagy erőkifejtésre képes, fáradékony.

Jellemzői: általában akaratunktól függően működik, gyors, nagy erőkifejtésre képes, fáradékony. Izomszövetek Szerkesztette: Vizkievicz András A citoplazmára általában jellemző összehúzékonyság (kontraktilitás) az izomszövetekben különösen nagymértékben fejlődött ki. Ennek oka, hogy a citoplazma összehúzódásáért


Tubulin, mikrotubuláris rendszer és mikrotubulus asszociált fehérjék

Tubulin, mikrotubuláris rendszer és mikrotubulus asszociált fehérjék Tubulin, mikrotubuláris rendszer és mikrotubulus asszociált fehérjék Talián Csaba Gábor PTE ÁOK, Biofizika Intézet 2011. február 22. Transzmissziós elektronmikroszkópos felvétel egy Heliozoa axopódiumának


Biomolekulák nanomechanikája A biomolekuláris rugalmasság alapjai

Biomolekulák nanomechanikája A biomolekuláris rugalmasság alapjai Fogorvosi Anyagtan Fizikai Alapjai Biomolekulák nanomechanikája A biomolekuláris rugalmasság alapjai Mártonfalvi Zsolt Biofizikai és Sugárbiológiai Intézet Semmelweis Egyetem Budapest Biomolekulák mint


Izomműködés. Harántcsíkolt izom. Simaizom és simaizom-alapú szervek biofizikája.

Izomműködés. Harántcsíkolt izom. Simaizom és simaizom-alapú szervek biofizikája. Izomműködés. Harántcsíkolt izom. Simaizom és simaizom-alapú szervek biofizikája. Hirdetés D.R. Wilkie professzor előadására a londoni Villamosmérnöki Intézetben. A téma: izom. Kapható: LINEÁRIS MOTOR.


A sejtváz. Mikrotubulusok (25 nm átmérő) Mikrofilamentumok (7 nm átmérő) Intermedier filamentumok (8-12 nm átmérő)

A sejtváz. Mikrotubulusok (25 nm átmérő) Mikrofilamentumok (7 nm átmérő) Intermedier filamentumok (8-12 nm átmérő) A sejtváz A citoszkeleton, vagy sejtváz kötegek hálózatából felépülő struktúra, mely a sejt szilárdításán, alakjának biztosításán túl, a mozgásban, a szállításban is szerepet játszik. Három molekuláris


Citoszkeleton Sejtmozgás

Citoszkeleton Sejtmozgás Citoszkeleton Sejtmozgás Citoszkeleton funkciói Sejtalak meghatározása Organellumok kihorgonyzása Organellumok mozgatása Húzószilárdság Kromoszóma mozgatás Sejtpolaritás Motilitás Citoszkeleton Mikrofilamentumok


Sejtváz Sejtek mozgása

Sejtváz Sejtek mozgása Sejtváz Sejtek mozgása Sejtváz: Az eukarióta sejtekben vékony fonálszerű struktúra 3 fő alrendszer alkotja: Mikrofilamentumok: 7-9 nm átmérőjű aktinfonalakból áll; Intermedier filamentumok: 10 nm átmérőjűek;


Sejtciklus. Sejtciklus. Centriólum ciklus (centroszóma ciklus) A sejtosztódás mechanizmusa. Mikrotubulusok és motor fehérjék szerepe a mitózisban

Sejtciklus. Sejtciklus. Centriólum ciklus (centroszóma ciklus) A sejtosztódás mechanizmusa. Mikrotubulusok és motor fehérjék szerepe a mitózisban A sejtosztódás mechanizmusa Mikrotubulusok és motor fehérjék szerepe a mitózisban 2010.03.23. Az M fázis alatti események: mag osztódása (mitózis) mitotikus orsó: MT + MAP (pl. motorfehérjék) citoplazma


Kollokviumi vizsgakérdések biokémiából humánkineziológia levelező (BSc) 2015

Kollokviumi vizsgakérdések biokémiából humánkineziológia levelező (BSc) 2015 Kollokviumi vizsgakérdések biokémiából humánkineziológia levelező (BSc) 2015 A kérdés 1. A sejtről általában, a szervetlen alkotórészeiről, a vízről részletesen. 2. A sejtről általában, a szervetlen alkotórészeiről,


DNS, RNS, Fehérjék. makromolekulák biofizikája. Biológiai makromolekulák. A makromolekulák TÖMEG szerinti mennyisége a sejtben NAGY

DNS, RNS, Fehérjék. makromolekulák biofizikája. Biológiai makromolekulák. A makromolekulák TÖMEG szerinti mennyisége a sejtben NAGY makromolekulák biofizikája DNS, RNS, Fehérjék Kellermayer Miklós Tér Méret, alak, lokális és globális szerkezet Idő Fluktuációk, szerkezetváltozások, gombolyodás Kölcsönhatások Belső és külső kölcsöhatások,


Az izomműködés élettana

Az izomműködés élettana Az izomműködés élettana 1./11 Somogyi Magdolna Az izomszövet kontraktilis szövet Az izomműködés élettana Tipikus működése szerint összehúzódásra és elernyedésre képes Ennek eredményeként mozgatható a test



2. AKTIN-KÖTŐ FEHÉRJÉK A CITOSZKELETÁLIS RENDSZER 2011. 02. 15. Bugyi Beáta PTE ÁOK, Biofizikai Intézet 2. AKTIN-KÖTŐ FEHÉRJÉK Citoszkeletális aktin HEp-2 sejtekben - rodamin-falloidin jelölés forrás: Nyitrai Miklós, Grama László,


Az izommőködéssel járó élettani jelenségek

Az izommőködéssel járó élettani jelenségek Az izommőködéssel járó élettani jelenségek Az izomszövet az egyetlen olyan szövet, amely hosszúságát változtatni tudja. Egy nem elhízott (non-obese) hölgyben az izomtömeg a testsúly 25-35 %-a, férfiben


Vázizom Simaizom. Szentesi Péter

Vázizom Simaizom. Szentesi Péter Vázizom Simaizom Szentesi Péter A harántcsíkolt izom struktúrája általános felépítés LC-2 Izom LC1/3 Izom fasciculus LMM S-2 S-1 HMM rod Miozin molekula S-1 LMM HMM S-2 S-1 Izomrost H Band Z Disc A csík


Nanomedicina Szimpózium, 2008. Nanomechanika: Egyedi Biomolekulák Manipulálása. Kellermayer Miklós

Nanomedicina Szimpózium, 2008. Nanomechanika: Egyedi Biomolekulák Manipulálása. Kellermayer Miklós Nanomedicina Szimpózium, 28 Nanomechanika: Egyedi Biomolekulák Manipulálása Kellermayer Miklós Semmelweis Egyetem Általános Orvostudományi Kar Biofizikai és Sugárbiológiai Intézet ÉLŐ SEJTBEN: BONYOLULT


A harántcsíkolt izomrostok típusai:

A harántcsíkolt izomrostok típusai: A harántcsíkolt izomrostok típusai: 1. Vörös (aerob) rostok: vékony rostok nagy mennyiségű mioglobinnal citokrómmal mitokondriummal 2. Fehér (anaerob) rostok: vastag rostok kevés mioglobinnal citokrómmal


TERMELÉSÉLETTAN. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 projekt

TERMELÉSÉLETTAN. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 projekt Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 projekt TERMELÉSÉLETTAN Debreceni Egyetem Nyugat-magyarországi Egyetem Pannon Egyetem A projekt az Európai Unió támogatásával,


Testtömegünk kb. felét az izomszövet teszi ki.

Testtömegünk kb. felét az izomszövet teszi ki. Izomműködés élettana Dr. Dux Mária Testtömegünk kb. felét az izomszövet teszi ki. Témák: Vázizom (kb. 400 izom) Felépítés Kontrakció -mechanizmus -energetika -mechanika Simaizom - vázizommal összehasonlítva


A vázrendszer, az izomkontrakció alapjai, az izomsejtek típusai és működésük

A vázrendszer, az izomkontrakció alapjai, az izomsejtek típusai és működésük A vázrendszer, az izomkontrakció alapjai, az izomsejtek típusai és működésük Az ember csontváza és izomrendszere belső csontos váz vázizomrendszer a vázizmokat beidegző idegek eredete A csontok típusai


A motorfehérjék hatékonyságának molekuláris háttere

A motorfehérjék hatékonyságának molekuláris háttere A motorfehérjék hatékonyságának molekuláris háttere Szakdolgozat Biológia alapszak, biológus szakirány Készítette: IMRICH VANDA Témavezető: MÁLNÁSI-CSIZMADIA ANDRÁS Egyetemi docens Biokémia Tanszék EÖTVÖS


Vérkeringés. A szív munkája

Vérkeringés. A szív munkája Vérkeringés. A szív munkája 2014.11.04. Keringési Rendszer Szív + erek (artériák, kapillárisok, vénák) alkotta zárt rendszer. Funkció: vér pumpálása vér áramlása az erekben oxigén és tápanyag szállítása


Izomélettan. Vázizom

Izomélettan. Vázizom Izomélettan VÁZIZOM, SIMAIZOM ÉS SZÍVIZOM 2 0 1 6. 0 9. 2 7. Ö S S Z E V O N T S Z E M I N Á R I U M Vázizom Harántcsíkolt Funkcionális egysége az izomrost: sok magvú, hosszú hengeres sejtek Izomrostok


Emberi szövetek. A hámszövet

Emberi szövetek. A hámszövet Emberi szövetek Az állati szervezetekben öt fı szövettípust különböztetünk meg: hámszövet, kötıszövet, támasztószövet, izomszövet, idegszövet. Minden szövetféleség sejtekbıl és a közöttük lévı sejtközötti


Az izomkontrakció szabályozása molekuláris szinten

Az izomkontrakció szabályozása molekuláris szinten Az izomkontrakció szabályozása molekuláris szinten Szakdolgozat Biológia alapszak, Biológus szakirány Készítette: RÁTI SZILVIA MARIANNA Témavezető: NYITRAY LÁSZLÓ, PhD, habil., DSc - Tanszékvezető Biokémia


Az élő sejt fizikai Biológiája: motorfehérjék, egyensúlytól távoli folyamatok

Az élő sejt fizikai Biológiája: motorfehérjék, egyensúlytól távoli folyamatok Tematika Az élő sejt fizikai Biológiája: motorfehérjék, egyensúlytól távoli folyamatok Kellermayer Miklós Motorfehérjék működése. A munkaciklus Egyensúlytól távoli folyamatok. Erővezérelt fehérjegombolyodás.


A miokardium intracelluláris kalcium homeosztázisa: iszkémiás és kardiomiopátiás változások

A miokardium intracelluláris kalcium homeosztázisa: iszkémiás és kardiomiopátiás változások Doktori értekezés A miokardium intracelluláris kalcium homeosztázisa: iszkémiás és kardiomiopátiás változások Dr. Szenczi Orsolya Témavezető: Dr. Ligeti László Klinikai Kísérleti Kutató- és Humán Élettani


Fehérjeszerkezet, és tekeredés

Fehérjeszerkezet, és tekeredés Fehérjeszerkezet, és tekeredés Futó Kinga 2013.10.08. Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983


MULTICELLULÁRIS SZERVEZŐDÉS: SEJT-SEJT (SEJT-MÁTRIX) KÖLCSÖNHATÁSOK 1. Bevezetés (2.)Extracelluláris mátrix (ECM) (Kollagén, hialuron sav,

MULTICELLULÁRIS SZERVEZŐDÉS: SEJT-SEJT (SEJT-MÁTRIX) KÖLCSÖNHATÁSOK 1. Bevezetés (2.)Extracelluláris mátrix (ECM) (Kollagén, hialuron sav, MULTICELLULÁRIS SZERVEZŐDÉS: SEJT-SEJT (SEJT-MÁTRIX) KÖLCSÖNHATÁSOK 1. Bevezetés (2.)Extracelluláris mátrix (ECM) (Kollagén, hialuron sav, proteoglikánok) (3.)Multiadhéziós fehérjék és sejtfelszíni receptorok


Egy idegsejt működése

Egy idegsejt működése 2a. Nyugalmi potenciál Egy idegsejt működése A nyugalmi potenciál (feszültség) egy nem stimulált ingerelhető sejt (neuron, izom, vagy szívizom sejt) membrán potenciálját jelenti. A membránpotenciál a plazmamembrán


GONDOLATOK AZ EXCENTRIKUS IZOMMŰKÖDÉSRŐL a csúszó filamentum elmélet korlátai

GONDOLATOK AZ EXCENTRIKUS IZOMMŰKÖDÉSRŐL a csúszó filamentum elmélet korlátai GONDOLATOK AZ EXCENTRIKUS IZOMMŰKÖDÉSRŐL a csúszó filamentum elmélet korlátai Tanulmány Szegedi Tudományegyetem ÁOK Biokémiai Intézet Csonka Csaba 2015 1 Gondolatok az excentrikus izomműködésről a csúszó



MOTORENZIMEK MŰKÖDÉSÉNEK SOKFÉLESÉGE MOTORENZIMEK MŰKÖDÉSÉNEK SOKFÉLESÉGE MTA doktori értekezés Kovács Mihály Eötvös Loránd Tudományegyetem Természettudományi Kar Biológiai Intézet Biokémiai Tanszék 2010 Tartalomjegyzék 1. Összefoglalás 4


1. Az élő szervezetek felépítése és az életfolyamatok 17

1. Az élő szervezetek felépítése és az életfolyamatok 17 Élődi Pál BIOKÉMIA vomo; Akadémiai Kiadó, Budapest 1980 Tartalom Bevezetés 1. Az élő szervezetek felépítése és az életfolyamatok 17 Mi jellemző az élőre? 17. Biogén elemek 20. Biomolekulák 23. A víz 26.


Az ember izomrendszere, az izomműködés szabályozása

Az ember izomrendszere, az izomműködés szabályozása Az ember izomrendszere, az izomműködés szabályozása Az ember csontváza és izomrendszere belső váz- izületek - varratok Energia szolgáltató folyamatok az izomban AEROB ANAEROB (O 2 elég) (O 2 kevés) szénhidrát


Izom energetika. Szentesi Péter

Izom energetika. Szentesi Péter Izom energetika Szentesi Péter A harántcsíkolt izom struktúrája a kontraktilis fehérjék Izom LC-2 LC1/3 LMM = light meromiosin Izom fasciculus LMM S-2 S-1 HMM rod Miozin molekula S-1 HMM = heavy meromiosin


Sejtváz, aktin mikrofilamentumok, motor fehérjék

Sejtváz, aktin mikrofilamentumok, motor fehérjék Sejtváz, aktin mikrofilamentumok, motor fehérjék Sejtváz Az eukarióta sejtek citoplazmájában található, fehérjefonalakból álló hálózat. (~citoszkeleton) Feladatai: -strukturális vázat alkotva, meghatározza


Makromolekulák. Fehérjetekeredé. rjetekeredés. Biopolimer. Polimerek

Makromolekulák. Fehérjetekeredé. rjetekeredés. Biopolimer. Polimerek Biopolimerek Makromolekulá Makromolekulák. Fehé Fehérjetekeredé rjetekeredés. Osztódó sejt magorsófonala 2011. November 16. Huber Tamá Tamás Dohány levél epidermális sejtjének aktin hálózata Bakteriofágból


Izomszövet eredetű aktin izoformák termodinamikai és spektroszkópiai vizsgálata

Izomszövet eredetű aktin izoformák termodinamikai és spektroszkópiai vizsgálata Izomszövet eredetű aktin izoformák termodinamikai és spektroszkópiai vizsgálata PhD értekezés Készítette: Orbán József Témavezetők: DR. LŐRINCZY DÉNES DR. HILD GÁBOR Doktori Iskola: Doktori Iskola vezető:


SEJTBIOLÓGIA biomérnök hallgatók számára

SEJTBIOLÓGIA biomérnök hallgatók számára SEJTBIOLÓGIA biomérnök hallgatók számára Kilencedik rész: A citoszkeleton Novák Béla docens Proofreading: Sveiczer Ákos ösztöndíjas kutató 1994. december 16. Copyright 1994 BME, Mezõgazdasági Kémiai Technológia


Mi a biomechanika? Mechanika: a testek mozgásával, a testekre ható erőkkel foglalkozó tudományág

Mi a biomechanika? Mechanika: a testek mozgásával, a testekre ható erőkkel foglalkozó tudományág Biomechanika Mi a biomechanika? Mechanika: a testek mozgásával, a testekre ható erőkkel foglalkozó tudományág Biomechanika: a mechanika törvényszerűségeinek alkalmazása élő szervezetekre, elsősorban az


A mozgatórendszer biomechanikája. Az előadás diáinak magyarázó szövege

A mozgatórendszer biomechanikája. Az előadás diáinak magyarázó szövege A mozgatórendszer biomechanikája Az előadás diáinak magyarázó szövege 1. dia: A vázizom biomechanikája 2. dia: A mozgatórendszer aktív és passzív szervei vannak, amelyek egységben működve hozzák létre


A titin PEVK domén aktinkötő és mechanikai tulajdonságai

A titin PEVK domén aktinkötő és mechanikai tulajdonságai PhD értekezés A titin PEVK domén aktinkötő és mechanikai tulajdonságai Nagy Attila Pécsi Tudományegyetem Általános Orvostudományi Kar Biofizikai Intézet Pécs 2006 A program megnevezése: Programvezető:


2007/11/05 Molekuláris biológia előadások - Putnoky 1-1

2007/11/05 Molekuláris biológia előadások - Putnoky 1-1 1-1 Fehérje transzportmechanizmusok az eukariota sejtben: 1) transzmembrán transzport kitekert formában, egyedi fehérjék transzportja célzottan - citoszol ER, citoszol MT 2) póruson keresztüli transzport


Élettan-anatómia. 1. félév

Élettan-anatómia. 1. félév Élettan-anatómia 1. félév Dr. Világi Ildikó docens ELTE TTK Élettani és Neurobiológiai Tanszék tematika, előadások anyaga, fogalomjegyzék, esszé témakörök: http://physiology.elte.hu/elettan_pszicho.html


Tudjunk Egymásról Bugyi Beáta 22/11/2012

Tudjunk Egymásról Bugyi Beáta 22/11/2012 Listeria monocytogenes Loisel, Boujemaa et al. Nature 1999 Összetett aktin hálózatok Spire/formin szinergia Reymann et al. Nature Materials 1 ADF/aktin Bosch, Bugyi B et al. Molecular Cell 7 Reymann et


A dezmin nanomechanikai vizsgálata

A dezmin nanomechanikai vizsgálata A dezmin nanomechanikai vizsgálata Doktori értekezés Dr. Kiss Balázs Semmelweis Egyetem Elméleti Orvostudományok Doktori Iskola Témavezető: Dr. Kellermayer Miklós egyetemi tanár, az orvostudományok doktora



ANATÓMIA FITNESS AKADÉMIA ANATÓMIA FITNESS AKADÉMIA sejt szövet szerv szervrendszer sejtek általános jellemzése: az élet legkisebb alaki és működési egysége minden élőlény sejtes felépítésű minden sejtre jellemző: határoló rendszer


Az élő sejt fizikai Biológiája:

Az élő sejt fizikai Biológiája: Az élő sejt fizikai Biológiája: Modellépítés, biológiai rendszerek skálázódása Kellermayer Miklós Fizikai biológia Ma már nem csak kvalitatív megfigyeléseket, hanem kvantitatív méréseket végzünk (biológiai


Élettan. előadás tárgykód: bf1c1b10 ELTE TTK, fizika BSc félév: 2015/2016., I. időpont: csütörtök, 8:15 9:45

Élettan. előadás tárgykód: bf1c1b10 ELTE TTK, fizika BSc félév: 2015/2016., I. időpont: csütörtök, 8:15 9:45 Élettan előadás tárgykód: bf1c1b10 ELTE TTK, fizika BSc félév: 2015/2016., I. időpont: csütörtök, 8:15 9:45 oktató: Dr. Tóth Attila, adjunktus ELTE TTK Biológiai Intézet, Élettani és Neurobiológiai tanszék


Bio-nanorendszerek. Vonderviszt Ferenc. Pannon Egyetem Nanotechnológia Tanszék

Bio-nanorendszerek. Vonderviszt Ferenc. Pannon Egyetem Nanotechnológia Tanszék Bio-nanorendszerek Vonderviszt Ferenc Pannon Egyetem Nanotechnológia Tanszék Technológia: képesség az anyag szerkezetének, az anyagot felépítő részecskék elrendeződésének befolyásolására. A technológiai


SEJT,SZÖVET,SZERV BIOLÓGIAI ÖSSZEFOGLALÓ KURZUS 6. HÉT. Kun Lídia Semmelweis Egyetem, Genetika, Sejt és Immunbiológiai Intézet

SEJT,SZÖVET,SZERV BIOLÓGIAI ÖSSZEFOGLALÓ KURZUS 6. HÉT. Kun Lídia Semmelweis Egyetem, Genetika, Sejt és Immunbiológiai Intézet SEJT,SZÖVET,SZERV BIOLÓGIAI ÖSSZEFOGLALÓ KURZUS 6. HÉT Kun Lídia Semmelweis Egyetem, Genetika, Sejt és Immunbiológiai Intézet Egy eukarióta sejt általában Kompartmentalizáció = különböző sejtfolyamatok


Elektronmikroszkópos képek gyűjteménye az ÁOK-s hallgatók részére

Elektronmikroszkópos képek gyűjteménye az ÁOK-s hallgatók részére Prof. Dr. Röhlich Pál Dr. L. Kiss Anna Dr. H.-inkó Krisztina Elektronmikroszkópos képek gyűjteménye az ÁOK-s hallgatók részére Semmelweis Egyetem, Humánmorfológiai és Fejlődésbiológiai Intézet ny n N L


Mozgás, mozgásszabályozás

Mozgás, mozgásszabályozás Mozgás, mozgásszabályozás Az idegrendszer szerveződése receptor érző idegsejt inger átkapcsoló sejt végrehajtó sejt központi idegrendszer reflex ív, feltétlen reflex Az ember csontváza és izomrendszere


Tropomiozin és nehéz meromiozin hatása a formin által nukleált aktin filamentumok flexibilitására

Tropomiozin és nehéz meromiozin hatása a formin által nukleált aktin filamentumok flexibilitására Tropomiozin és nehéz meromiozin hatása a formin által nukleált aktin filamentumok flexibilitására Ujfalusi Zoltán Témavezető: PROF. DR. N YITRAI MIKLÓS Doktori iskola: I n t e r d i s z c i p l i n á r


Polimerlánc egyensúlyi alakja. Féregszerű polimermodell (Wormlike chain) WLC (wormlike chain): Entropikus rugalmasság vizualizálása

Polimerlánc egyensúlyi alakja. Féregszerű polimermodell (Wormlike chain) WLC (wormlike chain): Entropikus rugalmasság vizualizálása Polimerlánc egyensúlyi alakja Az a makroállapot, amely a legtöbb mikroállapottal valósítható meg (legvalószínűbb állapot) DNS molekulák fluoreszcencia mikroszkóp alatt Féregszerű polimermodell (Wormlike


Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Azonosító szám: TÁMOP-4.1.2-08/1/A-2009-0011 Az orvosi


Fehérjeszerkezet, és tekeredés. Futó Kinga

Fehérjeszerkezet, és tekeredés. Futó Kinga Fehérjeszerkezet, és tekeredés Futó Kinga Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983 H 211861 N


A felépítő és lebontó folyamatok. Biológiai alapismeretek

A felépítő és lebontó folyamatok. Biológiai alapismeretek A felépítő és lebontó folyamatok Biológiai alapismeretek Anyagforgalom: Lebontó Felépítő Lebontó folyamatok csoportosítása: Biológiai oxidáció Erjedés Lebontó folyamatok összehasonlítása Szénhidrátok


Bodosi Balázs. Az emberi test 40-45%-a izom.

Bodosi Balázs. Az emberi test 40-45%-a izom. Bodosi Balázs AZ EMBERI TEST VÁZIZOMZATA Az emberi test 40-45%-a izom. 1 A FELKAR ÉS A VÁLLÖV HÁTULNÉZETBEN scapulacsúcs deltoideus Caput longus Caput lateralis Caput medialis brachioradialis Extensor


Definíciók Az izomszövet átlagos összetétele

Definíciók Az izomszövet átlagos összetétele 11.2. A HÚS 1 Definíciók Élelmiszer-hatósági szempontból: melegvérű állatok emberi fogyasztásra alkalmas része friss vagy tartósított formában. Általánosságban: több-kevesebb zsírszövetet is tartalmazó



AZ EMBERI TEST FELÉPÍTÉSE AZ EMBERI TEST FELÉPÍTÉSE Szalai Annamária ESZSZK GYITO Általános megfontolások anatómia-élettan: az egészséges emberi szervezet felépítésével és működésével foglalkozik emberi test fő jellemzői: kétoldali



7. A SEJT A SEJT 1. ÁLTALÁNOS TUDNIVALÓK A SEJT 1. ÁLTALÁNOS TUDNIVALÓK DIA 1 DIA 2 DIA 3 DIA 4 A sejtbiológia a biológiának az a tudományterülete, amely a sejt szerkezeti felépítésével, a különféle sejtfolyamatokkal (sejtlégzés, anyagtranszport,


Intracelluláris ion homeosztázis I.-II. Február 15, 2011

Intracelluláris ion homeosztázis I.-II. Február 15, 2011 Intracelluláris ion homeosztázis I.II. Február 15, 2011 Ca 2 csatorna 1 Ca 2 1 Ca 2 EC ~2 mm PLAZMA Na /Ca 2 cserélő Ca 2 ATPáz MEMBRÁN Ca 2 3 Na ATP ADP 2 H IC ~100 nm citoszol kötött Ca 2 CR CSQ SERCA


Biopolimer 12/7/09. Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. DNS. Polimerek. Kardos Roland DNS elsődleges szerkezete

Biopolimer 12/7/09. Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. DNS. Polimerek. Kardos Roland DNS elsődleges szerkezete Biopolimerek Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. Osztódó sejt magorsófonala Kardos Roland 2009.10.29. Dohány levél epidermális sejtjének aktin hálózat Bakteriofágból kiszabaduló


A glükóz reszintézise.

A glükóz reszintézise. A glükóz reszintézise. A glükóz reszintézise. A reszintézis nem egyszerű megfordítása a glikolízisnek. A glikolízis 3 irrevezibilis lépése más úton játszódik le. Ennek oka egyrészt energetikai, másrészt


A sejtes szervezıdés elemei (sejtalkotók / sejtorganellumok)

A sejtes szervezıdés elemei (sejtalkotók / sejtorganellumok) A sejtes szervezıdés elemei (sejtalkotók / sejtorganellumok) 1 Sejtorganellumok vizsgálata: fénymikroszkóp elektronmikroszkóp pl. scanning EMS A szupramolekuláris struktúrák további szervezıdése sejtorganellumok


Fehérje szintézis 2. TRANSZLÁCIÓ Molekuláris biológia kurzus 7. hét. Kun Lídia Genetikai, Sejt- és immunbiológiai Intézet

Fehérje szintézis 2. TRANSZLÁCIÓ Molekuláris biológia kurzus 7. hét. Kun Lídia Genetikai, Sejt- és immunbiológiai Intézet Fehérje szintézis 2. TRANSZLÁCIÓ Molekuláris biológia kurzus 7. hét Kun Lídia Genetikai, Sejt- és immunbiológiai Intézet Gén mrns Fehérje Transzkripció Transzláció A transzkriptum : mrns Hogyan mutatható



PÉCSI TUDOMÁNYEGYETEM PÉCSI TUDOMÁNYEGYETEM Kémia Doktori Iskola Fehérje szerkezet és működés c. program Glicerinezett izomrostok vizsgálata ATP hidrolízis köztes állapotaiban EPR és DSC technikával PhD értekezés Degez Tímea


1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói

1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói 1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói Plazmamembrán Membrán funkciói: sejt integritásának fenntartása állandó hő, energia, és információcsere biztosítása homeosztázis


Energia források a vázizomban

Energia források a vázizomban Energia források a vázizomban útvonal sebesség mennyiség ATP/glükóz 1. direkt foszforiláció igen gyors igen limitált - 2. glikolízis gyors limitált 2-3 3. oxidatív foszforiláció lassú nem limitált 36 Izomtípusok


Az élő szervezetek felépítése I. Biogén elemek biomolekulák alkotóelemei a természetben előforduló elemek közül 22 fordul elő az élővilágban O; N; C; H; P; és S; - élő anyag 99%-a Biogén elemek sajátosságai:



1. SEJT-, ÉS SZÖVETTAN. I. A sejt 1. SEJT-, ÉS SZÖVETTAN SZAKMAI INFORMÁCIÓTARTALOM I. A sejt A sejt cellula az élő szervezet alapvető szerkezeti és működési egysége, amely képes az önálló anyag cserefolyamatokra és a szaporodásra. Alapvetően


A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin.

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin. Myoglobin Fehérje-szerkezetek! MGLSDGEWQLVLNVWGKVEADIPGGQEVLIRLFK GPETLEKFDKFKLKSEDEMKASE DLKKGATVLTALGGILKKKGEAEIKPLAQSA TKKIPVKYLEFISECIIQVLQSK PGDFGADAQGAMNKALELFRKDMASNYKELGFQG Fuxreiter Mónika! Debreceni


Nanotechnológia. Vonderviszt Ferenc. Veszprémi Egyetem Nanotechnológia Tanszék

Nanotechnológia. Vonderviszt Ferenc. Veszprémi Egyetem Nanotechnológia Tanszék Nanotechnológia Vonderviszt Ferenc Veszprémi Egyetem Nanotechnológia Tanszék Ősi technológiák Mikroelektronika Technológia: képesség az anyag szerkezetének, az anyagot felépítő részecskék elrendeződésének



HUMÁN ÉLETTAN I. ELİADÁSOK TEMATIKÁJA GYÓGYSZERÉSZ HALLGATÓKNAK HUMÁN ÉLETTAN I. ELİADÁSOK TEMATIKÁJA GYÓGYSZERÉSZ HALLGATÓKNAK 2006/2007 A tananyag elsajátításához Fonyó: Élettan gyógyszerész hallgatók részére (Medicina, Budapest, 1998) címő könyvet ajánljuk. Az Élettani


Energiatermelés a sejtekben, katabolizmus. Az energiaközvetítő molekula: ATP

Energiatermelés a sejtekben, katabolizmus. Az energiaközvetítő molekula: ATP Energiatermelés a sejtekben, katabolizmus Az energiaközvetítő molekula: ATP Elektrontranszfer, a fontosabb elektronszállító molekulák NAD: nikotinamid adenin-dinukleotid FAD: flavin adenin-dinukleotid


Szénhidrátok monoszacharidok formájában szívódnak fel a vékonybélből.

Szénhidrátok monoszacharidok formájában szívódnak fel a vékonybélből. Vércukorszint szabályozása: Szénhidrátok monoszacharidok formájában szívódnak fel a vékonybélből. Szövetekben monoszacharid átalakítás enzimjei: Szénhidrát anyagcserében máj központi szerepű. Szénhidrát


A kemotaxis biológiai és klinikai

A kemotaxis biológiai és klinikai A kemotaxis biológiai és klinikai jelentősége - Válogatott fejezetek A kemotaxis biológiai és klinikai jelentősége - Válogatott fejezetek - Írta: Kőhidai László Szakmailag ellenőrizte: Csaba György Láng


Vadmadarak és emlősök anatómiája és élettana. Mozgás szervrendszer Fogak

Vadmadarak és emlősök anatómiája és élettana. Mozgás szervrendszer Fogak Vadmadarak és emlősök anatómiája és élettana Mozgás szervrendszer Fogak Mozgás szervrendszer A helyváltoztatás az állatok jellemző képessége. A mozgásmód faji sajátosság eltérés rendellenesség Izmok aktív



AZ ÉLET KÉMIÁJA... ÉLŐ ANYAG SZERVEZETI ALAPEGYSÉGE AZ ÉLET KÉMIÁJA... ÉLŐ ANYAG SZERVEZETI ALAPEGYSÉGE A biológia az élet tanulmányozásával foglalkozik, az élő szervezetekre viszont vonatkoznak a fizika és kémia törvényei MI ÉPÍTI FEL AZ ÉLŐ ANYAGOT? HOGYAN


A tananyag felépítése: A BIOLÓGIA ALAPJAI. I. Prokarióták és eukarióták. Az eukarióta sejt. Pécs Miklós: A biológia alapjai

A tananyag felépítése: A BIOLÓGIA ALAPJAI. I. Prokarióták és eukarióták. Az eukarióta sejt. Pécs Miklós: A biológia alapjai A BIOLÓGIA ALAPJAI A tananyag felépítése: Környezetmérnök és műszaki menedzser hallgatók számára Előadó: 2 + 0 + 0 óra, félévközi számonkérés 3 ZH: október 3, november 5, december 5 dr. Pécs Miklós egyetemi


Biokémiai kutatások ma

Biokémiai kutatások ma Nyitray László Biokémiai Tanszék Hb Biokémiai kutatások ma Makromolekulák szerkezet-funkció kutatása Molekuláris biológia minden szinten Redukcionista molekuláris biológia vs. holisztikus rendszerbiológia



A VÁZIZOM MŰKÖDÉSÉNEK NEUROMECHANIKAI ALAPJAI Sporttudományi képzés fejlesztése a Dunántúlon TÁMOP-4.1.2.E-13/1/KONV-2013-0012 Pécsi Tudományegyetem Természettudományi Kar Sporttudományi és Testnevelési Intézet A VÁZIZOM MŰKÖDÉSÉNEK NEUROMECHANIKAI
