MULTICELLULÁRIS SZERVEZŐDÉS: SEJT-SEJT (SEJT-MÁTRIX) KÖLCSÖNHATÁSOK 1. Bevezetés (2.)Extracelluláris mátrix (ECM) (Kollagén, hialuron sav,

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "MULTICELLULÁRIS SZERVEZŐDÉS: SEJT-SEJT (SEJT-MÁTRIX) KÖLCSÖNHATÁSOK 1. Bevezetés (2.)Extracelluláris mátrix (ECM) (Kollagén, hialuron sav,"


1 MULTICELLULÁRIS SZERVEZŐDÉS: SEJT-SEJT (SEJT-MÁTRIX) KÖLCSÖNHATÁSOK 1. Bevezetés (2.)Extracelluláris mátrix (ECM) (Kollagén, hialuron sav, proteoglikánok) (3.)Multiadhéziós fehérjék és sejtfelszíni receptorok - Laminin, nidogén - Fibronektinek Sejtfelszíni receptorok: - Integrinek (sejt mátrix, sejt sejt) 4. Sejt-sejt adhéziós molekulák - Kadherinek Ca 2+ mellett, (pl. E-, N-, P-kadherinek - Ig szupercsalád Ca 2+ nélkül (pl. N-CAM) - Szelektinek, Ca 2+ mellett 5. Sejt junkciók (specializált kapcsolatok) - okklúziós junkciók szoros junciók - kihorgonyzós junkciók adherens junkciók - funkcionális junkciók gap (rés) junkciók

2 Szabó Gábor: Sejtbiológia (Medicina, 2009) 9.2 Multicelluláris szerveződés:...(oldalak: )

3 Sejt-sejt adhéziós fehérje 1. Bevezetés Citoszkeletális fehérjék Intracelluláris kapcsoló fehérje Sejtfelszíni receptor Plazmamembrán Sejtfelszíni proteoglikán mag fehérje Multiadhézós fehérje Glükózaminoglikánok Mátrix proteoglikán mag fehérje Kollagén rost

4 (3.) Multiadhéziós fehérjék és sejtfelszíni receptorok (a) (b) 25 nm L1 B1 lánc L2 L3 helikálisan tekeredett hurok Laminin Nidogén N1 A lánc Diszulfid kötések L5 L6 hélix L4 B2 lánc N2 LAMININ Három polipeptid (MW: 820,000) L1 = integrin vagy nidogén kötőhelye L2, L4 = szulfonált lipid kötőhelye L3 = IV. típusú kollagén kötőhelye L5 = idegsejtek sejtfelszíni receptorainak kötőhelye L6 = proteoglikán kötőhelye NIDOGÉN (MW: 158,000) N1 = kollagén vagy proteoglikán kötőhelye N2 = laminin kötőhelye

5 (3.) Multiadhéziós fehérjék és sejtfelszíni receptorok Fibronektin filamentumok Fibroblasztok

6 (3.) Multiadhéziós fehérjék és sejtfelszíni receptorok FIBRONEKTIN Dimerek Sejteket rögzítik az ECM-hez RGD-t prezentál Normál sejtek választják ki Rákos sejtek nem választják ki Elősegíti a sejtek vándorlását

7 (3.) Multiadhéziós fehérjék és sejtfelszíni receptorok FIBRONEKTIN III típusú ismétlődő szakasz (kb. 100 aminosav) RGD bemutatás Arginin, glicin, aszparagin sav

8 (3.) Multiadhéziós fehérjék és sejtfelszíni receptorok

9 (3.) Multiadhéziós fehérjék és sejtfelszíni receptorok Ligand kötő régió 8 nm Cisztein gazdag ismétlődő szakaszok nm nm Plazmamembrán INTEGRINEK αβ heterodimerek, az emlősöknél 19 α és 8 β van, 152 kombinációból kb. 24 fajta van. Ca 2+ mellett kötődik β 1 ECM-hez kötődéshez β 2 sejt-sejt kölcsönhatás (fehérvérsejtek) RGD preferencia (arginin, glicin, asp. sav) Kd= M, viszonylag gyenge, néha aktiválni kell (vérlemezke α IIb β 3 )

10 (3.) Multiadhéziós fehérjék és sejtfelszíni receptorok

11 (3.) Multiadhéziós fehérjék és sejtfelszíni receptorok

12 (3.) Multiadhéziós fehérjék és sejtfelszíni receptorok Sejten kivüli tér Fibronektin szálak Plazmamembrán Aktint tartalmazó 7 nm-es mikrofilamentumok 0.5 m

13 (3.) Multiadhéziós fehérjék és sejtfelszíni receptorok Piros: aktin filamentek, zöld: integrin molekulák

14 4. Sejt-sejt adhéziós molekulák Homofil adhézió (1940, máj és vese sejtek disszociációja és összekeverése) Kötődések típusai HOMOFIL KÖTŐDÉS HETEROFIL KÖTŐDÉS KÖTŐDÉS EXTRACELLULÁRIS MOLEKULA SEGÍTSÉGÉVEL

15 Adhéziós domén Ig-szerü domének Lektin domén 4. Sejt-sejt adhéziós molekulák Külső tér III típusú fibronektin Plazmamebrán Citoszól Szelektinek Kadherinek Ig szupercsalád

16 Kadherinek 4. Sejt-sejt adhéziós molekulák Homofil kötődés Típusai: E-kadherinek (ovomorulin), epitél sejtek N-kadherinek, idegrendszer, lencse stb. P-kadherinek, szív, bélrendszer stb. Ca 2+ mellett kötődik L sejtek transzfekciója Az utolsó 100 aminosav szükséges a kötődéshez (kiméra, mutagenézis) Embriogenezis (E- helyett N- kadherinek)

17 4. Sejt-sejt adhéziós molekulák Kadherinek Kadherinek

18 4. Sejt-sejt adhéziós molekulák

19 4. Sejt-sejt adhéziós molekulák Ig szupercsalád N-CAM nerve cell adhesion molecule Három forma - alternative splicing Ca 2+ nem szükséges a kötődéshez Sziálsav (negatív töltésű cukorszármazék - embriogenezis 30% sziálsav gyenge kölcsönhatás - differenciálódás 10% sziálsav erősebb kölcsönhatás

20 Alternative splicing 4. Sejt-sejt adhéziós molekulák

21 4. Sejt-sejt adhéziós molekulák

22 4. Sejt-sejt adhéziós molekulák SZELEKTINEK Ca 2+ szükséges a kötődéshez Cukrot kötőhelye van P-szelektin, Extravazáció (PAF, α L β 2 ICAM-1) (PAF: platelet acivating factor ICAM-1: intracellular adhesion molecule-1) Leukocita adhéziós deficiencia (β 2 )

23 4. Sejt-sejt adhéziós molekulák

24 EXTRAVAZÁCIÓ 4. Sejt-sejt adhéziós molekulák

25 EXTRAVAZÁCIÓ 4. Sejt-sejt adhéziós molekulák

26 5. Sejt junkciók Sejt junkciók (specializált kapcsolatok) - okklúziós junkciók szoros junkciók - kihorgonyzós junkciók adherens junkciók - funkcionális junkciók gap (rés) junkciók

27 5. Sejt junkciók Mikrovillus Apikális felszín zoros junkciók Adherens junkció Pont dezmoszóma Laterális felszín Gap junkciók ntermediális ilamentumok Hemidezmoszóma Bazális felszín Bazális lamina

28 Szoros junkció 5. Sejt junkciók

29 5. Sejt junkciók Mikrovillusok Szoros junkció - okklúziós junkció Szomszédos sejteket összekapcsoló fehérje Szoros junkció Intercelluláris tér Fehérje sor Impermeábilis vízben oldódó molekulák számára Megakadályozza a membrán komponensek diffúzióját az apikális és bazolaterális membrán között Két sor fehérje részecske

30 5. Sejt junkciók Szoros junkció - okklúziós junkció

31 Adherens junkciók (kihorgonyzó junkciók) 5. Sejt junkciók Junkció Transzmemb. Extracelluláris Intracelluláris Intracelluláris kötő fehérje ligand citoszkeleton adapter fehérje Adhéziós öv kadherin szomszédos sejt aktin filamen- kateninek (Sejt sejt) kadherinje tumok plakoglobin Dezmoszóma kadherin szomszédos sejt intermediális dezmoplakinok (Sejt sejt) kadherinje filamentumok plakoglobin Adhéziós plakk integrin extracelluláris aktin filamen- talin, vinkulin (Sejt mátrix) α 6 β 4 mátrix fehérje tumok Hemidezmo- integrin extracelluláris intermediális dezmoplakin szóma α 6 β 4 mátrix fehérje filamentumok szerű fehérje (Sejt mátrix)

32 5. Sejt junkciók Adhéziós öv zonula adherens

33 5. Sejt junkciók

34 Plazmamembrán Sejt-sejt közötti tér Citoplazmatikus lemez (plakoglobin) 5. Sejt junkciók Dezmoszóma Dezmoglein és dezmokollin (transzmembrán kötő fehérjék) Keratin intermediális filamentumok

35 Epitél sejt Integrin Plazmamembrán Intermediális filamentumok Lemezek 5. Sejt junkciók Hemidezmoszóma Bazális lamina Kollagén Horgonyzó laminin szálak

36 Fokális kontaktus, adhéziós plakk 5. Sejt junkciók T: talin, V: vinkulin, Ten: tenzin, Pa: paxilin, α-ac1: α-aktinin

37 Fokális kontaktus, adhéziós plakk 5. Sejt junkciók

38 Fokális kontaktus, adhéziós plakk 5. Sejt junkciók

39 5. Sejt junkciók Gap (rés) junkciók - funkcionális junkciók 2 nm rés (gap) 1.5 nm átmérőjű 1200 Da molekulasúly alatt átjárható 2000 Da molekulasúly felett nem átjárható Kapcsoló ágensek: ATP, camp, Ca 2+ Elektromos kapcsolódás 6 konnexin alegység, 12 alegység együtt egy csatorna 3. hélix béleli a csatornát Magas Ca 2+, magas ph blokkolja a csatornát Kísérlet lucifer yellow festékkel

40 Gap junkció 5. Sejt junkciók

41 A) Hat konnexin alegységből alló henger (B) + NH 3 Sejtek közötti rés Citoszól 5. Sejt junkciók Gap junkció Membrán Transzmembrán hélixek COO - Sejtek közötti 2 nm-es rés Citoszól Citoszól

42 Az intercelluláris gap junkciók szabályozása és lehetséges céltáblái ICRAC Recepor-expresszió Receptor-asszociáció IP 3?? Ca 2+?? ph enzimek <1 kda: Ca, IP3, GF,. Szabályozás: PKG PKC PKA Ca 2+

43 GAP JUNKCIÓS KOMMUNIKÁCIÓ A172 GLIOBLASZTÓMA SEJTEKBEN Karcolásos jelölés: Közeg: HEPES puffer, 1 mm Ca, 10 mm EGTA Jelölő anyag: 1 mg/ml Lucifer Yellow

44 AZ INTERCELLULÁRIS GAP JUNKCIÓ SZÉTKAPCSOLÁSA Szétkapcsoló vegyületek: * Hosszú szénláncú alifás alkoholok pl.: oktanol * magas intracelluláris Ca 2+ szint * halotán (altatószer), stb.


46 MULTICELLULÁRIS SZERVEZŐDÉS: SEJT-SEJT (SEJT-MÁTRIX) KÖLCSÖNHATÁSOK 1. Bevezetés (2.)Extracelluláris mátrix (ECM) (Kollagén, hialuron sav, proteoglikánok) (3.)Multiadhéziós fehérjék és sejtfelszíni receptorok - Laminin, nidogén - Fibronektinek Sejtfelszíni receptorok: - Integrinek (sejt mátrix, sejt sejt) 4. Sejt-sejt adhéziós molekulák - Kadherinek Ca 2+ mellett, (pl. E-, N-, P-kadherinek - Ig szupercsalád Ca 2+ nélkül (pl. N-CAM) - Szelektinek, Ca 2+ mellett 5. Sejt junkciók (specializált kapcsolatok) - okklúziós junkciók szoros junciók - kihorgonyzós junkciók adherens junkciók - funkcionális junkciók gap (rés) junkciók




Sejtadhézió. Sejtkapcsoló struktúrák

Sejtadhézió. Sejtkapcsoló struktúrák Sejtadhézió Sejtkapcsoló struktúrák Sejtadhézió jelentősége: Sejtlemezek kialakulása Sejtadhézió jelentősége: Többrétegű sejtsorok kialakulása Limfociták kilépése az endotélen Rolling Adhézió Belépés homing


Sejtmozgás és adhézió Molekuláris biológia kurzus 8. hét. Kun Lídia Genetikai, Sejt és Immunbiológiai Intézet

Sejtmozgás és adhézió Molekuláris biológia kurzus 8. hét. Kun Lídia Genetikai, Sejt és Immunbiológiai Intézet Sejtmozgás és adhézió Molekuláris biológia kurzus 8. hét Kun Lídia Genetikai, Sejt és Immunbiológiai Intézet Sejtmozgás -amőboid - csillós - kontrakció Sejt adhézió -sejt-ecm -sejt-sejt MOZGÁS A sejtmozgás


A sejtek közötti közvetett (indirekt) kapcsolatok

A sejtek közötti közvetett (indirekt) kapcsolatok A sejtek közötti közvetett (indirekt) kapcsolatok kémiai anyag közvetítése a jeladó - jel - csatorna - jelfogó rendszerben szöveti hormon hormon szövet közötti tér véráram neurotranszmisszió neurotranszmitter


A sejtek közötti közvetett (indirekt) kapcsolatok

A sejtek közötti közvetett (indirekt) kapcsolatok A sejtek közötti közvetett (indirekt) kapcsolatok kémiai anyag közvetítése a jeladó - jel - csatorna - jelfogó rendszerben szöveti hormon hormon szövet közötti tér véráram neurotranszmisszió neurotranszmitter


A sejtváz. Mikrotubulusok (25 nm átmérő) Mikrofilamentumok (7 nm átmérő) Intermedier filamentumok (8-12 nm átmérő)

A sejtváz. Mikrotubulusok (25 nm átmérő) Mikrofilamentumok (7 nm átmérő) Intermedier filamentumok (8-12 nm átmérő) A sejtváz A citoszkeleton, vagy sejtváz kötegek hálózatából felépülő struktúra, mely a sejt szilárdításán, alakjának biztosításán túl, a mozgásban, a szállításban is szerepet játszik. Három molekuláris


METASZTÁZISKÉPZÉS. Láng Orsolya. Kemotaxis speciálkollégium 2005.

METASZTÁZISKÉPZÉS. Láng Orsolya. Kemotaxis speciálkollégium 2005. METASZTÁZISKÉPZÉS Láng Orsolya Kemotaxis speciálkollégium 2005. TUMOROK ÉS MIGRÁCIÓ PRIMER TUMOR METASZTÁZIS Angiogenezis Adhézió SEJT - SEJTCIKLUS Apoptózis Kemokinek Növekedési faktorok Szabályozó fehérjék



A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA 2013.10.09. CITOSZKELETON - DEFINÍCIÓ Fehérjékből felépülő, a sejt vázát alkotó intracelluláris rendszer. Eukarióta és prokarióta sejtekben egyaránt megtalálható.


Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Azonosító szám: TÁMOP-4.1.2-08/1/A-2009-0011 Az orvosi


Epitheliális transzport

Epitheliális transzport Biológus Bsc. Sejtélettan II. Epitheliális transzport Tóth István Balázs DE OEC Élettani Intézet 2010. 11. 05. Transzport szempontjából szimmetrikus és aszimmetrikus sejtek Szimmetrikus sejtek: - nincs


A Földön előforduló sejtek (pro- és eukarioták) közös és eltérő tulajdonságai. A sejtes szerveződés evolúciója.

A Földön előforduló sejtek (pro- és eukarioták) közös és eltérő tulajdonságai. A sejtes szerveződés evolúciója. A tárgy neve: Sejtbiológia előadás 1. Jellege: Törzs Gazda tanszék: Állattani és Sejtbiológiai Tanszék Felelős oktató: Dr. Gulya Károly Kredit: 2 Heti óraszám: 2 Típus: előadás Számonkérés: K A Földön


A sejtek közötti közvetett (indirekt) kapcsolatok

A sejtek közötti közvetett (indirekt) kapcsolatok A sejtek közötti közvetett (indirekt) kapcsolatok kémiai anyag közvetítése a jeladó - jel - csatorna - jelfogó rendszerben szöveti hormon hormon szövet közötti tér véráram neurotranszmisszió neurotranszmitter



S E J T A D H É Z I Ó S E J T A D H É Z I Ó A többsejtű szervezetekben a sejtek adott funkcióra specializált szöveteket alkotnak. Ehhez a magas szintű szerveződéshez elengedhetetlen a sejtek egymáshoz és az extracelluláris


Immunológia alapjai előadás. Sej-sejt kommunikációk az immunválaszban.

Immunológia alapjai előadás. Sej-sejt kommunikációk az immunválaszban. Immunológia alapjai 7-8. előadás Sej-sejt kommunikációk az immunválaszban. Koreceptorok és adhéziós molekulák. Cytokinek, chemokinek és receptoraik. A sejt-sejt kapcsolatok mediátorai: cross-talk - Szolubilis


Az ioncsatorna fehérjék szerkezete, működése és szabályozása. A patch-clamp technika

Az ioncsatorna fehérjék szerkezete, működése és szabályozása. A patch-clamp technika Az ioncsatorna fehérjék szerkezete, működése és szabályozása. A patch-clamp technika Panyi György 2014. November 12. Mesterséges membránok ionok számára átjárhatatlanok Iontranszport a membránon keresztül:


Az extracelluláris mátrix komponensek tumorinvázióban betöltött szerepe intrakraniális daganatokban

Az extracelluláris mátrix komponensek tumorinvázióban betöltött szerepe intrakraniális daganatokban 222 Összefoglaló közlemény Az extracelluláris mátrix komponensek tumorinvázióban betöltött szerepe intrakraniális daganatokban Klekner Álmos 1, Virga József 1, Tóth Judit 2, Hortobágyi Tibor 3, Dér Ádám


Izomműködés. Az izommozgás. az állati élet legszembetűnőbb külső jele a mozgás amőboid, ostoros ill. csillós és izomösszehúzódással

Izomműködés. Az izommozgás. az állati élet legszembetűnőbb külső jele a mozgás amőboid, ostoros ill. csillós és izomösszehúzódással Izomműködés Az izommozgás az állati élet legszembetűnőbb külső jele a mozgás amőboid, ostoros ill. csillós és izomösszehúzódással történő mozgás van Galenus id. II.szd. - az idegekből animal spirit folyik


A sejtek közöti kommunikáció formái. BsC II. Sejtélettani alapok Dr. Fodor János

A sejtek közöti kommunikáció formái. BsC II. Sejtélettani alapok Dr. Fodor János A sejtek közöti kommunikáció formái BsC II. Sejtélettani alapok Dr. Fodor János 2010. 03.19. I. Kommunikáció, avagy a sejtek informálják egymást Kémiai jelátvitel formái Az üzenetek kémiai úton történő


Natív antigének felismerése. B sejt receptorok, immunglobulinok

Natív antigének felismerése. B sejt receptorok, immunglobulinok Natív antigének felismerése B sejt receptorok, immunglobulinok B és T sejt receptorok A B és T sejt receptorok is az immunglobulin fehérje család tagjai A TCR nem ismeri fel az antigéneket, kizárólag az


A biológiai mozgás molekuláris mechanizmusai

A biológiai mozgás molekuláris mechanizmusai BIOLÓGIAI MOZGÁSOK A biológiai mozgás molekuláris mechanizmusai Kollektív mozgás Szervezet mozgása ( Az évszázad ugrása ) Szerv mozgás BIOLÓGIAI MOZGÁSOK BIOLÓGIAI MOZGÁSOK Ritmusosan összehúzódó szívizomsejt


A sejtfelszíni receptorok három fő kategóriája

A sejtfelszíni receptorok három fő kategóriája A sejtfelszíni receptorok három fő kategóriája 1. Saját enzimaktivitás nélküli receptorok 1a. G proteinhez kapcsolt pl. adrenalin, szerotonin, glukagon, bradikinin receptorok 1b. Tirozin kinázhoz kapcsolt


Elektronmikroszkópos képek gyűjteménye az ÁOK-s hallgatók részére

Elektronmikroszkópos képek gyűjteménye az ÁOK-s hallgatók részére Prof. Dr. Röhlich Pál Dr. L. Kiss Anna Dr. H.-inkó Krisztina Elektronmikroszkópos képek gyűjteménye az ÁOK-s hallgatók részére Semmelweis Egyetem, Humánmorfológiai és Fejlődésbiológiai Intézet ny n N L


A sejtek közötti kommunikáció módjai és mechanizmusa. kommunikáció a szomszédos vagy a távoli sejtek között intracellulári jelátviteli folyamatok

A sejtek közötti kommunikáció módjai és mechanizmusa. kommunikáció a szomszédos vagy a távoli sejtek között intracellulári jelátviteli folyamatok A sejtek közötti kommunikáció módjai és mechanizmusa kommunikáció a szomszédos vagy a távoli sejtek között intracellulári jelátviteli folyamatok A kommunikáció módjai szomszédos sejtek esetén autokrin


Biofizika I 2013-2014 2014.12.02.



Élettan. előadás tárgykód: bf1c1b10 ELTE TTK, fizika BSc félév: 2015/2016., I. időpont: csütörtök, 8:15 9:45

Élettan. előadás tárgykód: bf1c1b10 ELTE TTK, fizika BSc félév: 2015/2016., I. időpont: csütörtök, 8:15 9:45 Élettan előadás tárgykód: bf1c1b10 ELTE TTK, fizika BSc félév: 2015/2016., I. időpont: csütörtök, 8:15 9:45 oktató: Dr. Tóth Attila, adjunktus ELTE TTK Biológiai Intézet, Élettani és Neurobiológiai tanszék


Citoszkeleton Sejtmozgás

Citoszkeleton Sejtmozgás Citoszkeleton Sejtmozgás Citoszkeleton funkciói Sejtalak meghatározása Organellumok kihorgonyzása Organellumok mozgatása Húzószilárdság Kromoszóma mozgatás Sejtpolaritás Motilitás Citoszkeleton Mikrofilamentumok


S-2. Jelátviteli mechanizmusok

S-2. Jelátviteli mechanizmusok S-2. Jelátviteli mechanizmusok A sejtmembrán elválaszt és összeköt. Ez az információ-áramlásra különösen igaz! 2.1. A szignál-transzdukció elemi lépései Hírvivô (transzmitter, hormon felismerése = kötôdés


Immunológiai módszerek a klinikai kutatásban

Immunológiai módszerek a klinikai kutatásban Immunológiai módszerek a klinikai kutatásban 3. előadás Az immunrendszer molekuláris elemei: antigén, ellenanyag, Ig osztályok Az antigén meghatározása Detre László: antitest generátor - Régi meghatározás:


Immunológia alapjai előadás MHC. szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás.

Immunológia alapjai előadás MHC. szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás. Immunológia alapjai 5-6. előadás MHC szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás. Antigén felismerés Az ellenanyagok és a B sejt receptorok natív formában


A citoszkeletális rendszer

A citoszkeletális rendszer A citoszkeletális rendszer Az eukarióta sejtek dinamikus fehérje-vázrendszere, amely specifikus fehérjepolimer filamentumokból épül fel. Mikrofilamentumok Mikrotubulusok Intermedier filamentumok Aktin


Receptorok és szignalizációs mechanizmusok

Receptorok és szignalizációs mechanizmusok Molekuláris sejtbiológia: Receptorok és szignalizációs mechanizmusok Dr. habil Kőhidai László Semmelweis Egyetem Genetikai, Sejt- és Immunbiológiai Intézet Sejtek szignalizációs kapcsolatai Sejtek szignalizációs


Sejt - kölcsönhatások az idegrendszerben

Sejt - kölcsönhatások az idegrendszerben Sejt - kölcsönhatások az idegrendszerben dendrit Sejttest Axon sejtmag Axon domb Schwann sejt Ranvier mielinhüvely csomó (befűződés) terminális Sejt - kölcsönhatások az idegrendszerben Szinapszis típusok





Citoszkeleton. Sejtek rugalmassága. Polimer mechanika: Hooke-rugalmasság. A citoszkeleton filamentumai. Fogászati anyagtan fizikai alapjai 12.

Citoszkeleton. Sejtek rugalmassága. Polimer mechanika: Hooke-rugalmasság. A citoszkeleton filamentumai. Fogászati anyagtan fizikai alapjai 12. Fogászati anyagtan fizikai alapjai 12. Sejtek rugalmassága Citoszkeleton Eukariota sejtek dinamikus vázrendszere Három fő filamentum-osztály: A. Vékony (aktin) B. Intermedier C. Mikrotubulus Polimerizáció:


Immunológia alapjai előadás. Az immunológiai felismerés molekuláris összetevői.

Immunológia alapjai előadás. Az immunológiai felismerés molekuláris összetevői. Immunológia alapjai 3 4. előadás Az immunológiai felismerés molekuláris összetevői. Az antigén fogalma. Antitestek, T- és B- sejt receptorok: molekuláris szerkezet, funkciók, alcsoportok Az antigén meghatározása



AZ ÉLET KÉMIÁJA... ÉLŐ ANYAG SZERVEZETI ALAPEGYSÉGE AZ ÉLET KÉMIÁJA... ÉLŐ ANYAG SZERVEZETI ALAPEGYSÉGE A biológia az élet tanulmányozásával foglalkozik, az élő szervezetekre viszont vonatkoznak a fizika és kémia törvényei MI ÉPÍTI FEL AZ ÉLŐ ANYAGOT? HOGYAN


7. előadás: A plazma mebrán szerkezete és funkciója. Anyagtranszport a plazma membránon keresztül.

7. előadás: A plazma mebrán szerkezete és funkciója. Anyagtranszport a plazma membránon keresztül. 7. előadás: A plazma mebrán szerkezete és funkciója. Anyagtranszport a plazma membránon keresztül. A plazma membrán határolja el az élő sejteket a környezetüktől Szelektív permeabilitást mutat, így lehetővé


Biológiai membránok és membrántranszport

Biológiai membránok és membrántranszport Biológiai membránok és membrántranszport Biológiai membránok A citoplazma membrán funkciói: térrészek elválasztása (egész sejt, organellumok) transzport jelátvitel Milyen a membrán szerkezete? lipidek


A jel-molekulák útja változó hosszúságú lehet. A jelátvitel. hírvivő molekula (messenger) elektromos formában kódolt információ

A jel-molekulák útja változó hosszúságú lehet. A jelátvitel. hírvivő molekula (messenger) elektromos formában kódolt információ A jelátvitel hírvivő molekula (messenger) elektromos formában kódolt információ A jel-molekulák útja változó hosszúságú lehet 1. Endokrin szignalizáció: belső elválasztású mirigy véráram célsejt A jelátvitel:


A citoszkeleton. A citoszkeleton, a motorfehérjék, az izom és működésének szabályozása. A citoszkeleton. A citoszkeleton.

A citoszkeleton. A citoszkeleton, a motorfehérjék, az izom és működésének szabályozása. A citoszkeleton. A citoszkeleton. , a motorfehérjék, az izom és működésének szabályozása PTE ÁOK Biofizikai Intézet Ujfalusi Zoltán 2012. január-február Eukarióta sejtek dinamikus vázrendszere Három fő filamentum-osztály: 1. Intermedier


1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói

1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói 1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói Plazmamembrán Membrán funkciói: sejt integritásának fenntartása állandó hő, energia, és információcsere biztosítása homeosztázis


16. A sejtek kommunikációja: jelátviteli folyamatok (szignál-transzdukció)

16. A sejtek kommunikációja: jelátviteli folyamatok (szignál-transzdukció) 16. A sejtek kommunikációja: jelátviteli folyamatok (szignál-transzdukció) 2016. február 25. Lippai Mónika Minden sejt érzékel többféle, más sejtek által kibocsájtott jelmolekulát. - A jeleket


Egy idegsejt működése

Egy idegsejt működése 2a. Nyugalmi potenciál Egy idegsejt működése A nyugalmi potenciál (feszültség) egy nem stimulált ingerelhető sejt (neuron, izom, vagy szívizom sejt) membrán potenciálját jelenti. A membránpotenciál a plazmamembrán


Intracelluláris ion homeosztázis I.-II. Február 15, 2011

Intracelluláris ion homeosztázis I.-II. Február 15, 2011 Intracelluláris ion homeosztázis I.II. Február 15, 2011 Ca 2 csatorna 1 Ca 2 1 Ca 2 EC ~2 mm PLAZMA Na /Ca 2 cserélő Ca 2 ATPáz MEMBRÁN Ca 2 3 Na ATP ADP 2 H IC ~100 nm citoszol kötött Ca 2 CR CSQ SERCA


térrészek elválasztása transzport jelátvitel Milyen a membrán szerkezete? Milyen a membrán szerkezete? lipid kettısréteg, hidrofil/hidrofób részek

térrészek elválasztása transzport jelátvitel Milyen a membrán szerkezete? Milyen a membrán szerkezete? lipid kettısréteg, hidrofil/hidrofób részek Biológiai membránok A citoplazma membrán funkciói: Biológiai membránok és membrántranszport térrészek elválasztása (egész sejt, organellumok) transzport jelátvitel Milyen a membrán szerkezete? lipidek


A kemotaxis biológiai és klinikai

A kemotaxis biológiai és klinikai A kemotaxis biológiai és klinikai jelentősége - Válogatott fejezetek A kemotaxis biológiai és klinikai jelentősége - Válogatott fejezetek - Írta: Kőhidai László Szakmailag ellenőrizte: Csaba György Láng


MITOCHONDRIUM. Molekuláris sejtbiológia: Dr. habil. Kőhidai László egytemi docens Semmelweis Egyetem, Genetikai, Sejt- és Immunbiológiai Intézet

MITOCHONDRIUM. Molekuláris sejtbiológia: Dr. habil. Kőhidai László egytemi docens Semmelweis Egyetem, Genetikai, Sejt- és Immunbiológiai Intézet Molekuláris sejtbiológia: MITOCHONDRIUM külső membrán belső membrán lemezek / crista matrix Dr. habil. Kőhidai László egytemi docens Semmelweis Egyetem, Genetikai, Sejt- és Immunbiológiai Intézet Tudomány-történet


9. előadás Sejtek közötti kommunikáció

9. előadás Sejtek közötti kommunikáció 9. előadás Sejtek közötti kommunikáció Intracelluláris kommunikáció: Elmozdulás aktin szálak mentén miozin segítségével: A mikrofilamentum rögzített, A miozin mozgékony, vándorol az aktinmikrofilamentum


A citoszkeleton. A citoszkeleton, a motorfehérjék, az izom és működésének szabályozása. A citoszkeleton. A citoszkeleton. Az aktin.

A citoszkeleton. A citoszkeleton, a motorfehérjék, az izom és működésének szabályozása. A citoszkeleton. A citoszkeleton. Az aktin. , a motorfehérjék, az izom és működésének szabályozása PTE ÁOK Biofizikai Intézet Ujfalusi Zoltán 2011. január-február Eukarióta sejtek dinamikus vázrendszere Három fő filamentum-osztály: 1. Intermedier



ANATÓMIA FITNESS AKADÉMIA ANATÓMIA FITNESS AKADÉMIA sejt szövet szerv szervrendszer sejtek általános jellemzése: az élet legkisebb alaki és működési egysége minden élőlény sejtes felépítésű minden sejtre jellemző: határoló rendszer


IONCSATORNÁK. I. Szelektivitás és kapuzás. III. Szabályozás enzimek és alegységek által. IV. Akciós potenciál és szinaptikus átvitel

IONCSATORNÁK. I. Szelektivitás és kapuzás. III. Szabályozás enzimek és alegységek által. IV. Akciós potenciál és szinaptikus átvitel IONCSATORNÁK I. Szelektivitás és kapuzás II. Struktúra és funkció III. Szabályozás enzimek és alegységek által IV. Akciós potenciál és szinaptikus átvitel V. Ioncsatornák és betegségek VI. Ioncsatornák





AJÁNLOTT IRODALOM. Tankönyvkiadó, Budpest. Zboray Géza (1992) Összehasonlító anatómiai praktikum I.

AJÁNLOTT IRODALOM. Tankönyvkiadó, Budpest. Zboray Géza (1992) Összehasonlító anatómiai praktikum I. A tárgy neve Az állati szervezet felépítése és működése Meghirdető tanszék(csoport) SZTE TTK Állattani és Sejtbiológiai Tanszék Felelős oktató: Dr.Fekete Éva Kredit 2 Heti óraszám 2 típus Előadás Számonkérés


Extraszinaptikus proteinek szerepe a szinaptikus átvitelben

Extraszinaptikus proteinek szerepe a szinaptikus átvitelben Extraszinaptikus proteinek szerepe a szinaptikus átvitelben Szakdolgozat biológia alapszak, biológus szakirány készítette: GYÖRFFY BALÁZS ANDRÁS témavezető: DR. KÉKESI ADRIENNA KATALIN, egyetemi docens


A citoszkeleton Eukarióta sejtváz

A citoszkeleton Eukarióta sejtváz A citoszkeleton Eukarióta sejtváz - Alak és belső szerkezet - Rugalmas struktúra sejt izomzat - Fehérjékből épül fel A citoszkeleton háromféle filamentumból épül fel Intermedier filamentum mikrotubulus


Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Azonosító szám: TÁMOP-4.1.2-08/1/A-2009-0011 Az orvosi


Fehérjeszerkezet, és tekeredés

Fehérjeszerkezet, és tekeredés Fehérjeszerkezet, és tekeredés Futó Kinga 2013.10.08. Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983


Szerkesztette: Vizkievicz András

Szerkesztette: Vizkievicz András Fehérjék A fehérjék - proteinek - az élő szervezetek számára a legfontosabb vegyületek. Az élet bármilyen megnyilvánulási formája fehérjékkel kapcsolatos. A sejtek szárazanyagának minimum 50 %-át adják.


Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek

Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek Hidroxikarbonsavak α-hidroxi karbonsavak -Glikolsav (kézkrémek) - Tejsav (tejtermékek, izomláz, fogszuvasodás) - Citromsav (citrusfélékben,


NÖVÉNYGENETIKA. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP /1/A

NÖVÉNYGENETIKA. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP /1/A NÖVÉNYGENETIKA Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 A NÖVÉNYI TÁPANYAG TRANSZPORTEREK az előadás áttekintése A tápionok útja a növényben Növényi tápionok passzív és


Élettan-anatómia. 1. félév

Élettan-anatómia. 1. félév Élettan-anatómia 1. félév Dr. Világi Ildikó docens ELTE TTK Élettani és Neurobiológiai Tanszék tematika, előadások anyaga, fogalomjegyzék, esszé témakörök:



TRIPSZIN TISZTÍTÁSA AFFINITÁS KROMATOGRÁFIA SEGÍTSÉGÉVEL TRIPSZIN TISZTÍTÁSA AFFINITÁS KROMATOGRÁFIA SEGÍTSÉGÉVEL Az egyes biomolekulák izolálása kulcsfontosságú a biológiai szerepük tisztázásához. Az affinitás kromatográfia egyszerűsége, reprodukálhatósága


Vezikuláris transzport

Vezikuláris transzport Molekuláris Sejtbiológia Vezikuláris transzport Dr. habil KŐHIDAI László Semmelweis Egyetem, Genetikai, Sejt- és Immunbiológiai Intézet 2005. november 3. Intracelluláris vezikul uláris transzport Kommunikáció


Emlőtumorok progressziójában szerepet játszó molekuláris mechanizmusok vizsgálata a syndecan-4 komplex szerepe MCF-7 sejtekben

Emlőtumorok progressziójában szerepet játszó molekuláris mechanizmusok vizsgálata a syndecan-4 komplex szerepe MCF-7 sejtekben Emlőtumorok progressziójában szerepet játszó molekuláris mechanizmusok vizsgálata a syndecan-4 komplex szerepe MCF-7 sejtekben Doktori értekezés Dr. Keller-Pintér Anikó Semmelweis Egyetem Patológiai Doktori


Immunológia alapjai 5-6. előadás MHC szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás.

Immunológia alapjai 5-6. előadás MHC szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás. Immunológia alapjai 5-6. előadás MHC szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás. Az immunrendszer felépítése Veleszületett immunitás (komplement, antibakteriális






Opponensi vélemény. dr. Várnai Péter: MOLEKULÁRIS KÖLCSÖNHATÁSOK SZEREPE EMLİS SEJTEK JELÁTVITELI OLYAMATAIBAN címő MTA Doktori Értekezésérıl Opponensi vélemény dr. Várnai Péter: MOLEKULÁRIS KÖLCSÖNHATÁSOK SZEREPE EMLİS SEJTEK JELÁTVITELI OLYAMATAIBAN címő MTA Doktori Értekezésérıl Dr. Várnai Péter MTA Doktori Értekezésének témáját az 1998 óta


A harántcsíkolt izom struktúrája általános felépítés

A harántcsíkolt izom struktúrája általános felépítés harántcsíkolt izom struktúrája általános felépítés LC-2 Izom LC1/3 Izom fasciculus LMM S-2 S-1 HMM rod Miozin molekula S-1 LMM HMM S-2 S-1 Izomrost H Band Z Disc csík I csík M Z-Szarkomér-Z Miofibrillum


Eukariota állati sejt

Eukariota állati sejt Eukariota állati sejt SEJTMEMBRÁN A sejtek működéséhez egyszerre elengedhetetlen a környezettől való elhatárolódás és a környezettel való kapcsolat kialakítása. A sejtmembrán felelős többek közt azért,


A szervezet vízterei

A szervezet vízterei A homeosztázis Bernard (XIX. sz.): belsı környezet fogalma - az élı szervezet egy folyékony belsı közegben (=extracelluláris folyadék) létezik - stabilitását biztosítani kell Canon (1926): homeosztázis


Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Azonosító szám: TÁMOP-4.1.2-08/1/A-2009-0011 Az orvosi


FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest,

FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest, FEHÉRJÉK A MÁGNESEKBEN Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium Alkímia Ma, Budapest, 2013.02.28. I. FEHÉRJÉK: L-α aminosavakból felépülő lineáris polimerek α H 2 N CH COOH amino


A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin.

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin. Myoglobin Fehérje-szerkezetek! MGLSDGEWQLVLNVWGKVEADIPGGQEVLIRLFK GPETLEKFDKFKLKSEDEMKASE DLKKGATVLTALGGILKKKGEAEIKPLAQSA TKKIPVKYLEFISECIIQVLQSK PGDFGADAQGAMNKALELFRKDMASNYKELGFQG Fuxreiter Mónika! Debreceni


Energiatermelés a sejtekben, katabolizmus. Az energiaközvetítő molekula: ATP

Energiatermelés a sejtekben, katabolizmus. Az energiaközvetítő molekula: ATP Energiatermelés a sejtekben, katabolizmus Az energiaközvetítő molekula: ATP Elektrontranszfer, a fontosabb elektronszállító molekulák NAD: nikotinamid adenin-dinukleotid FAD: flavin adenin-dinukleotid


Biológia 3. zh. A gyenge sav típusú molekulák mozgása a szervezetben. Gyengesav transzport. A glükuronsavval konjugált molekulákat a vese kiválasztja.

Biológia 3. zh. A gyenge sav típusú molekulák mozgása a szervezetben. Gyengesav transzport. A glükuronsavval konjugált molekulákat a vese kiválasztja. Biológia 3. zh Az izomösszehúzódás szakaszai, molekuláris mechanizmusa, az izomösszehúzódás során milyen molekula deformálódik és hogyan? Minden izomrosthoz kapcsolódik kegy szinapszis, ez az úgynevezett


A piruvát-dehidrogenáz komplex. Csala Miklós

A piruvát-dehidrogenáz komplex. Csala Miklós A piruvát-dehidrogenáz komplex Csala Miklós szénhidrátok fehérjék lipidek glikolízis glukóz aminosavak zsírsavak acil-koa szintetáz e - piruvát acil-koa légz. lánc H + H + H + O 2 ATP szint. piruvát H


Novák Béla: Sejtbiológia Membrántranszport

Novák Béla: Sejtbiológia Membrántranszport Membrántranszport folyamatok A lipid kettos réteg gátat jelent a poláros molekulák számára. Ez a gát alapveto fontosságú a citoszól és az extracelluláris "milieu" közti koncentráció különbségek biztosításában.


2007/11/05 Molekuláris biológia előadások - Putnoky 1-1

2007/11/05 Molekuláris biológia előadások - Putnoky 1-1 1-1 Fehérje transzportmechanizmusok az eukariota sejtben: 1) transzmembrán transzport kitekert formában, egyedi fehérjék transzportja célzottan - citoszol ER, citoszol MT 2) póruson keresztüli transzport



1. SEJT-, ÉS SZÖVETTAN. I. A sejt 1. SEJT-, ÉS SZÖVETTAN SZAKMAI INFORMÁCIÓTARTALOM I. A sejt A sejt cellula az élő szervezet alapvető szerkezeti és működési egysége, amely képes az önálló anyag cserefolyamatokra és a szaporodásra. Alapvetően


A glükóz reszintézise.

A glükóz reszintézise. A glükóz reszintézise. A glükóz reszintézise. A reszintézis nem egyszerű megfordítása a glikolízisnek. A glikolízis 3 irrevezibilis lépése más úton játszódik le. Ennek oka egyrészt energetikai, másrészt


A citoszkeletális rendszer, a harántcsíkolt izom biofizikája.

A citoszkeletális rendszer, a harántcsíkolt izom biofizikája. A citoszkeletális rendszer, a harántcsíkolt izom biofizikája. SCIENCE PHOTO LIBRARY Kupi Tünde 2010. 10. 19. Citoszkeleton: eukarióta sejtek dinamikus fehérjevázrendszere Három fı filamentum-osztály: A.


Kollokviumi vizsgakérdések biokémiából humánkineziológia levelező (BSc) 2015

Kollokviumi vizsgakérdések biokémiából humánkineziológia levelező (BSc) 2015 Kollokviumi vizsgakérdések biokémiából humánkineziológia levelező (BSc) 2015 A kérdés 1. A sejtről általában, a szervetlen alkotórészeiről, a vízről részletesen. 2. A sejtről általában, a szervetlen alkotórészeiről,


Jelátviteli útvonalak 1

Jelátviteli útvonalak 1 Jelátviteli útvonalak 1 Információ metabolizmus Szignál transzdukció 1 Jelátviteli séma Mi lehet a jel? Hormonok Növekedési faktorok Fejlődési szignálok Neurotranszmitterek Antigének Sejtfelszíni glikoproteinek


A veseműködés élettana, a kiválasztás funkciója, az emberi test víztereinek élettana (5)

A veseműködés élettana, a kiválasztás funkciója, az emberi test víztereinek élettana (5) A veseműködés élettana, a kiválasztás funkciója, az emberi test víztereinek élettana (5) Dr. Attila Nagy 2016 Kalcium és foszfátháztartás (Tanulási támpont: 63) A szabályozásban a pajzsmirigy, mellékpajzsmirigy



AZ EMBERI TEST FELÉPÍTÉSE AZ EMBERI TEST FELÉPÍTÉSE Szalai Annamária ESZSZK GYITO Általános megfontolások anatómia-élettan: az egészséges emberi szervezet felépítésével és működésével foglalkozik emberi test fő jellemzői: kétoldali


1. Előadás Membránok felépítése, mebrán raftok

1. Előadás Membránok felépítése, mebrán raftok 1. Előadás Membránok felépítése, mebrán raftok Plazmamembrán Membrán funkciói: sejt integritásának fenntartása állandó hő, energia, és információcsere biztosítása homeosztázis biztosítása Klasszikus folyadékmozaik


A transzportfolyamatok és a sejtek közötti kommunikáció

A transzportfolyamatok és a sejtek közötti kommunikáció A transzportfolyamatok és a sejtek közötti kommunikáció A sejtmembrán protektív és szelektív barrier kompartmentalizáció: sejtfelszín és sejtorganellumok borítása 1926 szénhidrát 1943 zsírsav 1972 poláros


A miokardium intracelluláris kalcium homeosztázisa: iszkémiás és kardiomiopátiás változások

A miokardium intracelluláris kalcium homeosztázisa: iszkémiás és kardiomiopátiás változások Doktori értekezés A miokardium intracelluláris kalcium homeosztázisa: iszkémiás és kardiomiopátiás változások Dr. Szenczi Orsolya Témavezető: Dr. Ligeti László Klinikai Kísérleti Kutató- és Humán Élettani


MedInProt Szinergia IV. program. Szerkezetvizsgáló módszer a rendezetlen fehérjék szerkezetének és kölcsönhatásainak jellemzésére

MedInProt Szinergia IV. program. Szerkezetvizsgáló módszer a rendezetlen fehérjék szerkezetének és kölcsönhatásainak jellemzésére MedInProt Szinergia IV. program Szerkezetvizsgáló módszer a rendezetlen fehérjék szerkezetének és kölcsönhatásainak jellemzésére Tantos Ágnes MTA TTK Enzimológiai Intézet, Rendezetlen fehérje kutatócsoport


A harántcsíkolt izomrostok típusai:

A harántcsíkolt izomrostok típusai: A harántcsíkolt izomrostok típusai: 1. Vörös (aerob) rostok: vékony rostok nagy mennyiségű mioglobinnal citokrómmal mitokondriummal 2. Fehér (anaerob) rostok: vastag rostok kevés mioglobinnal citokrómmal


Integráció. Csala Miklós. Semmelweis Egyetem Orvosi Vegytani, Molekuláris Biológiai és Patobiokémiai Intézet

Integráció. Csala Miklós. Semmelweis Egyetem Orvosi Vegytani, Molekuláris Biológiai és Patobiokémiai Intézet Integráció Csala Miklós Semmelweis Egyetem Orvosi Vegytani, Molekuláris Biológiai és Patobiokémiai Intézet Anyagcsere jóllakott állapotban Táplálékkal felvett anyagok sorsa szénhidrátok fehérjék lipidek


A somatomotoros rendszer

A somatomotoros rendszer A somatomotoros rendszer Motoneuron 1 Neuromuscularis junctio (NMJ) Vázizom A somatomotoros rendszer 1 Neurotranszmitter: Acetil-kolin Mire hat: Nikotinos kolinerg-receptor (nachr) Izom altípus A parasympathicus


A keringı tumor markerek klinikai alkalmazásának aktuális kérdései és irányelvei

A keringı tumor markerek klinikai alkalmazásának aktuális kérdései és irányelvei A keringı tumor markerek klinikai alkalmazásának aktuális kérdései és irányelvei A TM vizsgálatok alapkérdései A vizsgálatok célja, információértéke? Az alkalmazás területei? Hogyan válasszuk ki az alkalmazott


Fehérjeszerkezet, fehérjetekeredés

Fehérjeszerkezet, fehérjetekeredés Fehérjeszerkezet, fehérjetekeredés A fehérjeszerkezet szintjei A fehérjetekeredés elmélete: Anfinsen kísérlet Levinthal paradoxon A feltekeredés tölcsér elmélet 2014.11.05. Aminosavak és fehérjeszerkezet


A centriólum és a sejtek mozgási organellumai

A centriólum és a sejtek mozgási organellumai A centriólum A centriólum és a sejtek mozgási organellumai Egysejtű eukarióta sejtekben,soksejtű állatok sejtjeiben 9x3-triplet A,B és C tubulus alegységek hengerpalástszerű helyezkedéssel Hossza 0,3mm


SEJT,SZÖVET,SZERV BIOLÓGIAI ÖSSZEFOGLALÓ KURZUS 6. HÉT. Kun Lídia Semmelweis Egyetem, Genetika, Sejt és Immunbiológiai Intézet

SEJT,SZÖVET,SZERV BIOLÓGIAI ÖSSZEFOGLALÓ KURZUS 6. HÉT. Kun Lídia Semmelweis Egyetem, Genetika, Sejt és Immunbiológiai Intézet SEJT,SZÖVET,SZERV BIOLÓGIAI ÖSSZEFOGLALÓ KURZUS 6. HÉT Kun Lídia Semmelweis Egyetem, Genetika, Sejt és Immunbiológiai Intézet Egy eukarióta sejt általában Kompartmentalizáció = különböző sejtfolyamatok


2. Az alacsony feszültségű elektroporátor (LVEP) fenomenologikus modellje

2. Az alacsony feszültségű elektroporátor (LVEP) fenomenologikus modellje 1 Sugár István Sejt- és lipid membrán struktúrák. Az elektromos-, termális-, és kémiai kölcsönhatások szerepe című nagydoktori értekezésének véleményezése Sugár István nagydoktori értekezésének középpontjában


Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Azonosító szám: TÁMOP-4.1.2-08/1/A-2009-0011 Az orvosi


15. * A sejtbiológia gyakorlata. 15.1. Sejt- és szövettenyésztés: módszertani alapismeretek MADARÁSZ EMÍLIA

15. * A sejtbiológia gyakorlata. 15.1. Sejt- és szövettenyésztés: módszertani alapismeretek MADARÁSZ EMÍLIA 15. * A sejtbiológia gyakorlata 15.1. Sejt- és szövettenyésztés: módszertani alapismeretek MADARÁSZ EMÍLIA 15.1.1. A sejt- és szövettenyészetek típusai 15.1.2. Sejttenyészetek készítése Primer
