Molekuláris biológiai adatbázisok és adatbázis keresések. Barta Endre Tóth Gábor MBK Bioinformatikai Csoport

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "Molekuláris biológiai adatbázisok és adatbázis keresések. Barta Endre Tóth Gábor MBK Bioinformatikai Csoport"

Átírás

1 Molekuláris biológiai adatbázisok és adatbázis keresések Barta Endre Tóth Gábor MBK Bioinformatikai Csoport

2 Adatbázisok: megvalósítás Szöveges adatbázis általában szekvenciális, néha indexelt megfelelő programmal indexelt bináris formába alakítható (pl. EMBOSS/dbiflat, BLAST/formatdb) flatfile emberi olvasásra is alkalmas XML (extensibe Markup Language; DTD: Document Type Definition) adattárolás és adatmegjelenítés különválik számítógépes programmal dolgozandó fel Bináris ASN.1 ( Abstract Syntax Notation 1 ) adatcsere szabvány Relációs adatbázis keresztreferenciák, logikai kapcsolatok kezelése többszörös indexelhetőség bonyolult lekérdezések lehetősége gyors hozzáférés az adatokhoz adatbáziskezelő program Molecular phylogenetics 2

3 XML formátum (példa) Molecular phylogenetics 3

4 Relációs adatbázisok szerkezete Tábla 1 Mező 1 Mező 2 Mező n Tábla 2 Mező 3 Mező 4 Mező n Egy DNS adatbanknál egyszerű, de egy nagyobb adatbanknál sokkal bonyolultabb struktúra Molecular phylogenetics 4

5 Kereszthivatkozások (táblák összekapcsolása) Tábla 1 (GenBank) Mező 1 (LOCUS) Mező n taxid pl Több rekord is mutathat ugyanarra a fajra Tábla 2 (Taxonomy) Mező 1 (taxid, pl. 3702) Mező n (fajnév) Arabidopsis thaliana Molecular phylogenetics 5

6 Szekvencia adatbázis szerkezete Tábla (pl. GenBank) Rekord 1 (Annotáció) szöveges keresés Mező 1 (pl. Locus) Mező 2 (pl. Definition) Stb. (Szekvencia) hasonlóság keresés Mező n (pl. cgagcatgcatctagtagcagcgtactac) Molecular phylogenetics 6

7 Szöveges keresés adatbázisokban Flatfile-ban keresés egy szóra, szórészletre A találat sorát (pl. UNIX grep) és környezetét látjuk csak, holott mi az egész rekordra lennénk kíváncsiak Megoldás: adatbázismotorok SQL (Simple Query Language), pl. MS Access, Oracle, MySQL stb. ENSEMBL, UCSC (MySQL) EMBL, InterPro (Oracle) Saját motor ACEDB SRS (icarus) Molecular phylogenetics 7

8 Keresés alapfilozófiája SQL: SELECT * (összes olyan rekord) FROM tábla (pl. GenBank) WHERE mező1 CONTAINS/SIMILAR/IDENTICAL (LIKE) valami AND SORT BY DISPLAY stb. Ezeket össze lehet fűzni Pl. keressük az összes burgonya szekvenciát SELECT * FROM GenBank WHERE OS= Solanum tuberosum Molecular phylogenetics 8

9 Dinamikus weboldalak Megadjuk, hogy mit akarunk keresni Kiválasztjuk, hogy miben A szerver ezt átalakítja pl. egy SQL paranccsá (sokszor ezt meg is lehet nézni) Az SQL parancsot végrehajtja egy vagy több adatbázison (ezek lehetnek különböző szervereken) A kapott eredményt on-the-fly átalakítja és megjeleníti a kliens böngészőn Molecular phylogenetics 9

10 Keresési stratégiák Megfelelő kulcsszavak kiválasztása Szélesebbtől a szűkebb fele 2 legfontosabb hiba: Túl sok találat Túl kevés találat Általában mindegy hogy kisbetű vagy nagybetű Kifejezéseket idézőjelbe Logikai kifejezések használata a AND b = akkor, ha mindkettő megvan az adott rekordban a OR b = bármelyikben megvan a BUT(AND)NOT b = a benne van, de b nincs Molecular phylogenetics 10

11 Molekuláris biológiai adatbázisok típusai Elsődleges adatbázisok DNS (RNS) adatbázisok (International Nucleotide Sequence Database Collaboration) EMBL (European Bioinformatics Institute, EBI) GenBank (National Center for Biotechnology Information, NCBI) DDBJ (DNA DataBank of Japan) (pl. térszerkezeti adatbázisok) Másodlagos v. származtatott adatbázisok Fehérje adatbankok Motívum adatbankok Egyéb (nem szekvencia) adatbázisok (Nucleic Acids Res. januári első száma) Molecular phylogenetics 11

12 Molecular phylogenetics 12

13 Molecular phylogenetics 13

14 Elsődleges adatbázisok Mi a közös a 3 elsődleges adatbankban? International Nucleotide Sequence Database Collaboration adatcsere naponta taxonómia projekt azonos accession number közös feature table Elég eggyel foglalkozni, főbb adatokban nincs különbség Eltérő adatbázis-szerkezet/formátum formátumkonverzió: pl. readseq (UNIX), seqret (EMBOSS), ForCon (Windows) Molecular phylogenetics 14

15 Adatbázisok története Honnan jönnek az adatok? Irodalomban közölt adatok kézi bevitele Papíron beküldött szekvenciák (pl. GCG-ben Submission form ) Floppy Csak akkor fogadták el a cikket, ha a benne lévő szekvenciát már beküldték valamelyik adatbankba, innentől adatbankok szinkronizálása Internet (WWW, ) egyedileg a kutatók által nagyobb adagokban a szekvenáló központokból Molecular phylogenetics 15

16 Adatbázisok és a tárolókapacitás növekedése (MBK vs. EMBL) 1990: MicroVax szerver 2x 160 Mbyte HDD 50 Mbp 1993: SUN SparcServer x 512 Mbyte HDD 150 Mbp 1997: SUN Ultra Enterprise II 4x 9 Gbyte HDD 1 Gbp 2002: SUN Fire V480 8x 180Gbyte HDD 38 Gbp Szekvencia + annotáció + index: ~140 Gbyte (2004) Molecular phylogenetics 16

17 Molecular phylogenetics 17

18 Adatbázisok exponenciális növekedése EMBL: rekordok száma (millió) EMBL: nukleotidok száma (gigabázis) Molecular phylogenetics 18

19 Adatbázisok szerkezete Úgynevezett flatfile formátum EMBL: 64,8 Gb 38,3 millió rekord ( ) (WGS szekcióval együtt) GenBank Release 140 (2004. február) 32,6 millió szekvencia 37,9 milliárd nukleotid (37,9 gigabázis) ~127 Gbyte (indexekkel együtt ~143 GByte) Szekciók/divíziók Rendszertani kategóriák alapján De inkább ahogy történelmileg alakult Rekordok (vagy entry -k) Mezők Annotáció Szekvencia Molecular phylogenetics 19

20 EMBL szekciók Eredeti felosztás: Pl ben vírusok, prokarióták, eukarióták stb. Release 18, february 1989 Division Entries Nucleotides Artificial Chloroplast Genetic elements Mitochondrial Prokaryotic Viral/Phage Eukaryotic Unclassified Unannotated Total Nagy mennyiségű szekvenálás újabb szekciók bevezetése (pl. EST, HTG, GSS stb.), valamint egyes szekciók felosztása vált szükségessé Molecular phylogenetics 20

21 Főbb EMBL szekciók I. EST: expressed sequence tag (cdns részl. szekv.) STS: sequence tagged site (PCR) GSS: genome survey sequences (random genomi) HTG: high throughput genomic (unfinished) WGS: whole genome shotgun PLN: növények FUN: gombák PRO: prokarióta ORG: organellum VRL: vírus PHG: bakteriofág PAT: szabadalommal védett SYN: szintetikus Molecular phylogenetics 21

22 Főbb EMBL szekciók II. HUM: humán MUS: egér ROD: egyéb rágcsáló MAM: egyéb emlős VRT: egyéb gerinces INV: gerinctelen Molecular phylogenetics 22

23 Különböző EMBL szekciók mérete EMBL Release 78 EST HTG Molecular phylogenetics 23

24 EMBL: megoszlás fajok szerint (első 10) Nukleotidok száma: ecetmuslica egyéb kutya csimpánz ember patkány egér Molecular phylogenetics 24

25 Egy EMBL rekord (részlet) ID HSCYCLOX standard; mrna; HUM; 3387 BP. XX AC M90100; XX SV M XX DT 30-MAR-1992 (Rel. 31, Created) DT 04-MAR-2000 (Rel. 63, Last updated, Version 7) XX DE Homo sapiens cyclooxygenase-2 (Cox-2) mrna, complete cds. XX KW cyclooxygenase-2; prostaglandin synthase. XX OS Homo sapiens (human) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Primates; Catarrhini; Hominidae; Homo. XX RN [1] RP RX MEDLINE; RX PUBMED; RA Hla T., Neilson K.; RT "Human cyclooxygenase-2 cdna"; RL Proc. Natl. Acad. Sci. U.S.A. 89(16): (1992). XX DR GOA; P DR SWISS-PROT; P35354; PGH2_HUMAN. XX FH Key Location/Qualifiers FH FT source FT /db_xref="taxon:9606" FT /mol_type="mrna" FT /organism="homo sapiens" FT /cell_type="endothelial" FT /tissue_type="umbilical vein" Molecular phylogenetics 25

26 Egy EMBL rekord (folytatás) FT 5'UTR FT /gene="cox-2" FT CDS FT /codon_start=1 FT /db_xref="goa:p35354" FT /db_xref="swiss-prot:p35354" FT /gene="cox-2" FT /EC_number=" " FT /product="cyclooxygenase-2" FT /protein_id="aaa " FT /translation="mlaralllcavlalshtanpccshpcqnrgvcmsvgfdqykcdct FT RTGFYGENCSTPEFLTRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLT FT... FT KGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKT FT VTINASSSRSGLDDINPTVLLKERSTEL" FT sig_peptide FT /gene="cox-2" FT mat_peptide FT /gene="cox-2" FT /EC_number=" " FT /product="cyclooxygenase-2" FT 3'UTR FT /gene="cox-2" FT polya_signal FT /gene="cox-2" XX SQ Sequence 3387 BP; 1010 A; 712 C; 633 G; 1032 T; 0 other; gtccaggaac tcctcagcag cgcctccttc agctccacag ccagacgccc tcagacagca 60 aagcctaccc ccgcgccgcg ccctgcccgc cgctgcgatg ctcgcccgcg ccctgctgct tacctgaact tttgcaagtt ttcaggtaaa cctcagctca ggactgctat ttagctcctc 3360 ttaagaagat taaaaaaaaa aaaaaag 3387 // Molecular phylogenetics 26

27 Főbb mezők az EMBL adatbankban ID egyedi azonosító, (entryname dataclass; molecule; division; sequencelength BP.) AC accession number, változatlan, erre kell hivatkozni SV szekvencia verzió DT létrehozás, módosítás ideje DE description, a szekvencia rövid leírása KW kulcsszavak O? teljes taxonómiai besorolás R? referenciák DR adatbázis keresztreferenciák CC megjegyzések FT feature table: a szekvencia egy-egy részének a tulajdonsága XX üres, csak térkitöltő SQ szekvencia // rekord vége Molecular phylogenetics 27

28 Annotáció: EMBL vs. GenBank EMBL: ID egyedi azonosító AC egyedi azonosító! = GenBank ACCESSION SV entry verzió (volt: NI) DE rövid leírás OS faj OC taxonómiai besorolás FT feature table : tulajdonság/pozíció FT CDS kódoló szekvencia (PID) GenBank: LOCUS kihalóban? formátum miatt marad ACCESSION egyedi! = EMBL AC VERSION entry verzió * GI = EMBL NI DEFINITION rövid leírás SOURCE faj triviális neve ORGANISM faj, taxonómia FEATURES feature table tulajdonság/pozíció CDS kódoló szekvencia /protein_id /db_xref tr. fehérje GI No. * Accession.Version GI: NCBI belső azonosító (ld. BLAST DB) Molecular phylogenetics 28

29 Egy GenBank rekord (részlet) LOCUS HUMCYCLOX 3387 bp mrna linear PRI 31-DEC-1994 DEFINITION Homo sapiens cyclooxygenase-2 (Cox-2) mrna, complete cds. ACCESSION M90100 VERSION M GI: KEYWORDS cyclooxygenase-2; prostaglandin synthase. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Primates; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 3387) AUTHORS Hla,T. and Neilson,K. TITLE Human cyclooxygenase-2 cdna JOURNAL Proc. Natl. Acad. Sci. U.S.A. 89 (16), (1992) MEDLINE PUBMED COMMENT Original source text: Homo sapiens umbilical vein cdna to mrna. FEATURES Location/Qualifiers source /organism="homo sapiens" /mol_type="mrna" /db_xref="taxon:9606" /cell_type="endothelial" /tissue_type="umbilical vein" gene /gene="cox-2" 5'UTR /gene="cox-2" Molecular phylogenetics 29

30 Egy GenBank rekord (folytatás) CDS /gene="cox-2" /EC_number=" " /codon_start=1 /product="cyclooxygenase-2" /protein_id="aaa " /db_xref="gi:181254" /translation="mlaralllcavlalshtanpccshpcqnrgvcmsvgfdqykcdc TRTGFYGENCSTPEFLTRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYV... VEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKGCPFTSF SVPDPELIKTVTINASSSRSGLDDINPTVLLKERSTEL" sig_peptide /gene="cox-2" mat_peptide /gene="cox-2" /product="cyclooxygenase-2" /EC_number=" " 3'UTR /gene="cox-2" polya_signal /gene="cox-2" BASE COUNT 1010 a 712 c 633 g 1032 t ORIGIN 1 gtccaggaac tcctcagcag cgcctccttc agctccacag ccagacgccc tcagacagca 61 aagcctaccc ccgcgccgcg ccctgcccgc cgctgcgatg ctcgcccgcg ccctgctgct tacctgaact tttgcaagtt ttcaggtaaa cctcagctca ggactgctat ttagctcctc 3361 ttaagaagat taaaaaaaaa aaaaaag // Molecular phylogenetics 30

31 EMBL adatbázis fejlődése EMBL Sequence Version Archive Nem csak az adatok, hanem az adatbázis szerkezete is folyamatosan változik elsősorban a feature table új keresztreferenciák más adatbázisokkal Molecular phylogenetics 31

32 Szekvencia-beküldés az adatbankokba EMBL: WEBin (http://www.ebi.ac.uk/submission/webin.html) GenBank: BankIt (http://www.ncbi.nlm.nih.gov/bankit/index.html) EMBL/GenBank: Sequin (lokálisan futó PC-s program) (ftp://ftp.ebi.ac.uk/pub/software/sequin/) Molecular phylogenetics 32

33 WEBIN Molecular phylogenetics 33

34 Molecular phylogenetics 34

35 Fehérjeszekvencia adatbázisok I. Swiss-Prot Kollaborációban készíti a SIB és az EBI Protein tudásbázis (ExPASy = Expert Protein Analysis System) Legjobban annotált adatbázis (kézi annotáció) Jó keresztreferenciák Non-profit kutatóknak ingyenes EMBL-hez hasonló adatbázis-szerkezet Szekvenciák lassú megjelenése TrEMBL Translated EMBL Automatikusan annotált SP-TrEMBL és REM-TrEMBL Molecular phylogenetics 35

36 Fehérjeszekvencia adatbázisok II. PIR (Protein Identification Resource) PIR-PSD Formátum: NBRF/PIR Kézi annotáció Keresztreferenciák (SWISS-PROT jobb!) Szupercsalád-besorolás 4 szekció: PIR1, PIR2, PIR3, PIR4 (legjobban annotált: PIR1) Megszűnik beolvadt az UniProt adatbázisba Genpept Lefordított GenBank CDS-ek (NCBI) Mint TrEMBL Molecular phylogenetics 36

37 Fehérjeszekvencia adatbázisok III. Universal Protein Resource (UniProt) Az EBI/SIB Swiss-Prot + TrEMBL és a PIR-PSD egyesítésével létrehozott adatbank EBI + SIB + PIR UniProt Consortium (2002) Három adatbázisréteg: UniProt Archive (UniParc) az összes publikus fehérjeszekvencia (nem redundáns) UniProt Knowledgebase (UniProt) megbízhatóan, konzisztensen és gazdagon annotált központi fehérjeszekvencia-adatbázis UniProt Non-redundant Reference (UniRef) kondenzált szekvenciakészlet UniProt tudásbázis: két rész kézzel annotált rekordok: Swiss-Prot (2004 végéig licenszköteles) számítógéppel elemzett rekordok (kézi annotáció előtt): TrEMBL UniRef UniRef100 (=UniProt), UniRef90, UniRef50 Molecular phylogenetics 37

38 Egy UniProt (Swiss-Prot) rekord ID AHA1_HUMAN STANDARD; PRT; 338 AA. AC O95433; Q96IL6; Q9P060; DT 16-OCT-2001 (Rel. 40, Created) DT 16-OCT-2001 (Rel. 40, Last sequence update) DT 15-SEP-2003 (Rel. 42, Last annotation update) DE Activator of 90 kda heat shock protein ATPase homolog 1 (AHA1) (p38) DE (HSPC322). GN AHSA1 OR C14ORF3. OS Homo sapiens (Human). OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; OC Mammalia; Eutheria; Primates; Catarrhini; Hominidae; Homo. OX NCBI_TaxID=9606; RN [1] RP SEQUENCE FROM N.A. RA Michaud J., Chrast R., Rossier C., Papassavas M.P., Antonarakis S.E., RA Scott H.S.; RT "Isolation of a novel gene underexpressed in Down syndrome."; RL Submitted (JUN-1999) to the EMBL/GenBank/DDBJ databases. DR EMBL; AF111168; AAD ; -. DR EMBL; AJ243310; CAB ; -. DR EMBL; AF164791; AAF ; -. DR EMBL; BC000321; AAH ; -. DR EMBL; BC007398; AAH ; ALT_INIT. DR EMBL; AF161440; AAF ; -. DR PIR; JC7769; JC7769. DR Genew; HGNC:1189; AHSA1. DR InterPro; IPR007821; DUF704. DR Pfam; PF05146; DUF704; 1. FT CONFLICT EA -> CL (IN REF. 4). SQ SEQUENCE 338 AA; MW; E6B686DDD8D7D729 CRC64; MAKWGEGDPR WIVEERADAT NVNNWHWTER DASNWSTDKL KTLFLAVQVQ NEEGKCEVTE VSKLDGEASI NNRKGKLIFF YEWSVKLNWT GTSKSGVQYK GHVEIPNLSD ENSVDEVEIS VSLAKDEPDT NLVALMKEEG VKLLREAMGI YISTLKTEFT QGMILPTMNG ESVDPVGQPA LKTEERKAKP APSKTQARPV GVKIPTCKIT LKETFLTSPE ELYRVFTTQE LVQAFTHAPA TLEADRGGKF HMVDGNVSGE FTDLVPEKHI VMKWRFKSWP EGHFATITLT FIDKNGETEL CMEGRGIPAP EEERTRQGWQ RYYFEGIKQT FGYGARLF // Molecular phylogenetics 38

39 Nem redundáns adatbázisok NCBI NRDB egyesített GenPept, PDB szekvenciák, SWISS-PROT, PIR nem azonos (!) fehérjék (polimorfizmus és szekvenálási hibák miatt redundáns) nr: indexelt BLAST formátumban letölthető OWL (http://www.bioinf.man.ac.uk/dbbrowser/owl/) összetett, nem redundáns fehérje adatbázis egyetlen aminosavban eltérő szekvenciák közül csak 1 marad prioritási sorrend: SWISS-PROT, PIR1-PIR4, GenPept, NRL-3D NCBI UniGene egyedi gének átfedő EST-k klaszterezésével 10 állat: pl. humán, egér, patkány, szarvasmarha, béka, zebrahal 7 növény: pl. rizs, búza, árpa, kukorica TIGR TC (Tentative Consensus) klaszterezett és összefűzött EST-szekvenciák Molecular phylogenetics 39

40 Molecular phylogenetics 40

41 Molecular phylogenetics 41

42 Molecular phylogenetics 42

43 Fehérje-mintázat, -motívum és profil-adatbázisok ADATBÁZIS VERZIÓ REKORDOK Swiss-Prot PRINTS TrEMBL Pfam PROSITE patterns INTERPRO adatbázis dec. PROSITE preprofiles N/A 131 ProDom InterPro Smart TIGRFAMs PIR SuperFamily SUPERFAMILY Molecular phylogenetics 43

44 Az INTERPRO adatbázis generálása Molecular phylogenetics 44

45 PROSITE adatbank Protein családok és domének adatbázisa Biológiailag szignifikáns: Helyek Mintázatok Profilok Ezek alapján lehet eldönteni, hogy egy adott fehérje milyen csoportba tartozik Molecular phylogenetics 45

46 Pfam (Protein families database of alignments and HMMs) Gyűjteménye a: Többszörös illesztéseknek, és a Hidden Markov modelleknek A legtöbb protein domént tartalmazza Pfam-A: Kurátorok által annotált domének Pfam-B: Automatikusan generált domének Fehérjék doménszerkezetének vizsgálata dex.shtml Molecular phylogenetics 46

47 PRINTS adatbázis Protein fingerprint -ek gyűjteménye fingerprint = konzerválódott motívumok csoportja UNIPROT-ból nyerik ki RINTS/ Molecular phylogenetics 47

48 PRODOM protein domén adatbázis Automatikus keresése a homológ doméneknek Módszer: rekurzív PSI-BLAST ent/html/home.php Molecular phylogenetics 48

49 SMART (Simple Modular Architecture Research Tool) Genetikailag mozgó domének vizsgálata Domén felépítés vizsgálata Több mint 500 domén részletes annotációja Molecular phylogenetics 49

50 TIGRFAM Protein családok gyűjteménye Többszörös illesztések Funkcionálisan rokon fehérjék azonosítása ml Molecular phylogenetics 50

51 PIR SuperFamily (PIRSF) Klasszifikációs rendszer A fehérjék teljes aminosav sorrendjének az evolúciós elemzésén alapul A családok tagjai monofiletikusak és homeomorfak Molecular phylogenetics 51

52 SUPERFAMILY Ismert szerkezetű fehérjék Hidden Markov Model profilok A SCOP adatbázisban alkalmazott szerkezeti osztályozáson alapul Molecular phylogenetics 52

53 Evolúciós adatbázisok I., Tree of Life Biológusok közös erőfeszítése egy teljes törzsfa kialakítására Molecular phylogenetics 53

54 Evolúciós adatbázisok I., Treebase Filogenetikai kapcsolatok adatbázisa Adatokat a kutatók küldik be treebase/index.html Molecular phylogenetics 54

55 3-D fehérjetérszerkezeti adatbázisok PDB (Protein Data Bank) Research Collaboratory for Structural Bioinformatics, USA kísérletesen meghatározott szerkezetek (röntgendiffrakció, NMR, MRI) MMDB NCBI: fehérje és nukleinsav; PDB egy része (elméleti modellek nélkül) EBI-MSD (~PDB) SCOP CATH EBI: 3-D szerkezetek hierarchikus osztályozása 4 szint: osztályok, gombolyok, szupercsaládok, családok) Molecular phylogenetics 55

56 Genomi adatbázisok I. NCBI 159 baktérium- és archeon genom (néhány fajból több törzs) 7 gomba, 10 egyéb eukarióta COGs (Clusters of Orthologous Groups) teljes eubaktérium és archeon, valamint élesztő genomok (jelenleg 43 teljes genom, 30 fő filogenetikai vonalból) ortológ gének csoportjai (fehérje-blast alapján) legalább 3 fajban előforduló nagyon hasonló fehérjék COGnitor program felhasználás: funkciópredikció egy adott genomból hiányzó konzervált COG - annotálatlan gén detektálása Molecular phylogenetics 56

57 Molecular phylogenetics 57

58 Molecular phylogenetics 58

59 Molecular phylogenetics 59

60 Genomi adatbázisok II. ENSEMBL (Sanger Institute, EBI) integrált genom annotációs rendszer automatikus genomannotációs csövezeték genom böngésző szabad szoftver (MySQL motor) eredetileg humán annotációra fejlesztették most: humán, (csimpánz), egér, patkány, (tyúk), zebrahal, fugu, moszkító, ecetmuslica, C. elegans, C. briggsae Molecular phylogenetics 60

61 Molecular phylogenetics 61

62 Kontig nézet Molecular phylogenetics 62

63 UCSC genom böngésző ENSEMBL amerikai alternatívája Néha frissebb az annotáció Kevesebb szervezet Új géncsalád böngésző Molecular phylogenetics 63

64 UCSC Genome Browser (példa) Molecular phylogenetics 64

65 Gén-ontológia (GO) The Gene Ontology Consortium bármely élő szervezetben megtalálható géntermék leírására hierarchikus besorolás egységes terminológia 3-féle ontológia: molekuláris funkció biológiai folyamat sejtalkotórész online: pl. Mouse Genome Initiative GO Browser GOA Molecular phylogenetics 65

66 Molecular phylogenetics 66

67 Molecular phylogenetics 67

68 NCBI adatbázisok LocusLink / RefSeq / Entrez Gene LocusLink: kiindulópont egy genetikai lókusz (pl. gén) egyedi azonosító: LocusID kapcsolt információ: pl. fenotípus, térképpozíció, homológ gének RefSeq: egyedi gének (nem redundáns) mrns és fehérje szekvenciák humán, egér, patkány, szarvasmarha, zebrahal, ecetmuslica Taxonomy taxonómiai adatbázis OMIM (Online Mendelian Inheritance in Man) humán gének és genetikai betegségek PubMed (bibliográfiai adatbázis) magában foglalja a MEDLINE adatbázist azonosító: PMID (PubMed identifier), MUID (MEDLINE unique identifier) Molecular phylogenetics 68

69 Keresés az annotációkban I. NCBI Bármilyen adatbázisrekord (Annotáció) szöveges keresés Mező 1 (pl. Locus) Mező 2 (pl. Definition) Stb. (Szekvencia) hasonlóság keresés Mező n (pl. cgagcatgcatctagtagcagcgtactac) Molecular phylogenetics 69

70 Integrált információkeresés I. NCBI Entrez NCBI (National Center of Biotechnology Information, Bethesda, USA) >20 részadatbázis Molecular phylogenetics 70

71 Molecular phylogenetics 71

72 Molecular phylogenetics 72

73 Molecular phylogenetics 73

74 Molecular phylogenetics 74

75 Molecular phylogenetics 75

76 Molecular phylogenetics 76

77 Molecular phylogenetics 77

78 Molecular phylogenetics 78

79 Molecular phylogenetics 79

80 Molecular phylogenetics 80

81 Keresés az annotációkban II. SRS Bármilyen adatbázisrekord (Annotáció) szöveges keresés Mező 1 (pl. Locus) Mező 2 (pl. Definition) Stb. (Szekvencia) hasonlóság keresés Mező n (pl. cgagcatgcatctagtagcagcgtactac) Molecular phylogenetics 81

82 Sequence Retrieval System (SRS) Adatbázis indexelő és kereső rendszer Thure Etzold kezdte el fejleszteni a 90-es évek elején Heidelbergben az EMBL-ben 1996-tól az EBI-ben 1999-től a Lion Biosciences-ben közösen az EBIvel 5.1-es verzió szabad (de a legújabb adatbázisokkal már nehéz használni) 6.0-ás verziótól akadémiai liszenszet lehet kérni 7.0-ás verziótól EMBOSS integrálva van és helyileg: Molecular phylogenetics 82

83 Mire jó az SRS? Keresés mindenfajta adatbázis annotációban Szekvenciák letöltése egy faj, vagy egy adott taxonómiai egységhez tartozó szekvenciák egy adott annotált tulajdonsághoz tartozó szekvenciák (pl. intronok, domének) adott szekvenciákhoz tartozó referenciák keresése legmegfelelőbb adatbázis keresése Molecular phylogenetics 83

84 Segítség az SRS használatához Lehet keresni a dokumentációban (természetesen az is egy adatbázis) Meglehet nézni on-line vagy le lehet tölteni PDF formátumban a teljes dokumentációt Legfontosabb az SRS User Guide SRS-t lehet Linux alá is telepíteni, ilyenkor az SRS Administrators Guide ad segítséget Természetesen minden oldalról van link Molecular phylogenetics 84

85 Mit lehet keresni az SRS segítségével? Az összes adatbázis összes mezőjében bármilyen szöveget ID, Elérési szám (accession number) Definíció Organizmus Szekvenciához kapcsolódó referencia Feature (pl. domén, kötőhely stb.) Molecular phylogenetics 85

86 Hogyan működik az SRS? Az adatbázis felbontása rekordokra és mezőkre ID TRBG361 standard; mrna; PLN; 1859 BP. AC X56734; S46826; SV X DT 12-SEP-1991 (Rel. 29, Created) DT 15-MAR-1999 (Rel. 59, Last updated, Version 9) DE Trifolium repens mrna for noncyanogenic beta-glucosidase KW beta-glucosidase. Molecular phylogenetics 86

87 Adatbázis felbontása rekordokra és mezőkre Molecular phylogenetics 87

88 Indexelés Molecular phylogenetics 88

89 SRS kezdőoldal Molecular phylogenetics 89

90 Keresés a szekvenciákban Bármilyen adatbázisrekord (Annotáció) szöveges keresés Mező 1 (pl. Locus) Mező 2 (pl. Definition) Stb. (Szekvencia) hasonlóság keresés Mező n (pl. cgagcatgcatctagtagcagcgtactac) Molecular phylogenetics 90

91 Hasonlósági keresések adatbázisokban Optimális illesztéssel: nagyon időigényes, csak célhardveren Sokprocesszoros számítógép vagy számítógép-klaszter, párhuzamos processzálás Erre a célra fejlesztett chip Heurisztikus algoritmusok használata Bizonyos elhanyagolásokkal, gyakran tapasztalati úton beállított algoritmusok, paraméterek és statisztika Sok tesztfuttatással igazolt használhatóság Sebességnövekedés bizonyos fokú érzékenységvesztés árán FASTA (W. Pearson fejlesztette) BLAST (az NCBI-nál fejlesztik; S. Altschul), PSI-BLAST Molecular phylogenetics 91

92 FASTA FASTA2 és FASTA3 (Lipman és Pearson, 1985; Pearson és Lipman, 1988; Pearson, 2000) FASTA3 programcsomag (ftp://ftp.virginia.edu/pub/fasta) Rövid (10 nukleotidnyi) keresőszekvenciák is használhatók A keresés időigénye nagyban függ az alkalmazott k-tuple értéktől Molecular phylogenetics 92

93 FASTA algoritmus (1) a kereső ( query ) és az adatbázisszekvencia között közös szavak (ktuple) keresése (2) az azonos átlón található szavak összefűzése és pontozása a helyettesítési mátrix-szal database sequence database sequence query sequence query sequence 10 legjobb szegmens: Init1 score Molecular phylogenetics 93

94 FASTA algoritmus (3) eltérő, de egy bizonyos eltoláson belüli átlók egyesítése és pontozása (helyettesítési mátrix + hézagbüntetések) (4) optimális lokális illesztés egy sávban (S-W alg.) database sequence database sequence query sequence: Initn score query sequence: Opt score Molecular phylogenetics 94

95 A FASTA3 csomag programjai Molecular phylogenetics 95

96 Mikor melyik programot használjuk? Molecular phylogenetics 96

97 FASTA a weben WWW: (EBI) (Institut Pasteur) Molecular phylogenetics 97

98 BLAST BLAST (http://www.ncbi.nlm.nih.gov/blast/) a leggyorsabb, helyben is futtatható (pl. blastp Linux PC-n is hamar lefut) gyors, lokális illesztéseket végez szekvenciaillesztésre optimalizált, nem motívumkeresésre statisztikai módszerek alkalmazásával becsüli a találatok szignifikanciáját NCBI-BLAST két verziója: (régi, nem enged hézagokat), (új, hézagokat enged: gapped BLAST ) WU-BLAST 2.0 Warren Gish (Washington University) implementációja (hézagokat enged) Molecular phylogenetics 98

99 BLAST algoritmus (Altschul et al., 1990, 1997) (1) W hosszúságú szavakból szomszédos szó lista generálása L hosszúságú kereső szekvencia Maximum L-W+1 szó (w~3 fehérjékre) Mátrix használata (PAM vagy BLOSUM, stb.) szó-lista T (threshold) pontértékű szavakból (2) Szavak adatbázis: tökéletes egyezések keresése adatbázis-szekvenciák tökéletes egyezések (3) Találatok kiterjesztése és a legjobb lokális illesztés megkeresése: HSP-k S pontértékkel kereső szekv.: adatbázis szekv.: EGDCVFDGMIGSDQGSL E C+ +G G+D GS+ EAGCLQNGQRGTDVGSV X G S D Q G S L R F D G F D V E C D G T D V G S V M D E I P N D F E C Molecular phylogenetics 99

100 BLAST algoritmus és statisztika A keresés lépései: W hosszúságú szavak ( word ) keresése találatok pontozása szubsztitúciós mátrix használatával nagy pontértékű találatok kiválasztása: HSP-k ( High scoring Segment Pairs ) HSP-k kiterjesztése mindkét irányban (szubsztitúciós mátrix használatával), amíg a szekvencia el nem fogy, vagy az egyezés már nem szignifikáns végeredmény: MSP-k ( Maximal scoring Segment Pairs ) Statisztikai szignifikanciabecslés: E érték: hasonló vagy nagyobb pontértékű találat véletlen előfordulásának várható száma; minél kisebb, annál jobb. Molecular phylogenetics 100

101 BLAST programok NCBI BLAST lokális futtatásánál a p opcióval kell megadni, pl.: blastall p blastp Molecular phylogenetics 101

102 NCBI BLAST Paraméterek: W (-W opció): blastn alapértelmezés: 11 (kompromisszum: szinte minden véletlen illeszkedést kizár, de divergált homológokét is) szűrés (-F opció): kis komplexitású régiók N-ekre vagy X-ekre cserélése a keresőszekvenciában; alapértelmezés: igen (T); blastn: DUST, többi: SEG és/vagy XNU; pontosabban is specifikálható (pl. szűrés csak a szó-lista létrehozásánál) opció: nem (F) szubsztitúciós mátrix (-M opció): BLOSUM45, BLOSUM62, BLOSUM80, PAM30, PAM70 E-határérték ( expected score threshold ) (-e opció); alapértelmezés: 10 blastn: egyező (M) és nem egyező (N) nukleotidok pontszámának aránya; alapértelmezés: M = 5, N = -4 ( M/N = 1.25; ~47 nukleotid PAM); minél nagyobb az arány, annál távolabbi szekvenciákat talál meg Molecular phylogenetics 102

103 BLAST programok WWW: NCBI-BLAST: (NCBI) (EBI) WU-BLAST: (EBI) (Institute Pasteur) (és sok más helyen, gyakran speciális adatbázisokkal, pl. fajok szerint) Lokálisan futtatható: blastall FASTA formátumú adatbázis formázása és indexelése: formatdb -i nr -o T BLAST keresés: blastall -p blastp -d nr -i query.fasta o \ out.query Molecular phylogenetics 103

104 Potenciális műtermékek, fals pozitívok Forrásai: Kis komplexitású régiók Repetitív elemek Figyelmeztető találatok (pl. Alu szekvencia) Vektor-szennyezés Megoldás: keresőszekvencia maszkolása, szűrése Kis összetételi komplexitású régiók: BLAST-ba beépítve: seg ill. xnu (aminosav), dust (nukleotid) kis komplexitású régiók, mikroszatellitek maszkolása Mikroszatellitek (SSR): Sputnik (http://abajian.net/sputnik/) mikroszatellitek (SSR) azonosítása; Windows, UNIX TRF (Tandem Repeat Finder) mikroszatellitek (SSR) azonosítása; Windows, UNIX Molecular phylogenetics 104

105 Kis komplexitású régiók szűrése SEG (fehérjékre) HILCDEVNEGDEENEDFLPS HILCXXXXXXXXXXXXFLPS DUST (nukleinsavakra) GCTCAAAAAATAAAAACACG GCTCNNNNNNNNNNNNCACG Molecular phylogenetics 105

A tárgy címe: Bioinformatika

A tárgy címe: Bioinformatika A tárgy címe: Bioinformatika Kötelezően választható tárgy IV. és V. évfolyamos biológus hallgatók számára; heti 2+3 óra Előkövetelmény: Biokémia főkollégium; genetika főkollégium; alapszintű számítógépes

Részletesebben

ADATBÁZIS-KEZELÉS - BEVEZETŐ - Tarcsi Ádám, ade@inf.elte.hu

ADATBÁZIS-KEZELÉS - BEVEZETŐ - Tarcsi Ádám, ade@inf.elte.hu ADATBÁZIS-KEZELÉS - BEVEZETŐ - Tarcsi Ádám, ade@inf.elte.hu Számonkérés 2 Papíros (90 perces) zh az utolsó gyakorlaton. Segédanyag nem használható Tematika 1. félév 3 Óra Dátum Gyakorlat 1. 2010.09.28.

Részletesebben

Bevezetés a bioinformatikába

Bevezetés a bioinformatikába Bevezetésabioinformatikába 2009 2010őszifélév,biológiaBSC,levelezőképzés BálintBalázs (balintb@brc.hu) http://biotech.szbk.u szeged.hu/ Információakurzusról I.elméletialapok(azévvégivizsgaanyaga) II.azelméletirészheztartozógyakorlatimunka(nemszámonkért)

Részletesebben

Gyakorlati bioinformatika

Gyakorlati bioinformatika Gyakorlati bioinformatika Szekvenciaillesztés PhD kurzus 2. Szekvenciaillesztés Bagossi Péter Fajtái: - egyszer ill. többszörös illesztés - globális ill. lokális illesztés Alkalmazása: - adatbázisokban

Részletesebben

SQLServer. SQLServer konfigurációk

SQLServer. SQLServer konfigurációk SQLServer 2. téma DBMS installáció SQLServer konfigurációk 1 SQLServer konfigurációk SQLServer konfigurációk Enterprise Edition Standart Edition Workgroup Edition Developer Edition Express Edition 2 Enterprise

Részletesebben

Biomassza alapú bioalkohol előállítási technológia fejlesztése metagenomikai eljárással

Biomassza alapú bioalkohol előállítási technológia fejlesztése metagenomikai eljárással Biomassza alapú bioalkohol előállítási technológia fejlesztése metagenomikai eljárással Kovács Zoltán ügyvezető DEKUT Debreceni Kutatásfejlesztési Közhasznú Nonprofit Kft. Problémadefiníció Első generációs

Részletesebben

Szekvencia összehasonlítások II. Bioinformatika és genom analízis az orvostudományban (AOGENBIG_1M)

Szekvencia összehasonlítások II. Bioinformatika és genom analízis az orvostudományban (AOGENBIG_1M) Szekvencia összehasonlítások II. Bioinformatika és genom analízis az orvostudományban (AOGENBIG_1M) Miklós István SOTE, 21. október 28. DNS-szekvenciák összeszerelése Ún. shot-gun szekvenálással lehet

Részletesebben

Tartalomjegyzék. Tartalomjegyzék 1. Az SQL nyelv 1 Az SQL DDL alapjai 2

Tartalomjegyzék. Tartalomjegyzék 1. Az SQL nyelv 1 Az SQL DDL alapjai 2 Tartalomjegyzék Tartalomjegyzék 1 Az SQL nyelv 1 Az SQL DDL alapjai 2 Adatbázis parancsok 2 Táblaparancsok 2 A táblázat létrehozása 2 A táblázat módosítása 3 A tábla törlése 3 Indextábla létrehozása 3

Részletesebben

Web-fejlesztés NGM_IN002_1

Web-fejlesztés NGM_IN002_1 Web-fejlesztés NGM_IN002_1 Szindikálás, aggregálás - RSS, Atom Tartalom betáplálás Gyakran frissül! webszájtok Új felhasználói igények el!fizetési igény az új tartalomra a tartalom újrafelhasználása eltér!

Részletesebben

Szolgáltatási csomagok I-SZERVIZ Kft. érvényes 2008. szeptember 1-től

Szolgáltatási csomagok I-SZERVIZ Kft. érvényes 2008. szeptember 1-től Szolgáltatási csomagok I-SZERVIZ Kft. érvényes 2008. szeptember 1-től HomeWeb csomagok Ha Ön szeretné családjával megosztani fotóit, vagy valamilyen családi eseményt szeretne egyszerű weboldalon megmutatni

Részletesebben

Microsoft SQL Server telepítése

Microsoft SQL Server telepítése Microsoft SQL Server telepítése Az SQL Server a Microsoft adatbázis kiszolgáló megoldása Windows operációs rendszerekre. Az SQL Server 1.0 verziója 1989-ben jelent meg, amelyet tizenegy további verzió

Részletesebben

Migráció MS Access-ről Oracle Application Express-re

<Insert Picture Here> Migráció MS Access-ről Oracle Application Express-re Migráció MS Access-ről Oracle Application Express-re Sárecz Lajos Oracle Hungary Izsák Tamás Független szakértő Program Miért migráljunk Microsoft Access-ről? Mi az az Oracle Application

Részletesebben

Webapp (in)security. Gyakori hibákról és azok kivédéséről fejlesztőknek és üzemeltetőknek egyaránt. Veres-Szentkirályi András

Webapp (in)security. Gyakori hibákról és azok kivédéséről fejlesztőknek és üzemeltetőknek egyaránt. Veres-Szentkirályi András Webapp (in)security Gyakori hibákról és azok kivédéséről fejlesztőknek és üzemeltetőknek egyaránt Veres-Szentkirályi András Rövid áttekintés Webalkalmazások fejlesztése során elkövetett leggyakoribb hibák

Részletesebben

SQLServer. DB Recovery modes

SQLServer. DB Recovery modes SQLServer 13. téma Szöveges állományok kezelése XML DB Recovery modes A DML műveletek hatékonyságának fontos eleme a naplózás módozata: - FULL Recovery mode: minden elemi művelet naplózódik költséges,

Részletesebben

Access XP alapokon Tartalomjegyzék

Access XP alapokon Tartalomjegyzék Access XP alapokon Tartalomjegyzék Kapcsolódhat a fejezetben elkészítendő raktárrendszerhez egy számlázó program?...4 1. Az Access eszközigénye, telepítése...4 Az én Office programom nem tartalmazza az

Részletesebben

Oracle EBS Dilemmák GE Capital International Budapest Bank. Slezák András

Oracle EBS Dilemmák GE Capital International Budapest Bank. Slezák András Oracle EBS Dilemmák Budapest Bank Slezák András Háttér információk Budapest Bank és GE kapcsolata 1995: a GE részesedést vásárol a Budapest Bankban 2001: a GE többségi tulajdonossá válik, megtörténik a

Részletesebben

MySQL. Elektronikus jegyzet Széchenyi István Egyetem Távközlési tanszék

MySQL. Elektronikus jegyzet Széchenyi István Egyetem Távközlési tanszék MySQL Elektronikus jegyzet Széchenyi István Egyetem Távközlési tanszék Távközlés-informatika szakirány Protokollok és Szoftverek I. Zsiga Bálint Kovács Ákos Az relációs adatbázis-kezelő rendszerekről Kis

Részletesebben

Sikerünk kulcsa: az információ De honnan lesz adatunk? Palaczk Péter

Sikerünk kulcsa: az információ De honnan lesz adatunk? Palaczk Péter Sikerünk kulcsa: az információ De honnan lesz adatunk? Palaczk Péter Bevezető az Oracle9i adattárházas újdonságaihoz Elemzési és vezetői információs igények 80:20 az adatgyűjtés javára! Adattárházak kínálta

Részletesebben

Adatbáziskezelés Delphi 5 alatt. Bese Antal 2006. http://toni.web.elte.hu/delphi

Adatbáziskezelés Delphi 5 alatt. Bese Antal 2006. http://toni.web.elte.hu/delphi Adatbáziskezelés Delphi 5 alatt Bese Antal 2006. http://toni.web.elte.hu/delphi 1. Bevezetés Számítógépes adattárolás fájlokban. Az egész adatbázist egy fájlban (Pl.: Access, Interbase,és a legtöbb SQL

Részletesebben

Vizuális programozás gyakorlat

Vizuális programozás gyakorlat Vizuális programozás gyakorlat A gyakorlat célja az entitás modell készítésének és az MS SQLEXPRESS használatának gyakorlása. A gyakorlat során egy könyvtári szoftver adatmodelljét tervezzük meg, valamint

Részletesebben

Fejlett kereső és lekérdező eszközök egy elektronikus szakfolyóirathoz (IBVS)

Fejlett kereső és lekérdező eszközök egy elektronikus szakfolyóirathoz (IBVS) Networkshop, 2008 Márc. 17 19., Dunaújváros Holl Erdődi: Fejlett kereső... 1 Fejlett kereső és lekérdező eszközök egy elektronikus szakfolyóirathoz (IBVS) Holl András Erdődi Péter MTA Konkoly Thege Miklós

Részletesebben

Component Soft 1994-2013 és tovább

Component Soft 1994-2013 és tovább Component Soft 1994-2013 és tovább IT szakemberek oktatása, tanácsadás Fő témáink: UNIX/Linux rendszerek, virtualizációs, fürtözési, tároló menedzsment és mentési technológiák Adatbázisok és middleware

Részletesebben

w w w. h a n s a g i i s k. h u 1

w w w. h a n s a g i i s k. h u 1 w w w. h a n s a g i i s k. h u Adatbázis-kezelés Adatbázisok Az adatbázisok rendezett adatok halmaza. Rendezett adatok közt sokkal gyorsabban lehet keresni! Napjainkban a relációs típusú adatbázis terjedt

Részletesebben

GEIAL Kovács László. GEIAL Kovács László GEIAL Kovács László

GEIAL Kovács László. GEIAL Kovács László GEIAL Kovács László Adatbázis rendszerek I mysql kezelése ME- GEIAL Dr. Kovács LászlL szló DBMS alternatívák probléma méretem otthoni feladat egyéni vállalkozv llalkozás kis vállalat v Közép vállalatv nagyvállalat nemzetközi

Részletesebben

Tartalomjegyzék 2. RENDSZER FELÉPÍTÉSE... 3

Tartalomjegyzék 2. RENDSZER FELÉPÍTÉSE... 3 Tartalomjegyzék 1. BEVEZETŐ... 2 2. RENDSZER FELÉPÍTÉSE... 3 2.1. FELÜLET... 3 2.2. FELHASZNÁLÓI FUNKCIÓK... 4 2.2.1. Modulok... 4 2.2.2. Előzmények... 4 2.2.3. Lekérdezés működése, beállítások... 5 2.2.4.

Részletesebben

INFORMATIKAI ALAPISMERETEK

INFORMATIKAI ALAPISMERETEK Informatikai alapismeretek középszint 0621 ÉRETTSÉGI VIZSGA 2007. május 25. INFORMATIKAI ALAPISMERETEK KÖZÉPSZINTŰ ÍRÁSBELI ÉRETTSÉGI VIZSGA JAVÍTÁSI-ÉRTÉKELÉSI ÚTMUTATÓ OKTATÁSI ÉS KULTURÁLIS MINISZTÉRIUM

Részletesebben

Office 2007 teszt. Question 1 Válassza ki, milyen típusú SmartArt objektumok NEM készíthetők az alábbiak közül!

Office 2007 teszt. Question 1 Válassza ki, milyen típusú SmartArt objektumok NEM készíthetők az alábbiak közül! Office 2007 teszt Question 1 Válassza ki, milyen típusú SmartArt objektumok NEM készíthetők az alábbiak közül! a. Hierarchia b. Kapcsolatok c. Mátrix d. Folyamatok e. Gantt-chart Question 2 Az Access 2007-ben

Részletesebben

KERESÉS A NETEN DR. KÓNYA LÁSZLÓ: KERESÉS A NETEN KERESÉS MÓDSZERE, KERESŐPROGRAMOK 2004.04.20

KERESÉS A NETEN DR. KÓNYA LÁSZLÓ: KERESÉS A NETEN KERESÉS MÓDSZERE, KERESŐPROGRAMOK 2004.04.20 INTERNET 1/42 KERESÉS A NETEN DR. KÓNYA LÁSZLÓ: KERESÉS A NETEN KERESÉS MÓDSZERE, KERESŐPROGRAMOK 2004.04.20 FORRÁS: TARR BENCE : KERESÉS AZ INTERNETEN PANEM KIADÓ, 2001 ISBN 963 545 326 4 INTERNET 2/42

Részletesebben

Szalai Ferenc szferi@gluon.hu. http://www.gluon.hu

Szalai Ferenc szferi@gluon.hu. http://www.gluon.hu Amit mindig is tudni akartál az LDAP-ról, de sosem merted megkérdezni Szalai Ferenc szferi@gluon.hu Bevezető Mi szösz az az LDAP? OpenLDAP szerver adatbázis felépítése szerver beállítása Mire jó az LDAP

Részletesebben

Oracle E-Business Suite üzemeltetés a Rába Járműipari Holding Nyrt.-nél

Oracle E-Business Suite üzemeltetés a Rába Járműipari Holding Nyrt.-nél Oracle E-Business Suite üzemeltetés a Rába Járműipari Holding Nyrt.-nél 1 Kósa György Szenior Rendszermérnök (Oracle OCP és MSSQL DBA, EBS DBA) T-Systems Magyarország Zrt. Kósa György - T-Systems Magyarország

Részletesebben

Adatbázis-kezelés. Fülep Dávid. SELECT id FROM eloadas WHERE intezmeny = sze ORDER BY unalomfaktor LIMIT 1 NGB_SZ_003_9

Adatbázis-kezelés. Fülep Dávid. SELECT id FROM eloadas WHERE intezmeny = sze ORDER BY unalomfaktor LIMIT 1 NGB_SZ_003_9 Adatbázis-kezelés Fülep Dávid SELECT id FROM eloadas WHERE intezmeny = sze ORDER BY unalomfaktor LIMIT 1 NGB_SZ_003_9 Adatbázis-kezelés Első előadás 2 Célok Válaszok a következőkhöz hasonló kérdésekre:

Részletesebben

PRECÍZ Információs füzetek

PRECÍZ Információs füzetek PRECÍZ Információs füzetek Információk, Módszerek, Ötletek és Megoldások a Precíz Integrált Ügyviteli Információs rendszerhez T14. ODBC adatkapcsolat 2009. augusztus 31. PRECÍZ integrált ügyviteli rendszer

Részletesebben

1. Gyakorlat: Telepítés: Windows Server 2008 R2 Enterprise, Core, Windows 7

1. Gyakorlat: Telepítés: Windows Server 2008 R2 Enterprise, Core, Windows 7 1. Gyakorlat: Telepítés: Windows Server 2008 R2 Enterprise, Core, Windows 7 1.1. Új virtuális gép és Windows Server 2008 R2 Enterprise alap lemez létrehozása 1.2. A differenciális lemezek és a két új virtuális

Részletesebben

Adatbázisok elleni fenyegetések rendszerezése. Fleiner Rita BMF/NIK Robothadviselés 2009

Adatbázisok elleni fenyegetések rendszerezése. Fleiner Rita BMF/NIK Robothadviselés 2009 Adatbázisok elleni fenyegetések rendszerezése Fleiner Rita BMF/NIK Robothadviselés 2009 Előadás tartalma Adatbázis biztonsággal kapcsolatos fogalmak értelmezése Rendszertani alapok Rendszerezési kategóriák

Részletesebben

Ellenőrző kérdések. 36. Ha t szintű indexet használunk, mennyi a keresési költség blokkműveletek számában mérve? (1 pont) log 2 (B(I (t) )) + t

Ellenőrző kérdések. 36. Ha t szintű indexet használunk, mennyi a keresési költség blokkműveletek számában mérve? (1 pont) log 2 (B(I (t) )) + t Ellenőrző kérdések 2. Kis dolgozat kérdései 36. Ha t szintű indexet használunk, mennyi a keresési költség blokkműveletek számában mérve? (1 pont) log 2 (B(I (t) )) + t 37. Ha t szintű indexet használunk,

Részletesebben

A kvantitatív PCR alkalmazhatósága a fertőző bronchitis vakcinák hatékonysági vizsgálatában. Derzsy Napok, Sárvár, 2011 Június 2-3.

A kvantitatív PCR alkalmazhatósága a fertőző bronchitis vakcinák hatékonysági vizsgálatában. Derzsy Napok, Sárvár, 2011 Június 2-3. A kvantitatív PCR alkalmazhatósága a fertőző bronchitis vakcinák hatékonysági vizsgálatában Pénzes Zoltán PhD, Soós Pál PhD, Nógrády Noémi PhD, Varga Mária, Jorge Chacón PhD, Zolnai Anna PhD, Nagy Zoltán

Részletesebben

Excel ODBC-ADO API. Tevékenységpontok: - DBMS telepítés. - ODBC driver telepítése. - DSN létrehozatala. -Excel-ben ADO bevonása

Excel ODBC-ADO API. Tevékenységpontok: - DBMS telepítés. - ODBC driver telepítése. - DSN létrehozatala. -Excel-ben ADO bevonása DBMS spektrum Excel ODBC-ADO API Tevékenységpontok: - DBMS telepítés - ODBC driver telepítése - DSN létrehozatala -Excel-ben ADO bevonása - ADOConnection objektum létrehozatala - Open: kapcsolat felvétel

Részletesebben

Viczián István IP Systems http://jtechlog.blogspot.hu/ JUM XIX. - 2012. szeptember 18.

Viczián István IP Systems http://jtechlog.blogspot.hu/ JUM XIX. - 2012. szeptember 18. Viczián István IP Systems http://jtechlog.blogspot.hu/ JUM XIX. - 2012. szeptember 18. Két projekt Mindkettőben folyamatirányítás Eltérő követelmények Eltérő megoldások Dokumentum gyártási folyamat Üzemeltetés

Részletesebben

Tartalom. Google szolgáltatásai. Googol Google. Története. Hogyan működik? Titka

Tartalom. Google szolgáltatásai. Googol Google. Története. Hogyan működik? Titka Tartalom Google szolgáltatásai - A keresésen túl - Tarcsi Ádám adam.tarcsi@gmail.com 2006. november 17. Google név eredete Története Titka PageRank Google trükkök Szolgáltatások Jövője InfoÉRA 2006 Tarcsi

Részletesebben

Adatbáziskezelés php-ben MySQL adatbáziskezelı rendszert használva

Adatbáziskezelés php-ben MySQL adatbáziskezelı rendszert használva Adatbáziskezelés php-ben MySQL adatbáziskezelı rendszert használva by A feladat bemutatása...1 Táblák létrehozása...1 Táblák feltöltése...2 Adatbáziskezelés php-ben...5 Csatlakozás az MySQL szerverhez

Részletesebben

RapidMiner telepítés i. RapidMiner telepítés

RapidMiner telepítés i. RapidMiner telepítés i RapidMiner telepítés ii COLLABORATORS TITLE : RapidMiner telepítés ACTION NAME DATE SIGNATURE WRITTEN BY Jeszenszky, Péter 2014. szeptember 17. REVISION HISTORY NUMBER DATE DESCRIPTION NAME iii Tartalomjegyzék

Részletesebben

Hálózati architektúrák laborgyakorlat

Hálózati architektúrák laborgyakorlat Hálózati architektúrák laborgyakorlat 8. hét Dr. Orosz Péter, Skopkó Tamás 2012. szeptember Domain Name System Mire való? IP címek helyett könnyen megjegyezhető nevek használata. (Pl. a böngésző címsorában)

Részletesebben

Az Oracle Text további lehetőségei

Az Oracle Text további lehetőségei Az Oracle Text további lehetőségei Szekció szerinti keresés Amint a könyvben már említettük, az Oracle Textben lehetőség van a keresést a dokumentum valamely meghatározott szekciójára (SECTION) korlátozni.

Részletesebben

w w w. h a n s a g i i s k. h u

w w w. h a n s a g i i s k. h u Weblapkészítés weblap: hypertext kódolású dokumentumok, melyek szöveget képet linkeket, könyvjelzőket/horgonyokat táblázatokat / szövegdobozokat és más objektumokat tartalmaznak. Kódolásuk HTML (Hypertext

Részletesebben

MozaiX Húsipari Értékesítési és Raktározási Rendszer bemutatása

MozaiX Húsipari Értékesítési és Raktározási Rendszer bemutatása MozaiX Húsipari Értékesítési és Raktározási Rendszer bemutatása Az informatikai rendszer elsősorban húsipari cégek értékesítési folyamataira nyújt teljes körű megoldást, a megrendelések feldolgozásától,

Részletesebben

INTERNET. internetwork röviden Internet /hálózatok hálózata/ 2010/2011. őszi félév

INTERNET. internetwork röviden Internet /hálózatok hálózata/ 2010/2011. őszi félév INTERNET A hatvanas években katonai megrendelésre hozták létre: ARPAnet @ (ARPA= Advanced Research Agency) A rendszer alapelve: minden gép kapcsolatot teremthet egy másik géppel az összekötő vezetékrendszer

Részletesebben

FELHASZNÁLÓI DOKUMENTÁCIÓ ÜZEMBEHELYEZÉSI KÉZIKÖNYV

FELHASZNÁLÓI DOKUMENTÁCIÓ ÜZEMBEHELYEZÉSI KÉZIKÖNYV "REGISZTER" rendszerek FELHASZNÁLÓI DOKUMENTÁCIÓ ÜZEMBEHELYEZÉSI KÉZIKÖNYV A népesség-nyilvántartás helyi rendszeréhez IBM PC számítógépre 4.0 Verzió Készítette: eközig ZRT. Készült: 2011. március Jelen

Részletesebben

GIS fejlesztés Web platformra nyílt forráskódú ingyenes eszközökkel

GIS fejlesztés Web platformra nyílt forráskódú ingyenes eszközökkel Nyugat-Magyarországi Egyetem Geoinformatikai Kar Magyar Tudomány Ünnepe 2007 A térinformatika mindenkié GIS fejlesztés Web platformra nyílt forráskódú ingyenes eszközökkel Kottyán László adjunktus Tartalom

Részletesebben

CCS Hungary, 2000 szeptember. Handling rendszer technikai specifikáció

CCS Hungary, 2000 szeptember. Handling rendszer technikai specifikáció CCS Hungary, 2000 szeptember Handling rendszer technikai specifikáció Hálózati architektúra SITA Hálózat/ Vám/ Internet/... CodecServer üzenet központ DB LA N Laptop computer RAS elérés Adatbázis szerver

Részletesebben

A humán mitokondriális genom: Evolúció, mutációk, polimorfizmusok, populációs vonatkozások. Egyed Balázs ELTE Genetikai Tanszék

A humán mitokondriális genom: Evolúció, mutációk, polimorfizmusok, populációs vonatkozások. Egyed Balázs ELTE Genetikai Tanszék A humán mitokondriális genom: Evolúció, mutációk, polimorfizmusok, populációs vonatkozások Egyed Balázs ELTE Genetikai Tanszék Endoszimbiotikus gén-transzfer (Timmis et al., 2004, Nat Rev Gen) Endoszimbiotikus

Részletesebben

AZ INFORMATIKAI ALAPISMERETEK VIZSGATÁRGY ÍRÁSBELI ÉS SZÓBELI ÉRETTSÉGI VIZSGÁIHOZ

AZ INFORMATIKAI ALAPISMERETEK VIZSGATÁRGY ÍRÁSBELI ÉS SZÓBELI ÉRETTSÉGI VIZSGÁIHOZ A dokumentum az emelt szintű érettségi vizsgán, valamint a kormányhivatalok által szervezett középszintű érettségi vizsgán választható szoftvereket tartalmazza. Az érettségit szervező középiskolák ettől

Részletesebben

Webáruház. Tisztelt Partnerünk!

Webáruház. Tisztelt Partnerünk! Tisztelt Partnerünk! Engedje meg, hogy figyelmébe ajánljuk a cégünk WEB áruházát, amely online hozzáférést biztosít a által forgalmazott katalógustermékekhez, az Ön vagy az Ön által képviselt cég részére

Részletesebben

Selling Platform Telepítési útmutató Gyakori hibák és megoldások

Selling Platform Telepítési útmutató Gyakori hibák és megoldások Selling Platform Telepítési útmutató Gyakori hibák és megoldások 265ced1609a17cf1a5979880a2ad364653895ae8 Index _ Amadeus szoftvertelepítő 3 _ Rendszerkövetelmények 3 Támogatott operációs rendszerek 3

Részletesebben

MŰSZAKI DOKUMENTÁCIÓ. Aleph WebOPAC elérhetővé tétele okostelefonon. Eötvös József Főiskola 6500 Baja, Szegedi út 2.

MŰSZAKI DOKUMENTÁCIÓ. Aleph WebOPAC elérhetővé tétele okostelefonon. Eötvös József Főiskola 6500 Baja, Szegedi út 2. Telefon: Fax: E-mail: (+36-1) 269-1642 (+36-1) 331 8479 info@ex-lh.hu www.ex-lh.hu Eötvös József Főiskola 6500 Baja, Szegedi út 2. MŰSZAKI DOKUMENTÁCIÓ Aleph WebOPAC elérhetővé tétele okostelefonon Pályázati

Részletesebben

Hamar Péter. RNS világ. Lánczos Kornél Gimnázium, Székesfehérvár, 2014. október 21. www.meetthescientist.hu 1 26

Hamar Péter. RNS világ. Lánczos Kornél Gimnázium, Székesfehérvár, 2014. október 21. www.meetthescientist.hu 1 26 Hamar Péter RNS világ Lánczos Kornél Gimnázium, Székesfehérvár, 2014. október 21. 1 26 Főszereplők: DNS -> RNS -> fehérje A kód lefordítása Dezoxy-ribo-Nuklein-Sav: DNS az élet kódja megkettőződés (replikáció)

Részletesebben

BaBér bérügyviteli rendszer telepítési segédlete 2011. év

BaBér bérügyviteli rendszer telepítési segédlete 2011. év BaBér bérügyviteli rendszer telepítési segédlete 2011. év Ajánlott konfiguráció A program hardverigénye: Konfiguráció: 2800 MHz processzor 512 Mbyte memória (RAM) / Szerver gépen 1G memória (RAM) Lézernyomtató

Részletesebben

A számítástechnika gyakorlata WIN 2000 I. Szerver, ügyfél Protokoll NT domain, Peer to Peer Internet o WWW oftp opop3, SMTP. Webmail (levelező)

A számítástechnika gyakorlata WIN 2000 I. Szerver, ügyfél Protokoll NT domain, Peer to Peer Internet o WWW oftp opop3, SMTP. Webmail (levelező) A számítástechnika gyakorlata WIN 2000 I. Szerver, ügyfél Protokoll NT domain, Peer to Peer Internet o WWW oftp opop3, SMTP Bejelentkezés Explorer (böngésző) Webmail (levelező) 2003 wi-3 1 wi-3 2 Hálózatok

Részletesebben

Átfogó megoldás a számlafolyamatok felgyorsításához ELO DocXtractor. Laczkó Kristóf ELO Digital Office Kft. Bálint András Prognax Kft.

Átfogó megoldás a számlafolyamatok felgyorsításához ELO DocXtractor. Laczkó Kristóf ELO Digital Office Kft. Bálint András Prognax Kft. Átfogó megoldás a számlafolyamatok felgyorsításához ELO DocXtractor Laczkó Kristóf ELO Digital Office Kft. Bálint András Prognax Kft. Áttekintés Struktúrált és egyéb Információk bármely forrásból dokumentumok

Részletesebben

SQL parancsok feldolgozása

SQL parancsok feldolgozása Az SQL nyelv SQL nyelv szerepe Sequental Query Language, deklaratív nyelv Halmaz orientált megközelítés, a relációs algebra műveleteinek megvalósítására Előzménye a SEQUEL (IBM) Algoritmus szerkezeteket

Részletesebben

Osztott Objektumarchitektúrák

Osztott Objektumarchitektúrák 1. Kliens szerver architektúra Osztott Objektumarchitektúrák Dr. Tick József Jól bevált architektúra Kliens-szerver szerepek rögzítettek Szerver szolgáltatást nyújt, vagy igénybe vesz Kliens csak igénybe

Részletesebben

ELEKTRONIKUS MUNKABÉRJEGYZÉK MODUL

ELEKTRONIKUS MUNKABÉRJEGYZÉK MODUL ELEKTRONIKUS MUNKABÉRJEGYZÉK MODUL nexonbér elektronikus munkabérjegyzék modul Kiszámolta már valaha, hogy mennyibe kerül egyetlen munkavállaló egyetlen havi munkabérjegyzéke (a nyomtatás, a borítékolás

Részletesebben

Indexek, tömörítés és más állatfajták

Indexek, tömörítés és más állatfajták Indexek, tömörítés és más állatfajták Lekérdezések a rendszer teljesítőképessége határán Kálmán György Miről lesz szó I. A probléma felvetése II. Lehetséges eszközök III. További lehetőségek IV. Tanulságok

Részletesebben

Projekt beszámoló. Könyvelési Szakértői Rendszer Kifejlesztése Repetitív Könyvelési Feladatok Szabályalapú Feldolgozására

Projekt beszámoló. Könyvelési Szakértői Rendszer Kifejlesztése Repetitív Könyvelési Feladatok Szabályalapú Feldolgozására Projekt beszámoló Projekt azonosítója: Projektgazda neve: Projekt címe: DAOP-1.3.1-12-2012-0081 Számviteli Innovációs Iroda Kft. Könyvelési Szakértői Rendszer Kifejlesztése Repetitív Könyvelési Feladatok

Részletesebben

Linux Linux rendszeren a Wine segédprogram segítségével telepíthető az Adobe Digital Editions.

Linux Linux rendszeren a Wine segédprogram segítségével telepíthető az Adobe Digital Editions. Az EBSCO dokumentumszolgáltatótól vásárolt e könyvek online és letöltött PDF változatban használhatóak. Kizárólag a kfki.hu domain névvel rendelkező gépekről érhetők el, egyidejűleg 1 felhasználó számára.

Részletesebben

ELO kliens funkciók összehasonlítása

ELO kliens funkciók összehasonlítása funkciók összehasonlítása összehasonlítás Java Web mobil Platform független Kliens telepítés szükséges (és Webstart) Unicode képes Vonalkód támogatása Dokumentumok egyenkénti vagy összefűzött szkennelése

Részletesebben

Elektronikus levelek. Az informatikai biztonság alapjai II.

Elektronikus levelek. Az informatikai biztonság alapjai II. Elektronikus levelek Az informatikai biztonság alapjai II. Készítette: Póserné Oláh Valéria poserne.valeria@nik.bmf.hu Miről lesz szó? Elektronikus levelek felépítése egyszerű szövegű levél felépítése

Részletesebben

2009.04.29. 2009. április 24. INFO Savaria 2009 2. 2009. április 24. INFO Savaria 2009 4. 2009. április 24. INFO Savaria 2009 3

2009.04.29. 2009. április 24. INFO Savaria 2009 2. 2009. április 24. INFO Savaria 2009 4. 2009. április 24. INFO Savaria 2009 3 Négy adatbázis-kezelı rendszer összehasonlítása webes környezetben Sterbinszky Nóra snorav@gmail.com Áttekintés Növekvı igény hatékony adatbázis- kezelıkre a világhálón Hogyan mérhetı ezek teljesítménye

Részletesebben

SDL Trados szervermegoldások. Szekeres Csaba SDL Trados partner szekeres.csaba@m-prospect.hu M-Prospect Kft.

SDL Trados szervermegoldások. Szekeres Csaba SDL Trados partner szekeres.csaba@m-prospect.hu M-Prospect Kft. SDL Trados szervermegoldások Szekeres Csaba SDL Trados partner szekeres.csaba@m-prospect.hu M-Prospect Kft. Fókuszban A fájlalapú fordítási memória korlátai SDL TM Server 2009 A fájlalapú terminológiai

Részletesebben

Levelező szerverek. Hargitai Gábor higany@sch.bme.hu 2005. november 28.

Levelező szerverek. Hargitai Gábor higany@sch.bme.hu 2005. november 28. Levelező szerverek Hargitai Gábor higany@sch.bme.hu 2005. november 28. Miről lesz szó? Protokollok SMTP POP3 IMAP4 Szerverek Bevezető Postfix Courier Hula Sympa SMTP Simple Mail Transfer Protocol 1982-ben

Részletesebben

3. Nemzetközi talajinformációs rendszerek

3. Nemzetközi talajinformációs rendszerek Magyar Tudományos Akadémia Agrártudományi Kutatóközpont Talajtani és Agrokémiai Intézet Környezetinformatikai Osztály Pásztor László: Térbeli Talajinformációs Rendszerek/ Bevezetés a digitális talajtérképezésbe

Részletesebben

SUNSITE A KLTE-N. Abstract

SUNSITE A KLTE-N. Abstract SUNSITE A KLTE-N Juhász Katalin, nyako@math.klte.hu Almási Béla, almasi@ math.klte.hu Lencse Zsolt, lencse@ math.klte.hu Szkiba Iván, szkiba@ math.klte.hu KLTE, Matematikai és Informatikai Intézet Abstract

Részletesebben

Windows hálózati adminisztráció segédlet a gyakorlati órákhoz

Windows hálózati adminisztráció segédlet a gyakorlati órákhoz Windows hálózati adminisztráció segédlet a gyakorlati órákhoz Szerver oldal: Kliens oldal: 4. Tartományvezérlő és a DNS 1. A belső hálózat konfigurálása Hozzuk létre a virtuális belső hálózatunkat. INTERNET

Részletesebben

Ügyviteli rendszerek hatékony fejlesztése Magic Xpa-val mobilos funkciókkal kiegészítve. Oktatók: Fülöp József, Smohai Ferenc, Nagy Csaba

Ügyviteli rendszerek hatékony fejlesztése Magic Xpa-val mobilos funkciókkal kiegészítve. Oktatók: Fülöp József, Smohai Ferenc, Nagy Csaba Ügyviteli rendszerek hatékony fejlesztése Magic Xpa-val mobilos funkciókkal kiegészítve Oktatók: Fülöp József, Smohai Ferenc, Nagy Csaba Inheritance beállítás Ez egy olyan beállítás, amely a modell alapján

Részletesebben

Szolgáltatás Orientált Architektúra és több felhasználós adatbázis használata OKF keretein belül. Beke Dániel

Szolgáltatás Orientált Architektúra és több felhasználós adatbázis használata OKF keretein belül. Beke Dániel Szolgáltatás Orientált Architektúra és több felhasználós adatbázis használata OKF keretein belül Beke Dániel Alap Architektúrák ESRI építőelemek Gazdag (vastag) Kliens Alkalmazások Web Alkalmazások Szolgáltatások

Részletesebben

Cisco Catalyst 3500XL switch segédlet

Cisco Catalyst 3500XL switch segédlet Cisco Catalyst 3500XL switch segédlet A leírást készítette: Török Viktor (Kapitány) GAMF mérnökinformatikus rendszergazda FOSZK hallgató, Hálózatok II. tárgy Web: http://prog.lidercfeny.hu/ Források: Medgyes

Részletesebben

Szövegbányászati rendszer fejlesztése a Magyar Elektronikus Könyvtár számára

Szövegbányászati rendszer fejlesztése a Magyar Elektronikus Könyvtár számára Szövegbányászati rendszer fejlesztése a Magyar Elektronikus Könyvtár számára Vázsonyi Miklós VÁZSONYI Informatikai és Tanácsadó Kft. BME Információ- és Tudásmenedzsment Tanszék 1/23 Tartalom A MEK jelenlegi

Részletesebben

Kedvenc Ingyenes editorok avagy milyen a programozó jobbkeze? PSPAD editor DEVPHP IDE

Kedvenc Ingyenes editorok avagy milyen a programozó jobbkeze? PSPAD editor DEVPHP IDE Kedvenc Ingyenes editorok avagy milyen a programozó jobbkeze? Az Interneten nagyon sok fizetős szoftver gyakorlatilag sz sem ér, ezért mindenkinek azt javaslom mielőtt még gyors költekezésbe kezdene nézzen

Részletesebben

5. Gyakorlat. 5.1 Hálós adatbázis modell műveleti része. NDQL, hálós lekérdező nyelv:

5. Gyakorlat. 5.1 Hálós adatbázis modell műveleti része. NDQL, hálós lekérdező nyelv: 5. Gyakorlat 5.1 Hálós adatbázis modell műveleti része NDQL, hálós lekérdező nyelv: A lekérdezés navigációs jellegű, vagyis a lekérdezés megfogalmazása során azt kell meghatározni, hogy milyen irányban

Részletesebben

Ügyviteli rendszerek hatékony fejlesztése Magic Xpa-val mobilos funkciókkal kiegészítve. Oktatók: Fülöp József, Smohai Ferenc, Nagy Csaba

Ügyviteli rendszerek hatékony fejlesztése Magic Xpa-val mobilos funkciókkal kiegészítve. Oktatók: Fülöp József, Smohai Ferenc, Nagy Csaba Ügyviteli rendszerek hatékony fejlesztése Magic Xpa-val mobilos funkciókkal kiegészítve Oktatók: Fülöp József, Smohai Ferenc, Nagy Csaba Programozás alapjai Ha egy adott adattáblára Ctrl + G t nyomunk,

Részletesebben

PartSoft Informatikai Kft. KÖNNY felhasználói kézikönyv 1 Általános információk... 2 1.1 Számítástechnikai alapok... 2 1.2 Felhasználói ismeretek...

PartSoft Informatikai Kft. KÖNNY felhasználói kézikönyv 1 Általános információk... 2 1.1 Számítástechnikai alapok... 2 1.2 Felhasználói ismeretek... 1 Általános információk... 2 1.1 Számítástechnikai alapok... 2 1.2 Felhasználói ismeretek... 2 2 Ügyfélcsoport... 2 3 Ügyfelek... 3 3.1 Váltás ügyfelek között... 4 4 Bevallások... 4 4.1 Létrehozás... 4

Részletesebben

Melyek a Windows Server 2008 R2 tiszta telepítésének (Clean Install) legfontosabb lépései?

Melyek a Windows Server 2008 R2 tiszta telepítésének (Clean Install) legfontosabb lépései? Mely Windows Server 2008 R2 kiadásra jellemzőek a következők: Maximum 32GB RAM és 4 CPU foglalatot, valamint 250 RRAS, 50 IAS és 250 RDS-GW licenszet nyújt? Web Standard Enterprise Datacenter Melyek a

Részletesebben

Felhasználói segédlet a Scopus adatbázis használatához

Felhasználói segédlet a Scopus adatbázis használatához Felhasználói segédlet a Scopus adatbázis használatához Az adatbázis elérése, regisztrálás, belépés Az adatbázis címe: http://www.scopus.com Az adatbázis csak regisztrált, jogosultsággal rendelkező intézmények,

Részletesebben

Tartalomszolgáltatási Tájékoztató

Tartalomszolgáltatási Tájékoztató Gödöllői Agrárközpont (GAK) Közhasznú Társaság Informatikai Csoport Tartalomszolgáltatási Tájékoztató 2003 / II. Kiadás Gödöllő, 2003. július 1. 1. EU AGRÁRINFO WWW.EU-INFO.HU Az EU agrár jogi szabályozásának,

Részletesebben

IBM Software Group Archiválási technológiák - tartalomkezelés Kovács László Az információ kezelésének evolúciója Struktúrált adatok kezelése '60s Alkalmazások '70s Adatbázisok alkalmazásokra optimalizálva

Részletesebben

Miért érdemes duplikált tartalmakkal és oldalakkal

Miért érdemes duplikált tartalmakkal és oldalakkal Tartalomduplikáció: liká ió Én loptam, vagy tőlem loptak? Énekes Barbara (Weboriginal Kft, ügyvezető) Az előadás témái Mit jelent a duplikáció? Miért érdemes duplikált tartalmakkal és oldalakkal foglalkozni?

Részletesebben

A L i n u x r u h á j a

A L i n u x r u h á j a A L i n u x r u h á j a Disztribúciók és azok sajátosságai Ablakkezelők DE-EFK Egészségügyi Ügyvitelszervező Szak Linux c. tantárgy 2006 I. félév D i s z t r i b ú c i ó f o g a l m a A Linux-disztribúció

Részletesebben

KIRA. KIRA rendszer. Telepítési útmutató v1

KIRA. KIRA rendszer. Telepítési útmutató v1 KIRA rendszer Telepítési útmutató v1 1. Bevezetés A dokumentáció, illetve a dokumentáció mellékleteként megtalálható állományok segítségével készíthető fel a kliens oldali számítógép a KIRA rendszer működtetésére.

Részletesebben

Hogyan növelje kritikus üzleti alkalmazásainak teljesítményét?

Hogyan növelje kritikus üzleti alkalmazásainak teljesítményét? Hogyan növelje kritikus üzleti alkalmazásainak teljesítményét? Alkalmazás archiválás EMC Forum 2013 Sepsy Zoltán Mindennapi alkalmazásaink Folyamatos változás az alkalmazás technológiákban. Kiterjedt

Részletesebben

Gyakorlati vizsgatevékenység B

Gyakorlati vizsgatevékenység B Gyakorlati vizsgatevékenység Szakképesítés azonosító száma, megnevezése: 481 04 0000 00 00 Web-programozó Vizsgarészhez rendelt követelménymodul azonosítója, megnevezése: 1189-06 Web-alkalmazás fejlesztés

Részletesebben

FEJLETT INFORMÁCIÓKERESÉSI TECHNOLÓGIA A FELSŐOKTATÁSBAN

FEJLETT INFORMÁCIÓKERESÉSI TECHNOLÓGIA A FELSŐOKTATÁSBAN FEJLETT INFORMÁCIÓKERESÉSI TECHNOLÓGIA A FELSŐOKTATÁSBAN Karácsony Gyöngyi, e-mail cím Debreceni Egyetem Jóföldi Endre, jofoldi.endre@polymeta.hu K-prog Bt. Összefoglaló Milyen problémákkal szembesülünk

Részletesebben

Adatbázisok MSc. 12. téma. Ontológia és SPARQL

Adatbázisok MSc. 12. téma. Ontológia és SPARQL Adatbázisok MSc 12. téma Ontológia és SPARQL Igény az automatikus tudáskezelése Az adat és tudáskezelés szintjei adatok összesítő adatok domain leírása következtetések tudás kontexus ismerete RDBMS OLAP

Részletesebben

EGY MÓDSZERTANI KÍSÉRLET A RAKTÁRI JEGYZÉKEK SZÁMÍTÓGÉPES MEGJELENÍTÉSE

EGY MÓDSZERTANI KÍSÉRLET A RAKTÁRI JEGYZÉKEK SZÁMÍTÓGÉPES MEGJELENÍTÉSE EGY MÓDSZERTANI KÍSÉRLET A RAKTÁRI JEGYZÉKEK SZÁMÍTÓGÉPES MEGJELENÍTÉSE Boross István MNL Veszprém Megyei Levéltára Juhász Zoltán Pannon Egyetem MNL Veszprém Megyei Levéltára, 2014. május 20. A MÓDSZERTANI

Részletesebben

INFORMATIKAI ALAPISMERETEK

INFORMATIKAI ALAPISMERETEK ÉRETTSÉGI VIZSGA 2005. május 20. INFORMATIKAI ALAPISMERETEK KÖZÉPSZINTŰ ÉRETTSÉGI VIZSGA Az írásbeli vizsga időtartama: 180 perc JAVÍTÁSI-ÉRTÉKELÉSI ÚTMUTATÓ OKTATÁSI MINISZTÉRIUM Megoldási útmutató I.

Részletesebben

Fekete Csaba Csongor Üzleti intelligencia vezető Citibank ZRt.

Fekete Csaba Csongor Üzleti intelligencia vezető Citibank ZRt. Fekete Csaba Csongor Üzleti intelligencia vezető Citibank ZRt. Tartalom BI mérföld kövek Kezdeti architektúra és kontextus Lokális Adattárház Kialakítása CRM Evolúció Üzleti Intelligencia kiaknázó eszközök

Részletesebben

DLNA- beállítási útmutató

DLNA- beállítási útmutató MAGYAR DLNA- beállítási útmutató LAN hálózati csatlakozáshoz Tapasztalja meg a valóságot AQUOS LCD-TV 2011 tavasz/nyár Oldal - 1 - LE820 - LE822 - LE814 - LE824 - LE914 - LE925 Tartalom: 1. A PC előkészítése

Részletesebben

JSF alkalmazások teljesítményhangolása JMeter és dynatrace segítségével

JSF alkalmazások teljesítményhangolása JMeter és dynatrace segítségével JSF alkalmazások teljesítményhangolása JMeter és dynatrace segítségével Bakai Balázs bakaibalazs@gmail.com http://seamplex.blogspot.hu 2013. október 9. Miről lesz szó? A JSF működése (röviden ) Terheléses

Részletesebben

Hiba bejelentés azonnal a helyszínről elvégezhető. Egységes bejelentési forma jön létre Követhető, dokumentált folyamat. Regisztráció.

Hiba bejelentés azonnal a helyszínről elvégezhető. Egységes bejelentési forma jön létre Követhető, dokumentált folyamat. Regisztráció. Ingyenes Mobil helpdesk megoldás A Mobil helpdesk egy olyan androidos felületen futó hibabejelentő, amelynek néhány alapbeállítását megadva saját mobil hibabejelentő rendszere lehet, vagy partnereinek

Részletesebben