Molekuláris biológiai adatbázisok és adatbázis keresések. Barta Endre Tóth Gábor MBK Bioinformatikai Csoport

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "Molekuláris biológiai adatbázisok és adatbázis keresések. Barta Endre Tóth Gábor MBK Bioinformatikai Csoport"

Átírás

1 Molekuláris biológiai adatbázisok és adatbázis keresések Barta Endre Tóth Gábor MBK Bioinformatikai Csoport

2 Adatbázisok: megvalósítás Szöveges adatbázis általában szekvenciális, néha indexelt megfelelő programmal indexelt bináris formába alakítható (pl. EMBOSS/dbiflat, BLAST/formatdb) flatfile emberi olvasásra is alkalmas XML (extensibe Markup Language; DTD: Document Type Definition) adattárolás és adatmegjelenítés különválik számítógépes programmal dolgozandó fel Bináris ASN.1 ( Abstract Syntax Notation 1 ) adatcsere szabvány Relációs adatbázis keresztreferenciák, logikai kapcsolatok kezelése többszörös indexelhetőség bonyolult lekérdezések lehetősége gyors hozzáférés az adatokhoz adatbáziskezelő program Molecular phylogenetics 2

3 XML formátum (példa) Molecular phylogenetics 3

4 Relációs adatbázisok szerkezete Tábla 1 Mező 1 Mező 2 Mező n Tábla 2 Mező 3 Mező 4 Mező n Egy DNS adatbanknál egyszerű, de egy nagyobb adatbanknál sokkal bonyolultabb struktúra Molecular phylogenetics 4

5 Kereszthivatkozások (táblák összekapcsolása) Tábla 1 (GenBank) Mező 1 (LOCUS) Mező n taxid pl Több rekord is mutathat ugyanarra a fajra Tábla 2 (Taxonomy) Mező 1 (taxid, pl. 3702) Mező n (fajnév) Arabidopsis thaliana Molecular phylogenetics 5

6 Szekvencia adatbázis szerkezete Tábla (pl. GenBank) Rekord 1 (Annotáció) szöveges keresés Mező 1 (pl. Locus) Mező 2 (pl. Definition) Stb. (Szekvencia) hasonlóság keresés Mező n (pl. cgagcatgcatctagtagcagcgtactac) Molecular phylogenetics 6

7 Szöveges keresés adatbázisokban Flatfile-ban keresés egy szóra, szórészletre A találat sorát (pl. UNIX grep) és környezetét látjuk csak, holott mi az egész rekordra lennénk kíváncsiak Megoldás: adatbázismotorok SQL (Simple Query Language), pl. MS Access, Oracle, MySQL stb. ENSEMBL, UCSC (MySQL) EMBL, InterPro (Oracle) Saját motor ACEDB SRS (icarus) Molecular phylogenetics 7

8 Keresés alapfilozófiája SQL: SELECT * (összes olyan rekord) FROM tábla (pl. GenBank) WHERE mező1 CONTAINS/SIMILAR/IDENTICAL (LIKE) valami AND SORT BY DISPLAY stb. Ezeket össze lehet fűzni Pl. keressük az összes burgonya szekvenciát SELECT * FROM GenBank WHERE OS= Solanum tuberosum Molecular phylogenetics 8

9 Dinamikus weboldalak Megadjuk, hogy mit akarunk keresni Kiválasztjuk, hogy miben A szerver ezt átalakítja pl. egy SQL paranccsá (sokszor ezt meg is lehet nézni) Az SQL parancsot végrehajtja egy vagy több adatbázison (ezek lehetnek különböző szervereken) A kapott eredményt on-the-fly átalakítja és megjeleníti a kliens böngészőn Molecular phylogenetics 9

10 Keresési stratégiák Megfelelő kulcsszavak kiválasztása Szélesebbtől a szűkebb fele 2 legfontosabb hiba: Túl sok találat Túl kevés találat Általában mindegy hogy kisbetű vagy nagybetű Kifejezéseket idézőjelbe Logikai kifejezések használata a AND b = akkor, ha mindkettő megvan az adott rekordban a OR b = bármelyikben megvan a BUT(AND)NOT b = a benne van, de b nincs Molecular phylogenetics 10

11 Molekuláris biológiai adatbázisok típusai Elsődleges adatbázisok DNS (RNS) adatbázisok (International Nucleotide Sequence Database Collaboration) EMBL (European Bioinformatics Institute, EBI) GenBank (National Center for Biotechnology Information, NCBI) DDBJ (DNA DataBank of Japan) (pl. térszerkezeti adatbázisok) Másodlagos v. származtatott adatbázisok Fehérje adatbankok Motívum adatbankok Egyéb (nem szekvencia) adatbázisok (Nucleic Acids Res. januári első száma) Molecular phylogenetics 11

12 Molecular phylogenetics 12

13 Molecular phylogenetics 13

14 Elsődleges adatbázisok Mi a közös a 3 elsődleges adatbankban? International Nucleotide Sequence Database Collaboration adatcsere naponta taxonómia projekt azonos accession number közös feature table Elég eggyel foglalkozni, főbb adatokban nincs különbség Eltérő adatbázis-szerkezet/formátum formátumkonverzió: pl. readseq (UNIX), seqret (EMBOSS), ForCon (Windows) Molecular phylogenetics 14

15 Adatbázisok története Honnan jönnek az adatok? Irodalomban közölt adatok kézi bevitele Papíron beküldött szekvenciák (pl. GCG-ben Submission form ) Floppy Csak akkor fogadták el a cikket, ha a benne lévő szekvenciát már beküldték valamelyik adatbankba, innentől adatbankok szinkronizálása Internet (WWW, ) egyedileg a kutatók által nagyobb adagokban a szekvenáló központokból Molecular phylogenetics 15

16 Adatbázisok és a tárolókapacitás növekedése (MBK vs. EMBL) 1990: MicroVax szerver 2x 160 Mbyte HDD 50 Mbp 1993: SUN SparcServer x 512 Mbyte HDD 150 Mbp 1997: SUN Ultra Enterprise II 4x 9 Gbyte HDD 1 Gbp 2002: SUN Fire V480 8x 180Gbyte HDD 38 Gbp Szekvencia + annotáció + index: ~140 Gbyte (2004) Molecular phylogenetics 16

17 Molecular phylogenetics 17

18 Adatbázisok exponenciális növekedése EMBL: rekordok száma (millió) EMBL: nukleotidok száma (gigabázis) Molecular phylogenetics 18

19 Adatbázisok szerkezete Úgynevezett flatfile formátum EMBL: 64,8 Gb 38,3 millió rekord ( ) (WGS szekcióval együtt) GenBank Release 140 (2004. február) 32,6 millió szekvencia 37,9 milliárd nukleotid (37,9 gigabázis) ~127 Gbyte (indexekkel együtt ~143 GByte) Szekciók/divíziók Rendszertani kategóriák alapján De inkább ahogy történelmileg alakult Rekordok (vagy entry -k) Mezők Annotáció Szekvencia Molecular phylogenetics 19

20 EMBL szekciók Eredeti felosztás: Pl ben vírusok, prokarióták, eukarióták stb. Release 18, february 1989 Division Entries Nucleotides Artificial Chloroplast Genetic elements Mitochondrial Prokaryotic Viral/Phage Eukaryotic Unclassified Unannotated Total Nagy mennyiségű szekvenálás újabb szekciók bevezetése (pl. EST, HTG, GSS stb.), valamint egyes szekciók felosztása vált szükségessé Molecular phylogenetics 20

21 Főbb EMBL szekciók I. EST: expressed sequence tag (cdns részl. szekv.) STS: sequence tagged site (PCR) GSS: genome survey sequences (random genomi) HTG: high throughput genomic (unfinished) WGS: whole genome shotgun PLN: növények FUN: gombák PRO: prokarióta ORG: organellum VRL: vírus PHG: bakteriofág PAT: szabadalommal védett SYN: szintetikus Molecular phylogenetics 21

22 Főbb EMBL szekciók II. HUM: humán MUS: egér ROD: egyéb rágcsáló MAM: egyéb emlős VRT: egyéb gerinces INV: gerinctelen Molecular phylogenetics 22

23 Különböző EMBL szekciók mérete EMBL Release 78 EST HTG Molecular phylogenetics 23

24 EMBL: megoszlás fajok szerint (első 10) Nukleotidok száma: ecetmuslica egyéb kutya csimpánz ember patkány egér Molecular phylogenetics 24

25 Egy EMBL rekord (részlet) ID HSCYCLOX standard; mrna; HUM; 3387 BP. XX AC M90100; XX SV M XX DT 30-MAR-1992 (Rel. 31, Created) DT 04-MAR-2000 (Rel. 63, Last updated, Version 7) XX DE Homo sapiens cyclooxygenase-2 (Cox-2) mrna, complete cds. XX KW cyclooxygenase-2; prostaglandin synthase. XX OS Homo sapiens (human) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Primates; Catarrhini; Hominidae; Homo. XX RN [1] RP RX MEDLINE; RX PUBMED; RA Hla T., Neilson K.; RT "Human cyclooxygenase-2 cdna"; RL Proc. Natl. Acad. Sci. U.S.A. 89(16): (1992). XX DR GOA; P DR SWISS-PROT; P35354; PGH2_HUMAN. XX FH Key Location/Qualifiers FH FT source FT /db_xref="taxon:9606" FT /mol_type="mrna" FT /organism="homo sapiens" FT /cell_type="endothelial" FT /tissue_type="umbilical vein" Molecular phylogenetics 25

26 Egy EMBL rekord (folytatás) FT 5'UTR FT /gene="cox-2" FT CDS FT /codon_start=1 FT /db_xref="goa:p35354" FT /db_xref="swiss-prot:p35354" FT /gene="cox-2" FT /EC_number=" " FT /product="cyclooxygenase-2" FT /protein_id="aaa " FT /translation="mlaralllcavlalshtanpccshpcqnrgvcmsvgfdqykcdct FT RTGFYGENCSTPEFLTRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLT FT... FT KGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKT FT VTINASSSRSGLDDINPTVLLKERSTEL" FT sig_peptide FT /gene="cox-2" FT mat_peptide FT /gene="cox-2" FT /EC_number=" " FT /product="cyclooxygenase-2" FT 3'UTR FT /gene="cox-2" FT polya_signal FT /gene="cox-2" XX SQ Sequence 3387 BP; 1010 A; 712 C; 633 G; 1032 T; 0 other; gtccaggaac tcctcagcag cgcctccttc agctccacag ccagacgccc tcagacagca 60 aagcctaccc ccgcgccgcg ccctgcccgc cgctgcgatg ctcgcccgcg ccctgctgct tacctgaact tttgcaagtt ttcaggtaaa cctcagctca ggactgctat ttagctcctc 3360 ttaagaagat taaaaaaaaa aaaaaag 3387 // Molecular phylogenetics 26

27 Főbb mezők az EMBL adatbankban ID egyedi azonosító, (entryname dataclass; molecule; division; sequencelength BP.) AC accession number, változatlan, erre kell hivatkozni SV szekvencia verzió DT létrehozás, módosítás ideje DE description, a szekvencia rövid leírása KW kulcsszavak O? teljes taxonómiai besorolás R? referenciák DR adatbázis keresztreferenciák CC megjegyzések FT feature table: a szekvencia egy-egy részének a tulajdonsága XX üres, csak térkitöltő SQ szekvencia // rekord vége Molecular phylogenetics 27

28 Annotáció: EMBL vs. GenBank EMBL: ID egyedi azonosító AC egyedi azonosító! = GenBank ACCESSION SV entry verzió (volt: NI) DE rövid leírás OS faj OC taxonómiai besorolás FT feature table : tulajdonság/pozíció FT CDS kódoló szekvencia (PID) GenBank: LOCUS kihalóban? formátum miatt marad ACCESSION egyedi! = EMBL AC VERSION entry verzió * GI = EMBL NI DEFINITION rövid leírás SOURCE faj triviális neve ORGANISM faj, taxonómia FEATURES feature table tulajdonság/pozíció CDS kódoló szekvencia /protein_id /db_xref tr. fehérje GI No. * Accession.Version GI: NCBI belső azonosító (ld. BLAST DB) Molecular phylogenetics 28

29 Egy GenBank rekord (részlet) LOCUS HUMCYCLOX 3387 bp mrna linear PRI 31-DEC-1994 DEFINITION Homo sapiens cyclooxygenase-2 (Cox-2) mrna, complete cds. ACCESSION M90100 VERSION M GI: KEYWORDS cyclooxygenase-2; prostaglandin synthase. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Primates; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 3387) AUTHORS Hla,T. and Neilson,K. TITLE Human cyclooxygenase-2 cdna JOURNAL Proc. Natl. Acad. Sci. U.S.A. 89 (16), (1992) MEDLINE PUBMED COMMENT Original source text: Homo sapiens umbilical vein cdna to mrna. FEATURES Location/Qualifiers source /organism="homo sapiens" /mol_type="mrna" /db_xref="taxon:9606" /cell_type="endothelial" /tissue_type="umbilical vein" gene /gene="cox-2" 5'UTR /gene="cox-2" Molecular phylogenetics 29

30 Egy GenBank rekord (folytatás) CDS /gene="cox-2" /EC_number=" " /codon_start=1 /product="cyclooxygenase-2" /protein_id="aaa " /db_xref="gi:181254" /translation="mlaralllcavlalshtanpccshpcqnrgvcmsvgfdqykcdc TRTGFYGENCSTPEFLTRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYV... VEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKGCPFTSF SVPDPELIKTVTINASSSRSGLDDINPTVLLKERSTEL" sig_peptide /gene="cox-2" mat_peptide /gene="cox-2" /product="cyclooxygenase-2" /EC_number=" " 3'UTR /gene="cox-2" polya_signal /gene="cox-2" BASE COUNT 1010 a 712 c 633 g 1032 t ORIGIN 1 gtccaggaac tcctcagcag cgcctccttc agctccacag ccagacgccc tcagacagca 61 aagcctaccc ccgcgccgcg ccctgcccgc cgctgcgatg ctcgcccgcg ccctgctgct tacctgaact tttgcaagtt ttcaggtaaa cctcagctca ggactgctat ttagctcctc 3361 ttaagaagat taaaaaaaaa aaaaaag // Molecular phylogenetics 30

31 EMBL adatbázis fejlődése EMBL Sequence Version Archive Nem csak az adatok, hanem az adatbázis szerkezete is folyamatosan változik elsősorban a feature table új keresztreferenciák más adatbázisokkal Molecular phylogenetics 31

32 Szekvencia-beküldés az adatbankokba EMBL: WEBin (http://www.ebi.ac.uk/submission/webin.html) GenBank: BankIt (http://www.ncbi.nlm.nih.gov/bankit/index.html) EMBL/GenBank: Sequin (lokálisan futó PC-s program) (ftp://ftp.ebi.ac.uk/pub/software/sequin/) Molecular phylogenetics 32

33 WEBIN Molecular phylogenetics 33

34 Molecular phylogenetics 34

35 Fehérjeszekvencia adatbázisok I. Swiss-Prot Kollaborációban készíti a SIB és az EBI Protein tudásbázis (ExPASy = Expert Protein Analysis System) Legjobban annotált adatbázis (kézi annotáció) Jó keresztreferenciák Non-profit kutatóknak ingyenes EMBL-hez hasonló adatbázis-szerkezet Szekvenciák lassú megjelenése TrEMBL Translated EMBL Automatikusan annotált SP-TrEMBL és REM-TrEMBL Molecular phylogenetics 35

36 Fehérjeszekvencia adatbázisok II. PIR (Protein Identification Resource) PIR-PSD Formátum: NBRF/PIR Kézi annotáció Keresztreferenciák (SWISS-PROT jobb!) Szupercsalád-besorolás 4 szekció: PIR1, PIR2, PIR3, PIR4 (legjobban annotált: PIR1) Megszűnik beolvadt az UniProt adatbázisba Genpept Lefordított GenBank CDS-ek (NCBI) Mint TrEMBL Molecular phylogenetics 36

37 Fehérjeszekvencia adatbázisok III. Universal Protein Resource (UniProt) Az EBI/SIB Swiss-Prot + TrEMBL és a PIR-PSD egyesítésével létrehozott adatbank EBI + SIB + PIR UniProt Consortium (2002) Három adatbázisréteg: UniProt Archive (UniParc) az összes publikus fehérjeszekvencia (nem redundáns) UniProt Knowledgebase (UniProt) megbízhatóan, konzisztensen és gazdagon annotált központi fehérjeszekvencia-adatbázis UniProt Non-redundant Reference (UniRef) kondenzált szekvenciakészlet UniProt tudásbázis: két rész kézzel annotált rekordok: Swiss-Prot (2004 végéig licenszköteles) számítógéppel elemzett rekordok (kézi annotáció előtt): TrEMBL UniRef UniRef100 (=UniProt), UniRef90, UniRef50 Molecular phylogenetics 37

38 Egy UniProt (Swiss-Prot) rekord ID AHA1_HUMAN STANDARD; PRT; 338 AA. AC O95433; Q96IL6; Q9P060; DT 16-OCT-2001 (Rel. 40, Created) DT 16-OCT-2001 (Rel. 40, Last sequence update) DT 15-SEP-2003 (Rel. 42, Last annotation update) DE Activator of 90 kda heat shock protein ATPase homolog 1 (AHA1) (p38) DE (HSPC322). GN AHSA1 OR C14ORF3. OS Homo sapiens (Human). OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; OC Mammalia; Eutheria; Primates; Catarrhini; Hominidae; Homo. OX NCBI_TaxID=9606; RN [1] RP SEQUENCE FROM N.A. RA Michaud J., Chrast R., Rossier C., Papassavas M.P., Antonarakis S.E., RA Scott H.S.; RT "Isolation of a novel gene underexpressed in Down syndrome."; RL Submitted (JUN-1999) to the EMBL/GenBank/DDBJ databases. DR EMBL; AF111168; AAD ; -. DR EMBL; AJ243310; CAB ; -. DR EMBL; AF164791; AAF ; -. DR EMBL; BC000321; AAH ; -. DR EMBL; BC007398; AAH ; ALT_INIT. DR EMBL; AF161440; AAF ; -. DR PIR; JC7769; JC7769. DR Genew; HGNC:1189; AHSA1. DR InterPro; IPR007821; DUF704. DR Pfam; PF05146; DUF704; 1. FT CONFLICT EA -> CL (IN REF. 4). SQ SEQUENCE 338 AA; MW; E6B686DDD8D7D729 CRC64; MAKWGEGDPR WIVEERADAT NVNNWHWTER DASNWSTDKL KTLFLAVQVQ NEEGKCEVTE VSKLDGEASI NNRKGKLIFF YEWSVKLNWT GTSKSGVQYK GHVEIPNLSD ENSVDEVEIS VSLAKDEPDT NLVALMKEEG VKLLREAMGI YISTLKTEFT QGMILPTMNG ESVDPVGQPA LKTEERKAKP APSKTQARPV GVKIPTCKIT LKETFLTSPE ELYRVFTTQE LVQAFTHAPA TLEADRGGKF HMVDGNVSGE FTDLVPEKHI VMKWRFKSWP EGHFATITLT FIDKNGETEL CMEGRGIPAP EEERTRQGWQ RYYFEGIKQT FGYGARLF // Molecular phylogenetics 38

39 Nem redundáns adatbázisok NCBI NRDB egyesített GenPept, PDB szekvenciák, SWISS-PROT, PIR nem azonos (!) fehérjék (polimorfizmus és szekvenálási hibák miatt redundáns) nr: indexelt BLAST formátumban letölthető OWL (http://www.bioinf.man.ac.uk/dbbrowser/owl/) összetett, nem redundáns fehérje adatbázis egyetlen aminosavban eltérő szekvenciák közül csak 1 marad prioritási sorrend: SWISS-PROT, PIR1-PIR4, GenPept, NRL-3D NCBI UniGene egyedi gének átfedő EST-k klaszterezésével 10 állat: pl. humán, egér, patkány, szarvasmarha, béka, zebrahal 7 növény: pl. rizs, búza, árpa, kukorica TIGR TC (Tentative Consensus) klaszterezett és összefűzött EST-szekvenciák Molecular phylogenetics 39

40 Molecular phylogenetics 40

41 Molecular phylogenetics 41

42 Molecular phylogenetics 42

43 Fehérje-mintázat, -motívum és profil-adatbázisok ADATBÁZIS VERZIÓ REKORDOK Swiss-Prot PRINTS TrEMBL Pfam PROSITE patterns INTERPRO adatbázis dec. PROSITE preprofiles N/A 131 ProDom InterPro Smart TIGRFAMs PIR SuperFamily SUPERFAMILY Molecular phylogenetics 43

44 Az INTERPRO adatbázis generálása Molecular phylogenetics 44

45 PROSITE adatbank Protein családok és domének adatbázisa Biológiailag szignifikáns: Helyek Mintázatok Profilok Ezek alapján lehet eldönteni, hogy egy adott fehérje milyen csoportba tartozik Molecular phylogenetics 45

46 Pfam (Protein families database of alignments and HMMs) Gyűjteménye a: Többszörös illesztéseknek, és a Hidden Markov modelleknek A legtöbb protein domént tartalmazza Pfam-A: Kurátorok által annotált domének Pfam-B: Automatikusan generált domének Fehérjék doménszerkezetének vizsgálata dex.shtml Molecular phylogenetics 46

47 PRINTS adatbázis Protein fingerprint -ek gyűjteménye fingerprint = konzerválódott motívumok csoportja UNIPROT-ból nyerik ki RINTS/ Molecular phylogenetics 47

48 PRODOM protein domén adatbázis Automatikus keresése a homológ doméneknek Módszer: rekurzív PSI-BLAST ent/html/home.php Molecular phylogenetics 48

49 SMART (Simple Modular Architecture Research Tool) Genetikailag mozgó domének vizsgálata Domén felépítés vizsgálata Több mint 500 domén részletes annotációja Molecular phylogenetics 49

50 TIGRFAM Protein családok gyűjteménye Többszörös illesztések Funkcionálisan rokon fehérjék azonosítása ml Molecular phylogenetics 50

51 PIR SuperFamily (PIRSF) Klasszifikációs rendszer A fehérjék teljes aminosav sorrendjének az evolúciós elemzésén alapul A családok tagjai monofiletikusak és homeomorfak Molecular phylogenetics 51

52 SUPERFAMILY Ismert szerkezetű fehérjék Hidden Markov Model profilok A SCOP adatbázisban alkalmazott szerkezeti osztályozáson alapul Molecular phylogenetics 52

53 Evolúciós adatbázisok I., Tree of Life Biológusok közös erőfeszítése egy teljes törzsfa kialakítására Molecular phylogenetics 53

54 Evolúciós adatbázisok I., Treebase Filogenetikai kapcsolatok adatbázisa Adatokat a kutatók küldik be treebase/index.html Molecular phylogenetics 54

55 3-D fehérjetérszerkezeti adatbázisok PDB (Protein Data Bank) Research Collaboratory for Structural Bioinformatics, USA kísérletesen meghatározott szerkezetek (röntgendiffrakció, NMR, MRI) MMDB NCBI: fehérje és nukleinsav; PDB egy része (elméleti modellek nélkül) EBI-MSD (~PDB) SCOP CATH EBI: 3-D szerkezetek hierarchikus osztályozása 4 szint: osztályok, gombolyok, szupercsaládok, családok) Molecular phylogenetics 55

56 Genomi adatbázisok I. NCBI 159 baktérium- és archeon genom (néhány fajból több törzs) 7 gomba, 10 egyéb eukarióta COGs (Clusters of Orthologous Groups) teljes eubaktérium és archeon, valamint élesztő genomok (jelenleg 43 teljes genom, 30 fő filogenetikai vonalból) ortológ gének csoportjai (fehérje-blast alapján) legalább 3 fajban előforduló nagyon hasonló fehérjék COGnitor program felhasználás: funkciópredikció egy adott genomból hiányzó konzervált COG - annotálatlan gén detektálása Molecular phylogenetics 56

57 Molecular phylogenetics 57

58 Molecular phylogenetics 58

59 Molecular phylogenetics 59

60 Genomi adatbázisok II. ENSEMBL (Sanger Institute, EBI) integrált genom annotációs rendszer automatikus genomannotációs csövezeték genom böngésző szabad szoftver (MySQL motor) eredetileg humán annotációra fejlesztették most: humán, (csimpánz), egér, patkány, (tyúk), zebrahal, fugu, moszkító, ecetmuslica, C. elegans, C. briggsae Molecular phylogenetics 60

61 Molecular phylogenetics 61

62 Kontig nézet Molecular phylogenetics 62

63 UCSC genom böngésző ENSEMBL amerikai alternatívája Néha frissebb az annotáció Kevesebb szervezet Új géncsalád böngésző Molecular phylogenetics 63

64 UCSC Genome Browser (példa) Molecular phylogenetics 64

65 Gén-ontológia (GO) The Gene Ontology Consortium bármely élő szervezetben megtalálható géntermék leírására hierarchikus besorolás egységes terminológia 3-féle ontológia: molekuláris funkció biológiai folyamat sejtalkotórész online: pl. Mouse Genome Initiative GO Browser GOA Molecular phylogenetics 65

66 Molecular phylogenetics 66

67 Molecular phylogenetics 67

68 NCBI adatbázisok LocusLink / RefSeq / Entrez Gene LocusLink: kiindulópont egy genetikai lókusz (pl. gén) egyedi azonosító: LocusID kapcsolt információ: pl. fenotípus, térképpozíció, homológ gének RefSeq: egyedi gének (nem redundáns) mrns és fehérje szekvenciák humán, egér, patkány, szarvasmarha, zebrahal, ecetmuslica Taxonomy taxonómiai adatbázis OMIM (Online Mendelian Inheritance in Man) humán gének és genetikai betegségek PubMed (bibliográfiai adatbázis) magában foglalja a MEDLINE adatbázist azonosító: PMID (PubMed identifier), MUID (MEDLINE unique identifier) Molecular phylogenetics 68

69 Keresés az annotációkban I. NCBI Bármilyen adatbázisrekord (Annotáció) szöveges keresés Mező 1 (pl. Locus) Mező 2 (pl. Definition) Stb. (Szekvencia) hasonlóság keresés Mező n (pl. cgagcatgcatctagtagcagcgtactac) Molecular phylogenetics 69

70 Integrált információkeresés I. NCBI Entrez NCBI (National Center of Biotechnology Information, Bethesda, USA) >20 részadatbázis Molecular phylogenetics 70

71 Molecular phylogenetics 71

72 Molecular phylogenetics 72

73 Molecular phylogenetics 73

74 Molecular phylogenetics 74

75 Molecular phylogenetics 75

76 Molecular phylogenetics 76

77 Molecular phylogenetics 77

78 Molecular phylogenetics 78

79 Molecular phylogenetics 79

80 Molecular phylogenetics 80

81 Keresés az annotációkban II. SRS Bármilyen adatbázisrekord (Annotáció) szöveges keresés Mező 1 (pl. Locus) Mező 2 (pl. Definition) Stb. (Szekvencia) hasonlóság keresés Mező n (pl. cgagcatgcatctagtagcagcgtactac) Molecular phylogenetics 81

82 Sequence Retrieval System (SRS) Adatbázis indexelő és kereső rendszer Thure Etzold kezdte el fejleszteni a 90-es évek elején Heidelbergben az EMBL-ben 1996-tól az EBI-ben 1999-től a Lion Biosciences-ben közösen az EBIvel 5.1-es verzió szabad (de a legújabb adatbázisokkal már nehéz használni) 6.0-ás verziótól akadémiai liszenszet lehet kérni 7.0-ás verziótól EMBOSS integrálva van és helyileg: Molecular phylogenetics 82

83 Mire jó az SRS? Keresés mindenfajta adatbázis annotációban Szekvenciák letöltése egy faj, vagy egy adott taxonómiai egységhez tartozó szekvenciák egy adott annotált tulajdonsághoz tartozó szekvenciák (pl. intronok, domének) adott szekvenciákhoz tartozó referenciák keresése legmegfelelőbb adatbázis keresése Molecular phylogenetics 83

84 Segítség az SRS használatához Lehet keresni a dokumentációban (természetesen az is egy adatbázis) Meglehet nézni on-line vagy le lehet tölteni PDF formátumban a teljes dokumentációt Legfontosabb az SRS User Guide SRS-t lehet Linux alá is telepíteni, ilyenkor az SRS Administrators Guide ad segítséget Természetesen minden oldalról van link Molecular phylogenetics 84

85 Mit lehet keresni az SRS segítségével? Az összes adatbázis összes mezőjében bármilyen szöveget ID, Elérési szám (accession number) Definíció Organizmus Szekvenciához kapcsolódó referencia Feature (pl. domén, kötőhely stb.) Molecular phylogenetics 85

86 Hogyan működik az SRS? Az adatbázis felbontása rekordokra és mezőkre ID TRBG361 standard; mrna; PLN; 1859 BP. AC X56734; S46826; SV X DT 12-SEP-1991 (Rel. 29, Created) DT 15-MAR-1999 (Rel. 59, Last updated, Version 9) DE Trifolium repens mrna for noncyanogenic beta-glucosidase KW beta-glucosidase. Molecular phylogenetics 86

87 Adatbázis felbontása rekordokra és mezőkre Molecular phylogenetics 87

88 Indexelés Molecular phylogenetics 88

89 SRS kezdőoldal Molecular phylogenetics 89

90 Keresés a szekvenciákban Bármilyen adatbázisrekord (Annotáció) szöveges keresés Mező 1 (pl. Locus) Mező 2 (pl. Definition) Stb. (Szekvencia) hasonlóság keresés Mező n (pl. cgagcatgcatctagtagcagcgtactac) Molecular phylogenetics 90

91 Hasonlósági keresések adatbázisokban Optimális illesztéssel: nagyon időigényes, csak célhardveren Sokprocesszoros számítógép vagy számítógép-klaszter, párhuzamos processzálás Erre a célra fejlesztett chip Heurisztikus algoritmusok használata Bizonyos elhanyagolásokkal, gyakran tapasztalati úton beállított algoritmusok, paraméterek és statisztika Sok tesztfuttatással igazolt használhatóság Sebességnövekedés bizonyos fokú érzékenységvesztés árán FASTA (W. Pearson fejlesztette) BLAST (az NCBI-nál fejlesztik; S. Altschul), PSI-BLAST Molecular phylogenetics 91

92 FASTA FASTA2 és FASTA3 (Lipman és Pearson, 1985; Pearson és Lipman, 1988; Pearson, 2000) FASTA3 programcsomag (ftp://ftp.virginia.edu/pub/fasta) Rövid (10 nukleotidnyi) keresőszekvenciák is használhatók A keresés időigénye nagyban függ az alkalmazott k-tuple értéktől Molecular phylogenetics 92

93 FASTA algoritmus (1) a kereső ( query ) és az adatbázisszekvencia között közös szavak (ktuple) keresése (2) az azonos átlón található szavak összefűzése és pontozása a helyettesítési mátrix-szal database sequence database sequence query sequence query sequence 10 legjobb szegmens: Init1 score Molecular phylogenetics 93

94 FASTA algoritmus (3) eltérő, de egy bizonyos eltoláson belüli átlók egyesítése és pontozása (helyettesítési mátrix + hézagbüntetések) (4) optimális lokális illesztés egy sávban (S-W alg.) database sequence database sequence query sequence: Initn score query sequence: Opt score Molecular phylogenetics 94

95 A FASTA3 csomag programjai Molecular phylogenetics 95

96 Mikor melyik programot használjuk? Molecular phylogenetics 96

97 FASTA a weben WWW: (EBI) (Institut Pasteur) Molecular phylogenetics 97

98 BLAST BLAST (http://www.ncbi.nlm.nih.gov/blast/) a leggyorsabb, helyben is futtatható (pl. blastp Linux PC-n is hamar lefut) gyors, lokális illesztéseket végez szekvenciaillesztésre optimalizált, nem motívumkeresésre statisztikai módszerek alkalmazásával becsüli a találatok szignifikanciáját NCBI-BLAST két verziója: (régi, nem enged hézagokat), (új, hézagokat enged: gapped BLAST ) WU-BLAST 2.0 Warren Gish (Washington University) implementációja (hézagokat enged) Molecular phylogenetics 98

99 BLAST algoritmus (Altschul et al., 1990, 1997) (1) W hosszúságú szavakból szomszédos szó lista generálása L hosszúságú kereső szekvencia Maximum L-W+1 szó (w~3 fehérjékre) Mátrix használata (PAM vagy BLOSUM, stb.) szó-lista T (threshold) pontértékű szavakból (2) Szavak adatbázis: tökéletes egyezések keresése adatbázis-szekvenciák tökéletes egyezések (3) Találatok kiterjesztése és a legjobb lokális illesztés megkeresése: HSP-k S pontértékkel kereső szekv.: adatbázis szekv.: EGDCVFDGMIGSDQGSL E C+ +G G+D GS+ EAGCLQNGQRGTDVGSV X G S D Q G S L R F D G F D V E C D G T D V G S V M D E I P N D F E C Molecular phylogenetics 99

100 BLAST algoritmus és statisztika A keresés lépései: W hosszúságú szavak ( word ) keresése találatok pontozása szubsztitúciós mátrix használatával nagy pontértékű találatok kiválasztása: HSP-k ( High scoring Segment Pairs ) HSP-k kiterjesztése mindkét irányban (szubsztitúciós mátrix használatával), amíg a szekvencia el nem fogy, vagy az egyezés már nem szignifikáns végeredmény: MSP-k ( Maximal scoring Segment Pairs ) Statisztikai szignifikanciabecslés: E érték: hasonló vagy nagyobb pontértékű találat véletlen előfordulásának várható száma; minél kisebb, annál jobb. Molecular phylogenetics 100

101 BLAST programok NCBI BLAST lokális futtatásánál a p opcióval kell megadni, pl.: blastall p blastp Molecular phylogenetics 101

102 NCBI BLAST Paraméterek: W (-W opció): blastn alapértelmezés: 11 (kompromisszum: szinte minden véletlen illeszkedést kizár, de divergált homológokét is) szűrés (-F opció): kis komplexitású régiók N-ekre vagy X-ekre cserélése a keresőszekvenciában; alapértelmezés: igen (T); blastn: DUST, többi: SEG és/vagy XNU; pontosabban is specifikálható (pl. szűrés csak a szó-lista létrehozásánál) opció: nem (F) szubsztitúciós mátrix (-M opció): BLOSUM45, BLOSUM62, BLOSUM80, PAM30, PAM70 E-határérték ( expected score threshold ) (-e opció); alapértelmezés: 10 blastn: egyező (M) és nem egyező (N) nukleotidok pontszámának aránya; alapértelmezés: M = 5, N = -4 ( M/N = 1.25; ~47 nukleotid PAM); minél nagyobb az arány, annál távolabbi szekvenciákat talál meg Molecular phylogenetics 102

103 BLAST programok WWW: NCBI-BLAST: (NCBI) (EBI) WU-BLAST: (EBI) (Institute Pasteur) (és sok más helyen, gyakran speciális adatbázisokkal, pl. fajok szerint) Lokálisan futtatható: blastall FASTA formátumú adatbázis formázása és indexelése: formatdb -i nr -o T BLAST keresés: blastall -p blastp -d nr -i query.fasta o \ out.query Molecular phylogenetics 103

104 Potenciális műtermékek, fals pozitívok Forrásai: Kis komplexitású régiók Repetitív elemek Figyelmeztető találatok (pl. Alu szekvencia) Vektor-szennyezés Megoldás: keresőszekvencia maszkolása, szűrése Kis összetételi komplexitású régiók: BLAST-ba beépítve: seg ill. xnu (aminosav), dust (nukleotid) kis komplexitású régiók, mikroszatellitek maszkolása Mikroszatellitek (SSR): Sputnik (http://abajian.net/sputnik/) mikroszatellitek (SSR) azonosítása; Windows, UNIX TRF (Tandem Repeat Finder) mikroszatellitek (SSR) azonosítása; Windows, UNIX Molecular phylogenetics 104

105 Kis komplexitású régiók szűrése SEG (fehérjékre) HILCDEVNEGDEENEDFLPS HILCXXXXXXXXXXXXFLPS DUST (nukleinsavakra) GCTCAAAAAATAAAAACACG GCTCNNNNNNNNNNNNCACG Molecular phylogenetics 105

A tárgy címe: Bioinformatika

A tárgy címe: Bioinformatika A tárgy címe: Bioinformatika Kötelezően választható tárgy IV. és V. évfolyamos biológus hallgatók számára; heti 2+3 óra Előkövetelmény: Biokémia főkollégium; genetika főkollégium; alapszintű számítógépes

Részletesebben

Juhász Angéla MTA ATK MI Alkalmazott Genomikai Osztály SZEKVENCIA ADATBÁZISOK

Juhász Angéla MTA ATK MI Alkalmazott Genomikai Osztály SZEKVENCIA ADATBÁZISOK Juhász Angéla MTA ATK MI Alkalmazott Genomikai Osztály SZEKVENCIA ADATBÁZISOK Fehérjét kódol? Tulajdonságai? -Hol lokalizálódik? -Oldható? -3D szerkezete? -Accession #? -Annotációja elérhető? Már benne

Részletesebben

ADATBÁZIS-KEZELÉS - BEVEZETŐ - Tarcsi Ádám, ade@inf.elte.hu

ADATBÁZIS-KEZELÉS - BEVEZETŐ - Tarcsi Ádám, ade@inf.elte.hu ADATBÁZIS-KEZELÉS - BEVEZETŐ - Tarcsi Ádám, ade@inf.elte.hu Számonkérés 2 Papíros (90 perces) zh az utolsó gyakorlaton. Segédanyag nem használható Tematika 1. félév 3 Óra Dátum Gyakorlat 1. 2010.09.28.

Részletesebben

NÖVÉNYI GENOMIKA JÓRI BALÁZS

NÖVÉNYI GENOMIKA JÓRI BALÁZS NÖVÉNYI GENOMIKA JÓRI BALÁZS Eötvös Loránd Tudományegyetem, Növényélettani és Molekuláris Növénybiológia Tanszék, 1117 Budapest, Pázmány P. sétány 1/c. Elfogadva: 2004. december 29. Bot. Közlem. 91(1 2):

Részletesebben

Gyakorlati bioinformatika

Gyakorlati bioinformatika Gyakorlati bioinformatika Szekvenciaillesztés PhD kurzus 2. Szekvenciaillesztés Bagossi Péter Fajtái: - egyszer ill. többszörös illesztés - globális ill. lokális illesztés Alkalmazása: - adatbázisokban

Részletesebben

Bevezetés a bioinformatikába

Bevezetés a bioinformatikába Bevezetésabioinformatikába 2009 2010őszifélév,biológiaBSC,levelezőképzés BálintBalázs (balintb@brc.hu) http://biotech.szbk.u szeged.hu/ Információakurzusról I.elméletialapok(azévvégivizsgaanyaga) II.azelméletirészheztartozógyakorlatimunka(nemszámonkért)

Részletesebben

Adatbázis, adatbázis-kezelő

Adatbázis, adatbázis-kezelő Adatbázisok I. rész Adatbázis, adatbázis-kezelő Adatbázis: Nagy adathalmaz Közvetlenül elérhető háttértárolón (pl. merevlemez) Jól szervezett Osztott Adatbázis-kezelő szoftver hozzáadás, lekérdezés, módosítás,

Részletesebben

A bakteriális kommunikáció és kooperáció génjeinek elhelyezkedése ismert genomokban.

A bakteriális kommunikáció és kooperáció génjeinek elhelyezkedése ismert genomokban. A bakteriális kommunikáció és kooperáció génjeinek elhelyezkedése ismert genomokban. Az AHL szabályzórendszer génjei. Pázmány Péter Katolikus Egyetem Információs Technológiai és Bionikai Kar Multidiszciplináris

Részletesebben

SQLServer. SQLServer konfigurációk

SQLServer. SQLServer konfigurációk SQLServer 2. téma DBMS installáció SQLServer konfigurációk 1 SQLServer konfigurációk SQLServer konfigurációk Enterprise Edition Standart Edition Workgroup Edition Developer Edition Express Edition 2 Enterprise

Részletesebben

A MOLEKULÁRIS BIOLÓGIA ISMERETÁBRÁZOLÁSI PROBLÉMÁI

A MOLEKULÁRIS BIOLÓGIA ISMERETÁBRÁZOLÁSI PROBLÉMÁI Magyar Tudomány 2005/4 A MOLEKULÁRIS BIOLÓGIA ISMERETÁBRÁZOLÁSI PROBLÉMÁI Pongor Sándor a biológiai tudomány doktora, MTA Biológiai Központ, Szeged International Centre of Genetic Engineering and Biotechnology,

Részletesebben

Adatbázis-kezelés. Harmadik előadás

Adatbázis-kezelés. Harmadik előadás Adatbázis-kezelés Harmadik előadás 39 Műveletek csoportosítása DDL adat definiálás Objektum létrehozás CREATE Objektum törlés DROP Objektum módosítás ALTER DML adat módosítás Rekord felvitel INSERT Rekord

Részletesebben

MŰSZAKI KÖVETELMÉNYEK, A KÖRKERESŐ SZOFTVER SPECIFIKÁCIÓJA, KÖLTSÉGVETÉS. A) Műszaki követelmények

MŰSZAKI KÖVETELMÉNYEK, A KÖRKERESŐ SZOFTVER SPECIFIKÁCIÓJA, KÖLTSÉGVETÉS. A) Műszaki követelmények 1. sz. melléklet MŰSZAKI KÖVETELMÉNYEK, A KÖRKERESŐ SZOFTVER SPECIFIKÁCIÓJA, KÖLTSÉGVETÉS A) Műszaki követelmények A körkereső szoftvernek (a továbbiakban Szoftver) az alábbi követelményeknek kell megfelelnie

Részletesebben

Informatikai alapismeretek Földtudományi BSC számára

Informatikai alapismeretek Földtudományi BSC számára Informatikai alapismeretek Földtudományi BSC számára 2010-2011 Őszi félév Heizlerné Bakonyi Viktória HBV@ludens.elte.hu Titkosítás,hitelesítés Szimmetrikus DES 56 bites kulcs (kb. 1000 év) felcserél, helyettesít

Részletesebben

Nyíregyházi Egyetem Matematika és Informatika Intézete. Fájl rendszer

Nyíregyházi Egyetem Matematika és Informatika Intézete. Fájl rendszer 1 Fájl rendszer Terminológia Fájl és könyvtár (mappa) koncepció Elérési módok Fájlattribútumok Fájlműveletek, fájlszerkezetek ----------------------------------------- Könyvtár szerkezet -----------------------------------------

Részletesebben

Genetikai panel kialakítása a hazai tejhasznú szarvasmarha állományok hasznos élettartamának növelésére

Genetikai panel kialakítása a hazai tejhasznú szarvasmarha állományok hasznos élettartamának növelésére Genetikai panel kialakítása a hazai tejhasznú szarvasmarha állományok hasznos élettartamának növelésére Dr. Czeglédi Levente Dr. Béri Béla Kutatás-fejlesztés támogatása a megújuló energiaforrások és agrár

Részletesebben

8. Gyakorlat SQL. DDL (Data Definition Language) adatdefiníciós nyelv utasításai:

8. Gyakorlat SQL. DDL (Data Definition Language) adatdefiníciós nyelv utasításai: 8. Gyakorlat SQL SQL: Structured Query Language; a relációs adatbáziskezelők szabványos, strukturált lekérdező nyelve SQL szabványok: SQL86, SQL89, SQL92, SQL99, SQL3 Az SQL utasításokat mindig pontosvessző

Részletesebben

Adatbáziskezelı-szerver SQL. Relációs adatbázis-kezelık. Relációs adatszerkezet. Házi feladat 2012.03.05.

Adatbáziskezelı-szerver SQL. Relációs adatbázis-kezelık. Relációs adatszerkezet. Házi feladat 2012.03.05. 1 2 Adatbáziskezelı-szerver Általában dedikált szerver Optimalizált háttértár konfiguráció Csak OS + adatbázis-kezelő szoftver Teljes memória az adatbázisoké Fő funkciók: Adatok rendezett tárolása a háttértárolón

Részletesebben

BIOINFORMATIKA Ungvári Ildikó

BIOINFORMATIKA Ungvári Ildikó 1 BIOINFORMATIKA Ungvári Ildikó Az elmúlt évtizedekben a molekuláris biológiai, genomikai technológiák robbanásszerű fejlődése a biológiai adatok mennyiségének exponenciális növekedéséhez vezetett. Ebben

Részletesebben

Tartalomjegyzék. Tartalomjegyzék 1. Az SQL nyelv 1 Az SQL DDL alapjai 2

Tartalomjegyzék. Tartalomjegyzék 1. Az SQL nyelv 1 Az SQL DDL alapjai 2 Tartalomjegyzék Tartalomjegyzék 1 Az SQL nyelv 1 Az SQL DDL alapjai 2 Adatbázis parancsok 2 Táblaparancsok 2 A táblázat létrehozása 2 A táblázat módosítása 3 A tábla törlése 3 Indextábla létrehozása 3

Részletesebben

Adatbázisok* tulajdonságai

Adatbázisok* tulajdonságai Gazdasági folyamatok térbeli elemzése 4. előadás 2010. 10. 05. Adatbázisok* tulajdonságai Rendezett, logikailag összefüggő és meghatározott szempont szerint tárolt adatok és/vagy információk halmaza Az

Részletesebben

Genomadatbázisok Ld. Entrez Genome: Összes ismert genom, hierarchikus szervezésben (kromoszóma, térképek, gének, stb.)

Genomadatbázisok Ld. Entrez Genome: Összes ismert genom, hierarchikus szervezésben (kromoszóma, térképek, gének, stb.) Genomika Új korszak, paradigmaváltás, forradalom: a teljes genomok ismeretében a biológia adatokban gazdag tudománnyá válik. Új kutatási módszerek, új szemlélet. Hajtóerõk: Genomszekvenálási projektek

Részletesebben

Biomassza alapú bioalkohol előállítási technológia fejlesztése metagenomikai eljárással

Biomassza alapú bioalkohol előállítási technológia fejlesztése metagenomikai eljárással Biomassza alapú bioalkohol előállítási technológia fejlesztése metagenomikai eljárással Kovács Zoltán ügyvezető DEKUT Debreceni Kutatásfejlesztési Közhasznú Nonprofit Kft. Problémadefiníció Első generációs

Részletesebben

Adatbázis rendszerek 7. előadás State of the art

Adatbázis rendszerek 7. előadás State of the art Adatbázis rendszerek 7. előadás State of the art Molnár Bence Szerkesztette: Koppányi Zoltán Osztott adatbázisok Osztott rendszerek Mi is ez? Mi teszi lehetővé? Nagy sebességű hálózat Egyre olcsóbb, és

Részletesebben

Szekvencia összehasonlítások II. Bioinformatika és genom analízis az orvostudományban (AOGENBIG_1M)

Szekvencia összehasonlítások II. Bioinformatika és genom analízis az orvostudományban (AOGENBIG_1M) Szekvencia összehasonlítások II. Bioinformatika és genom analízis az orvostudományban (AOGENBIG_1M) Miklós István SOTE, 21. október 28. DNS-szekvenciák összeszerelése Ún. shot-gun szekvenálással lehet

Részletesebben

ESZTERHÁZY KÁROLY FŐISKOLA, EGER. Beszámoló könyvtári szakmai gyakorlatról

ESZTERHÁZY KÁROLY FŐISKOLA, EGER. Beszámoló könyvtári szakmai gyakorlatról ESZTERHÁZY KÁROLY FŐISKOLA, EGER Beszámoló könyvtári szakmai gyakorlatról Digitálisarchívum-fejlesztő szak Humán Informatika Tanszék Média Informatika Intézet Zádori Zsuzsanna Netpun kód: U5AT4N A szakmai

Részletesebben

Multimédiás adatbázisok

Multimédiás adatbázisok Multimédiás adatbázisok Multimédiás adatbázis kezelő Olyan adatbázis kezelő, mely támogatja multimédiás adatok (dokumentum, kép, hang, videó) tárolását, módosítását és visszakeresését Minimális elvárás

Részletesebben

A HUMÁN GENOM PROJEKT Sasvári-Székely Mária* Semmelweis Egyetem, Orvosi Vegytani, Molekuláris Biológiai és Pathobiokémiai Intézet

A HUMÁN GENOM PROJEKT Sasvári-Székely Mária* Semmelweis Egyetem, Orvosi Vegytani, Molekuláris Biológiai és Pathobiokémiai Intézet A HUMÁN GENOM PROJEKT Sasvári-Székely Mária* Semmelweis Egyetem, Orvosi Vegytani, Molekuláris Biológiai és Pathobiokémiai Intézet *Levelezési cím: Dr. Sasvári-Székely Mária, Semmelweis Egyetem, Orvosi

Részletesebben

B I T M A N B I v: T 2015.03.01 M A N

B I T M A N B I v: T 2015.03.01 M A N Adatbázis Rendszerek MSc 2. Gy: MySQL Táblák, adatok B I v: T 2015.03.01 M A N 1/41 Témakörök SQL alapok DDL utasítások DML utasítások DQL utasítások DCL utasítások 2/41 Az SQL jellemzése Az SQL a relációs

Részletesebben

A fehérjék térszerkezetének jóslása

A fehérjék térszerkezetének jóslása A fehérjék térszerkezetének jóslása 1. A probléma bonyolultsága 2. A predikció szintjei 3. 1D predikciók (másodlagos szerkezet, hozzáférhetõség, transzmembrán hélixek 4. 2D predikciók (oldallánc kontaktusok,

Részletesebben

PHP-MySQL. Adatbázisok gyakorlat

PHP-MySQL. Adatbázisok gyakorlat PHP-MySQL Adatbázisok gyakorlat Weboldalak és adatbázisok Az eddigiek során megismertük, hogyan lehet a PHP segítségével dinamikus weblapokat készíteni. A dinamikus weboldalak az esetek többségében valamilyen

Részletesebben

Webapp (in)security. Gyakori hibákról és azok kivédéséről fejlesztőknek és üzemeltetőknek egyaránt. Veres-Szentkirályi András

Webapp (in)security. Gyakori hibákról és azok kivédéséről fejlesztőknek és üzemeltetőknek egyaránt. Veres-Szentkirályi András Webapp (in)security Gyakori hibákról és azok kivédéséről fejlesztőknek és üzemeltetőknek egyaránt Veres-Szentkirályi András Rövid áttekintés Webalkalmazások fejlesztése során elkövetett leggyakoribb hibák

Részletesebben

Adatbázis kezelés Delphiben. SQL lekérdezések

Adatbázis kezelés Delphiben. SQL lekérdezések Adatbázis kezelés Delphiben. SQL lekérdezések Structured Query Language adatbázisok kezelésére szolgáló lekérdező nyelv Szabályok: Utasítások tetszés szerint tördelhetők Utasítások végét pontosvessző zárja

Részletesebben

Közoktatási Statisztika Tájékoztató 2012/2013. Használati útmutató

Közoktatási Statisztika Tájékoztató 2012/2013. Használati útmutató Közoktatási Statisztika Tájékoztató 2012/2013 Tartalomjegyzék 1. Technikai információk... 2 2. Publikus felület... 2 2.1 Bejelentkezés... 2 2.2 Összesítés... 3 2.2.1 Statisztikai tábla megtekintése...

Részletesebben

Fejlett kereső és lekérdező eszközök egy elektronikus szakfolyóirathoz (IBVS)

Fejlett kereső és lekérdező eszközök egy elektronikus szakfolyóirathoz (IBVS) Networkshop, 2008 Márc. 17 19., Dunaújváros Holl Erdődi: Fejlett kereső... 1 Fejlett kereső és lekérdező eszközök egy elektronikus szakfolyóirathoz (IBVS) Holl András Erdődi Péter MTA Konkoly Thege Miklós

Részletesebben

Adatbázis-kezelés ODBC driverrel

Adatbázis-kezelés ODBC driverrel ADATBÁZIS-KEZELÉS ODBC DRIVERREL... 1 ODBC: OPEN DATABASE CONNECTIVITY (NYÍLT ADATBÁZIS KAPCSOLÁS)... 1 AZ ODBC FELÉPÍTÉSE... 2 ADATBÁZIS REGISZTRÁCIÓ... 2 PROJEKT LÉTREHOZÁSA... 3 A GENERÁLT PROJEKT FELÉPÍTÉSE...

Részletesebben

Microsoft SQL Server telepítése

Microsoft SQL Server telepítése Microsoft SQL Server telepítése Az SQL Server a Microsoft adatbázis kiszolgáló megoldása Windows operációs rendszerekre. Az SQL Server 1.0 verziója 1989-ben jelent meg, amelyet tizenegy további verzió

Részletesebben

Migráció MS Access-ről Oracle Application Express-re

<Insert Picture Here> Migráció MS Access-ről Oracle Application Express-re Migráció MS Access-ről Oracle Application Express-re Sárecz Lajos Oracle Hungary Izsák Tamás Független szakértő Program Miért migráljunk Microsoft Access-ről? Mi az az Oracle Application

Részletesebben

mintasepcifikus mikrokapilláris elektroforézis Lab-on-Chip elektroforézis / elektrokinetikus elven DNS, RNS, mirns 12, fehérje 10, sejtes minta 6

mintasepcifikus mikrokapilláris elektroforézis Lab-on-Chip elektroforézis / elektrokinetikus elven DNS, RNS, mirns 12, fehérje 10, sejtes minta 6 Agilent 2100 Bioanalyzer mikrokapilláris gélelektroforézis rendszer G2943CA 2100 Bioanalyzer system forgalmazó: Kromat Kft. 1112 Budapest Péterhegyi u. 98. t:36 (1) 248-2110 www.kromat.hu bio@kromat.hu

Részletesebben

(11) Lajstromszám: E 008 370 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA

(11) Lajstromszám: E 008 370 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000008370T2! (19) HU (11) Lajstromszám: E 008 370 (13) T2 MAGYAR KÖZTÁRSASÁG Szellemi Tulajdon Nemzeti Hivatala EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 06 750224 (22) A bejelentés

Részletesebben

SQL ALAPOK. Bevezetés A MYSQL szintaxisa Táblák, adatok kezelésének alapjai

SQL ALAPOK. Bevezetés A MYSQL szintaxisa Táblák, adatok kezelésének alapjai SQL ALAPOK Bevezetés A MYSQL szintaxisa Táblák, adatok kezelésének alapjai BEVEZETÉS SQL: Structured Query Language Strukturált Lekérdező Nyelv Szabvány határozza meg, azonban számos nyelvjárása létezik

Részletesebben

Human Genome Project, 1990-2005 5 évvel a tervezett befezés előtt The race is over, victory for Craig Venter. The genome is mapped* - now what?

Human Genome Project, 1990-2005 5 évvel a tervezett befezés előtt The race is over, victory for Craig Venter. The genome is mapped* - now what? 2000 június 26 Új út kezdete, vagy egy út vége? Human Genome Project, 1990-2005 5 évvel a tervezett befezés előtt The race is over, victory for Craig Venter. The genome is mapped* - now what? 2000 június

Részletesebben

Szolgáltatási csomagok I-SZERVIZ Kft. érvényes 2008. szeptember 1-től

Szolgáltatási csomagok I-SZERVIZ Kft. érvényes 2008. szeptember 1-től Szolgáltatási csomagok I-SZERVIZ Kft. érvényes 2008. szeptember 1-től HomeWeb csomagok Ha Ön szeretné családjával megosztani fotóit, vagy valamilyen családi eseményt szeretne egyszerű weboldalon megmutatni

Részletesebben

8. A fehérjék térszerkezetének jóslása

8. A fehérjék térszerkezetének jóslása 8. A fehérjék térszerkezetének jóslása A probléma bonyolultsága Általánosságban: találjuk meg egy tetszõleges szekvencia azon konformációját, amely a szabadentalpia globális minimumát adja. Egyszerû modellekben

Részletesebben

LOGISZTIKAI ADATBÁZIS RENDSZEREK BEVEZETÉS

LOGISZTIKAI ADATBÁZIS RENDSZEREK BEVEZETÉS LOGISZTIKAI ADATBÁZIS RENDSZEREK BEVEZETÉS Lénárt Balázs tanársegéd TANTERV, SZOFTVER, IRODALOM Hét Dátum Előadó Előadások Időpont: szerda 8:30-10:00, helye: LFSZÁMG Dátum Gyakvezető 1. 9. 11. Tokodi Adatbázis

Részletesebben

XML alapú adatbázis-kezelés. (Katona Endre diái alapján)

XML alapú adatbázis-kezelés. (Katona Endre diái alapján) XML alapú adatbázis-kezelés Adatstruktúrák: Digitális kép, hang: teljesen strukturálatlan A web (linkek): részben strukturált Relációs: teljesen strukturált Motiváció: (Katona Endre diái alapján) Ismeretlen

Részletesebben

Nem kódoló RNS-ekből potenciálisan keletkező de novo fehérjék azonosítása és elemzése DIPLOMAMUNKA

Nem kódoló RNS-ekből potenciálisan keletkező de novo fehérjék azonosítása és elemzése DIPLOMAMUNKA Nem kódoló RNS-ekből potenciálisan keletkező de novo fehérjék azonosítása és elemzése DIPLOMAMUNKA Készítette: Kiss-Tóth Annamária Infobionika MSc Témavezető: dr. Gáspári Zoltán Pázmány Péter Katolikus

Részletesebben

KERESÉS A NETEN DR. KÓNYA LÁSZLÓ: KERESÉS A NETEN KERESÉS MÓDSZERE, KERESŐPROGRAMOK 2004.04.20

KERESÉS A NETEN DR. KÓNYA LÁSZLÓ: KERESÉS A NETEN KERESÉS MÓDSZERE, KERESŐPROGRAMOK 2004.04.20 INTERNET 1/42 KERESÉS A NETEN DR. KÓNYA LÁSZLÓ: KERESÉS A NETEN KERESÉS MÓDSZERE, KERESŐPROGRAMOK 2004.04.20 FORRÁS: TARR BENCE : KERESÉS AZ INTERNETEN PANEM KIADÓ, 2001 ISBN 963 545 326 4 INTERNET 2/42

Részletesebben

KÖNYVTÁRI KATALÓGUS HASZNÁLATI ÚTMUTATÓ

KÖNYVTÁRI KATALÓGUS HASZNÁLATI ÚTMUTATÓ KÖNYVTÁRI KATALÓGUS HASZNÁLATI ÚTMUTATÓ Mi az OPAC? Az OPAC az Online Public Access Catalogue rövidítése. Jelentése olyan számítógépes katalógus, mely nyilvános, bárki számára közvetlenül, általában ingyen

Részletesebben

Web-fejlesztés NGM_IN002_1

Web-fejlesztés NGM_IN002_1 Web-fejlesztés NGM_IN002_1 Szindikálás, aggregálás - RSS, Atom Tartalom betáplálás Gyakran frissül! webszájtok Új felhasználói igények el!fizetési igény az új tartalomra a tartalom újrafelhasználása eltér!

Részletesebben

BEVEZETÉS Az objektum fogalma

BEVEZETÉS Az objektum fogalma BEVEZETÉS Az objektum fogalma Program (1) Adat (2) Objektum Kiadványszerkesztés Word Táblázatkezelés Excel CAD AutoCad Adatbáziskezelés Access 1 Program (1) Adat (2) Objektum Adatmodell (2) A valós világ

Részletesebben

LOGalyze Telepítési és Frissítési Dokumentáció Verzió 3.0

LOGalyze Telepítési és Frissítési Dokumentáció Verzió 3.0 LOGalyze Telepítési és Frissítési Dokumentáció Verzió 3.0 Dokumentum verzió: 3.0/1 Utolsó módosítás: 2009. március 5. 2 LOGalyze Telepítési és Frissítési Dokumentáció LOGalyze 3.0 Telepítési és Frissítési

Részletesebben

Summer of LabVIEW The Sunny Side of System Design

Summer of LabVIEW The Sunny Side of System Design Summer of LabVIEW The Sunny Side of System Design 30th June - 18th July 1 Adatbázis kapcsolatok, adattárolás és a LabVIEW Ványi Zoltán Hungary Kft. Agenda az előadás tematikája Bevezető - bemutatkozás

Részletesebben

Adatbázisok I. Jánosi-Rancz Katalin Tünde tsuto@ms.sapientia.ro 327A 1-1

Adatbázisok I. Jánosi-Rancz Katalin Tünde tsuto@ms.sapientia.ro 327A 1-1 Adatbázisok I. 1 Jánosi-Rancz Katalin Tünde tsuto@ms.sapientia.ro 327A 1-1 1-2 Ajánlott irodalom C. J. Date - An introduction to Database System (6) Békési-Geda-Holovács-Perge : Adatbázis-kezelés, EKF

Részletesebben

1. oldal, összesen: 29 oldal

1. oldal, összesen: 29 oldal 1. oldal, összesen: 29 oldal Bevezetõ AXEL PRO Nyomtatványkitöltõ Program Az AXEL PRO Nyomtatványkitöltõ egy olyan innovatív, professzionális nyomtatványkitöltõ és dokumentum-szerkesztõ program, mellyel

Részletesebben

A Matarka szerszámosládája

A Matarka szerszámosládája A Matarka szerszámosládája Szeged, 2007 Perlaki Attila perlaki@kvtlinux.lib.uni-miskolc.hu 1. Feltöltés A Matarka adatbázis feltöltését a közvetlen kézi bevitelen túl XML állományokból is el lehet végezni.

Részletesebben

Ellenőrző kérdések. 36. Ha t szintű indexet használunk, mennyi a keresési költség blokkműveletek számában mérve? (1 pont) log 2 (B(I (t) )) + t

Ellenőrző kérdések. 36. Ha t szintű indexet használunk, mennyi a keresési költség blokkműveletek számában mérve? (1 pont) log 2 (B(I (t) )) + t Ellenőrző kérdések 2. Kis dolgozat kérdései 36. Ha t szintű indexet használunk, mennyi a keresési költség blokkműveletek számában mérve? (1 pont) log 2 (B(I (t) )) + t 37. Ha t szintű indexet használunk,

Részletesebben

Selling Platform Telepítési útmutató Gyakori hibák és megoldások

Selling Platform Telepítési útmutató Gyakori hibák és megoldások Selling Platform Telepítési útmutató Gyakori hibák és megoldások 265ced1609a17cf1a5979880a2ad364653895ae8 Index _ Amadeus szoftvertelepítő 3 _ Rendszerkövetelmények 3 Támogatott operációs rendszerek 3

Részletesebben

Orvosi Genomtudomány 2014 Medical Genomics 2014. Április 8 Május 22 8th April 22nd May

Orvosi Genomtudomány 2014 Medical Genomics 2014. Április 8 Május 22 8th April 22nd May Orvosi Genomtudomány 2014 Medical Genomics 2014 Április 8 Május 22 8th April 22nd May Hét / 1st week (9. kalendariumi het) Takács László / Fehér Zsigmond Magyar kurzus Datum/ido Ápr. 8 Apr. 9 10:00 10:45

Részletesebben

SZOFTVEREK A SORBANÁLLÁSI ELMÉLET OKTATÁSÁBAN

SZOFTVEREK A SORBANÁLLÁSI ELMÉLET OKTATÁSÁBAN SZOFTVEREK A SORBANÁLLÁSI ELMÉLET OKTATÁSÁBAN Almási Béla, almasi@math.klte.hu Sztrik János, jsztrik@math.klte.hu KLTE Matematikai és Informatikai Intézet Abstract This paper gives a short review on software

Részletesebben

Mai témák. Fehérjék dinamikájának jelentősége. Számítógépes modellezés jelentősége

Mai témák. Fehérjék dinamikájának jelentősége. Számítógépes modellezés jelentősége Mai témák Fehérjék szerkezetének predikciója, szerkezeti adatok felhasználása adatbázisok segítségével, a számítógépes molekuladinamikai modellezés alapjai Hegedűs Tamás tamas@hegelab.org Bevezetés szimulációk

Részletesebben

A gyakorlat során MySQL adatbázis szerver és a böngészőben futó phpmyadmin használata javasolt. A gyakorlat során a következőket fogjuk gyakorolni:

A gyakorlat során MySQL adatbázis szerver és a böngészőben futó phpmyadmin használata javasolt. A gyakorlat során a következőket fogjuk gyakorolni: 1 Adatbázis kezelés 3. gyakorlat A gyakorlat során MySQL adatbázis szerver és a böngészőben futó phpmyadmin használata javasolt. A gyakorlat során a következőket fogjuk gyakorolni: Tábla kapcsolatok létrehozása,

Részletesebben

Sikerünk kulcsa: az információ De honnan lesz adatunk? Palaczk Péter

Sikerünk kulcsa: az információ De honnan lesz adatunk? Palaczk Péter Sikerünk kulcsa: az információ De honnan lesz adatunk? Palaczk Péter Bevezető az Oracle9i adattárházas újdonságaihoz Elemzési és vezetői információs igények 80:20 az adatgyűjtés javára! Adattárházak kínálta

Részletesebben

WWW MULTIMÉDIA INTERFÉSZ ADATBÁZISHASZNÁLATHOZ AZ INTERNETEN

WWW MULTIMÉDIA INTERFÉSZ ADATBÁZISHASZNÁLATHOZ AZ INTERNETEN WWW MULTIMÉDIA INTERFÉSZ ADATBÁZISHASZNÁLATHOZ AZ INTERNETEN Herdon Miklós, herdon@fs2.date.hu* Kovács Zoltán, kovacsz@fs2.date.hu** Szegedi János, szegedi@fs2.date.hu* Tóth András-Balázs, tab@fs2.date.hu*

Részletesebben

MySQL kontra MongoDB programozás. SQL és NoSQL megközelítés egy konkrét példán keresztül

MySQL kontra MongoDB programozás. SQL és NoSQL megközelítés egy konkrét példán keresztül MySQL kontra MongoDB programozás SQL és NoSQL megközelítés egy konkrét példán keresztül Kardos Sándor sandor@component.hu Miről lesz szó? Miért érdemes őket összehasonlítani? MySQL általános jellemzői

Részletesebben

Óravázlat. az ECDL oktatócsomaghoz. 5. modul. Adatbáziskezelés. Krea Kft. 1034 Budapest, Szőlő u 21. Tel/fax: 250-5570 / 387-2557 E-mail: krea@krea.

Óravázlat. az ECDL oktatócsomaghoz. 5. modul. Adatbáziskezelés. Krea Kft. 1034 Budapest, Szőlő u 21. Tel/fax: 250-5570 / 387-2557 E-mail: krea@krea. Óravázlat az ECDL oktatócsomaghoz 5. modul Adatbáziskezelés Krea Kft. 1034 Budapest, Szőlő u 21. Tel/fax: 250-5570 / 387-2557 E-mail: krea@krea.hu A vázlatot összeállította: Pintyőke László Lektorálta:

Részletesebben

LBRA6i integrált rendszer

LBRA6i integrált rendszer LBRA6i integrált rendszer LIBRA 6i logolás és a log megtekintése Készítette: Libra Szoftver Zrt. Létrehozás dátuma: 2005.12.15. Utolsó módosítás: 2014.10.30. Referencia szám: LIBRA6i_UZEM_V_1.5 Verzió:

Részletesebben

Térinformatika. j informáci. ciós s rendszerek funkciói. Kereső nyelvek (Query Languages) Az adatok feldolgozását (leválogat

Térinformatika. j informáci. ciós s rendszerek funkciói. Kereső nyelvek (Query Languages) Az adatok feldolgozását (leválogat Térinformatika Elemzék 2. Az informáci ciós s rendszerek funkciói adatnyerés s (input) adatkezelés s (management) adatelemzés s (analysis) adatmegjelenítés s (prentation) Összeállította: Dr. Szűcs LászlL

Részletesebben

The nontrivial extraction of implicit, previously unknown, and potentially useful information from data.

The nontrivial extraction of implicit, previously unknown, and potentially useful information from data. Budapesti Műszaki és Gazdaságtudományi Egyetem Méréstechnika és Információs rendszerek Tanszék Adatelemzés intelligens módszerekkel Hullám Gábor Adatelemzés hagyományos megközelítésben I. Megválaszolandó

Részletesebben

Önálló laboratórium beszámoló

Önálló laboratórium beszámoló Önálló laboratórium beszámoló BME-TMIT Készítette: Sümeghy Tamás Pál Neptun-kód: GFHSRE Szak: műszaki informatikus Szakirány: Internet és infokommunikációs alkalmazásai E-mail cím: schumy@sch.bme.hu Konzulens(ek):

Részletesebben

IBM WebSphere Adapters 7. változat 5. alváltozat. IBM WebSphere Adapter for Oracle E-Business Suite felhasználói kézikönyv 7. változat 5.

IBM WebSphere Adapters 7. változat 5. alváltozat. IBM WebSphere Adapter for Oracle E-Business Suite felhasználói kézikönyv 7. változat 5. IBM WebSphere Adapters 7. változat 5. alváltozat IBM WebSphere Adapter for Oracle E-Business Suite felhasználói kézikönyv 7. változat 5.kiadás IBM WebSphere Adapters 7. változat 5. alváltozat IBM WebSphere

Részletesebben

RapidMiner telepítés i. RapidMiner telepítés

RapidMiner telepítés i. RapidMiner telepítés i RapidMiner telepítés ii COLLABORATORS TITLE : RapidMiner telepítés ACTION NAME DATE SIGNATURE WRITTEN BY Jeszenszky, Péter 2014. szeptember 17. REVISION HISTORY NUMBER DATE DESCRIPTION NAME iii Tartalomjegyzék

Részletesebben

Enterprise extended Output Management. exom - Greendoc Systems Kft. 1

Enterprise extended Output Management. exom - Greendoc Systems Kft. 1 Enterprise extended Output Management exom - Greendoc Systems Kft. 1 exom - Greendoc Systems Kft. 2 Sokféle bementi adatformátum kezelése Adatok fogadása különböző csatornákon Előfeldolgozás: típus meghatározás,

Részletesebben

Csináld magad naplóelemzés syslog-ng-vel

Csináld magad naplóelemzés syslog-ng-vel Csináld magad naplóelemzés syslog-ng-vel Höltzl Péter, CISA holtzl.peter@balabit.com http:/// Miről lesz szó? Hogyan lesz az adatból információ? Hogyan elemez a syslog-ng futásidőben? Mire tudjuk használni

Részletesebben

Oracle E-Business Suite üzemeltetés a Rába Járműipari Holding Nyrt.-nél

Oracle E-Business Suite üzemeltetés a Rába Járműipari Holding Nyrt.-nél Oracle E-Business Suite üzemeltetés a Rába Járműipari Holding Nyrt.-nél 1 Kósa György Szenior Rendszermérnök (Oracle OCP és MSSQL DBA, EBS DBA) T-Systems Magyarország Zrt. Kósa György - T-Systems Magyarország

Részletesebben

Számítógépes hálózatok

Számítógépes hálózatok Számítógépes hálózatok Harmadik gyakorlat forgalomszűrés, DNS, HTTP forgalom elemzés Előadó: Ács Zoltán Hálózati forgalom elemzése 1/3 Különböző célok miatt szükség lehet a hálózati forgalom megfigyelésére

Részletesebben

Magyar Emlőstani Évkönyv. Szerzői tájékoztató (2016. február 27.)

Magyar Emlőstani Évkönyv. Szerzői tájékoztató (2016. február 27.) Magyar Emlőstani Évkönyv Szerzői tájékoztató (2016. február 27.) A Magyar Emlőstani Évkönyv (Hungarian Yearbook of Mammalogy) a Milvus Csoport Madártani és Természetvédelmi Egyesület és a Bükki Emlőstani

Részletesebben

A belső hálózat konfigurálása

A belső hálózat konfigurálása DHCP A belső hálózat konfigurálása Hozzuk létre a virtuális belső hálózatunkat. Szerver (Windows 2012) SWITCH Kliens gép (Windows 7) Hálózati kártya (LAN1) Hálózati kártya (LAN1) Állítsunk be egy lan1

Részletesebben

Vizuális programozás gyakorlat

Vizuális programozás gyakorlat Vizuális programozás gyakorlat A gyakorlat célja az entitás modell készítésének és az MS SQLEXPRESS használatának gyakorlása. A gyakorlat során egy könyvtári szoftver adatmodelljét tervezzük meg, valamint

Részletesebben

MozaiX Húsipari Értékesítési és Raktározási Rendszer bemutatása

MozaiX Húsipari Értékesítési és Raktározási Rendszer bemutatása MozaiX Húsipari Értékesítési és Raktározási Rendszer bemutatása Az informatikai rendszer elsősorban húsipari cégek értékesítési folyamataira nyújt teljes körű megoldást, a megrendelések feldolgozásától,

Részletesebben

Programozás. Adatbázis-kezelés (alapok) Fodor Attila

Programozás. Adatbázis-kezelés (alapok) Fodor Attila Programozás Adatbázis-kezelés (alapok) Fodor Attila Pannon Egyetem Műszaki Informatikai Kar Villamosmérnöki és Információs Rendszerek Tanszék foa@almos.vein.hu 2010. április 22. Bevezetés Adatbáziskezelés

Részletesebben

BaBér bérügyviteli rendszer telepítési segédlete 2011. év

BaBér bérügyviteli rendszer telepítési segédlete 2011. év BaBér bérügyviteli rendszer telepítési segédlete 2011. év Ajánlott konfiguráció A program hardverigénye: Konfiguráció: 2800 MHz processzor 512 Mbyte memória (RAM) / Szerver gépen 1G memória (RAM) Lézernyomtató

Részletesebben

A TERC VIP költségvetés-készítő program telepítése, Interneten keresztül, manuálisan

A TERC VIP költségvetés-készítő program telepítése, Interneten keresztül, manuálisan Telepítés internetről A TERC VIP költségvetés-készítő program telepítése, Interneten keresztül, manuálisan Új szolgáltatásunk keretén belül, olyan lehetőséget kínálunk a TERC VIP költségvetéskészítő program

Részletesebben

Szakmai CD-ROM és online adatbázisok 2007.10.09

Szakmai CD-ROM és online adatbázisok 2007.10.09 Szakmai CD-ROM és online adatbázisok 2007.10.09 Helyi (egyetemi) hálózatban elérhető CD-ROM adatbázisok Forest Science Database (Tree CD) CD-ROM adatbázisok a központi könyvtár állományában (helyi használat)

Részletesebben

Hozzáférés és újrahasznosítás

Hozzáférés és újrahasznosítás Hozzáférés és újrahasznosítás A TEL és az Europeana a tudományos kutatás szolgálatában Kovácsné Koreny Ágnes Fővárosi Szabó Ervin Könyvtár Kutatók a virtuális térben 10 évnyi kutatás a virtuális kutatók

Részletesebben

Adatbázisok I 2012.05.11. Adatmodellek komponensei. Adatbázis modellek típusai. Adatbázisrendszer-specifikus tervezés

Adatbázisok I 2012.05.11. Adatmodellek komponensei. Adatbázis modellek típusai. Adatbázisrendszer-specifikus tervezés Adatbázisok I Szemantikai adatmodellek Szendrői Etelka PTE-PMMK Rendszer és Szoftvertechnológiai Tanszék szendroi@pmmk.pte.hu Adatmodellek komponensei Adatmodell: matematikai formalizmus, mely a valóság

Részletesebben

INFORMATIKA ÁGAZATI ALKALMAZÁSAI. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010

INFORMATIKA ÁGAZATI ALKALMAZÁSAI. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 INFORMATIKA ÁGAZATI ALKALMAZÁSAI Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 2. Adatbáziskezelés eszközei Adatbáziskezelés feladata Adatmodell típusai Relációs adatmodell

Részletesebben

Sony Ericsson P910i BlackBerry Connect telepítési segédlet

Sony Ericsson P910i BlackBerry Connect telepítési segédlet Sony Ericsson P910i BlackBerry Connect telepítési segédlet A Sony Ericsson P910i BlackBerry Connect online levelezô alkalmazásának telepítése Microsoft Exchange szerverrel való együttmûködéshez : Megjegyzés:

Részletesebben

Component Soft 1994-2013 és tovább

Component Soft 1994-2013 és tovább Component Soft 1994-2013 és tovább IT szakemberek oktatása, tanácsadás Fő témáink: UNIX/Linux rendszerek, virtualizációs, fürtözési, tároló menedzsment és mentési technológiák Adatbázisok és middleware

Részletesebben

Csatlakozás az IBM i rendszerhez IBM i Access for Windows: Telepítés és beállítás

Csatlakozás az IBM i rendszerhez IBM i Access for Windows: Telepítés és beállítás IBM i Csatlakozás az IBM i rendszerhez IBM i Access for Windows: Telepítés és beállítás 7.1 IBM i Csatlakozás az IBM i rendszerhez IBM i Access for Windows: Telepítés és beállítás 7.1 Megjegyzés A kiadvány

Részletesebben

Szoftver Tervezési Dokumentáció. Nguyen Thai Binh

Szoftver Tervezési Dokumentáció. Nguyen Thai Binh Szoftver Tervezési Dokumentáció Nguyen Thai Binh April 2010 1. fejezet Feladat Szimulációs feladat. Célja, hogy reprezentáljunk egy több komponensből álló alkalmazást, amely a megadott témakörnek megfelel,

Részletesebben

Internet programozása. 1. előadás

Internet programozása. 1. előadás Internet programozása 1. előadás Áttekintés 1. Mi a PHP? 2. A PHP fejlődése 3. A PHP 4 újdonságai 4. Miért pont PHP? 5. A programfejlesztés eszközei 1. Mi a PHP? Egy makrókészlet volt, amely személyes

Részletesebben

A hitelezési folyamatok hatékonyságának növelése - Autonomy alapú iratkezelés. Szűcs István HP Informatikai Kft. E-banking konferencia 2014 március 6.

A hitelezési folyamatok hatékonyságának növelése - Autonomy alapú iratkezelés. Szűcs István HP Informatikai Kft. E-banking konferencia 2014 március 6. A hitelezési folyamatok hatékonyságának növelése - Autonomy alapú iratkezelés 1 Szűcs István HP Informatikai Kft. E-banking konferencia 2014 március 6. A klasszikus IT eszközei strukturált adatok feldolgozására

Részletesebben

ADATBÁZISKEZELÉS ADATBÁZIS

ADATBÁZISKEZELÉS ADATBÁZIS ADATBÁZISKEZELÉS 1 ADATBÁZIS Az adatbázis adott (meghatározott) témakörre vagy célra vonatkozó adatok gyűjteménye. - Pl. A megrendelések nyomon követése kereskedelemben. Könyvek nyilvántartása egy könyvtárban.

Részletesebben

Adatbázisok biztonsága

Adatbázisok biztonsága Adatbázisok biztonsága 13 1 Célkitőzések 1. Titoktartás (Secrecy): olyan felhasználó, akinek nincs joga, ne férjen hozzá az információkhoz. pl. egy diák ne láthassa más diák kreditjeit. 2. Sértetlenség

Részletesebben

Területi elemzések. Budapest, 2015. április

Területi elemzések. Budapest, 2015. április TeIR Területi elemzések Felhasználói útmutató Budapest, 2015. április Tartalomjegyzék 1. BEVEZETŐ... 3 2. AZ ELEMZÉSBEN SZEREPLŐ MUTATÓ KIVÁLASZTÁSA... 4 3. AZ ELEMZÉSI FELTÉTELEK DEFINIÁLÁSA... 5 3.1.

Részletesebben

Nemzeti Fejlesztési és Gazdasági Minisztérium támogatásával megvalósuló KKC-2008-V-08-08-101 számú projekt B2CR ONLINE KOMMUNIKÁCIÓ

Nemzeti Fejlesztési és Gazdasági Minisztérium támogatásával megvalósuló KKC-2008-V-08-08-101 számú projekt B2CR ONLINE KOMMUNIKÁCIÓ ONLINE KOMMUNIKÁCIÓ azaz, hogyan használjuk fel az internet lehetőségeit cégünk sikerei érdekében. MarkCon előadó: Vendler Balázs, ügyvezető TARTALOM (1) Az internetről általában (2) Webes megjelenések

Részletesebben

SZOFTVERES SZEMLÉLTETÉS A MESTERSÉGES INTELLIGENCIA OKTATÁSÁBAN _ Jeszenszky Péter Debreceni Egyetem, Informatikai Kar jeszenszky.peter@inf.unideb.

SZOFTVERES SZEMLÉLTETÉS A MESTERSÉGES INTELLIGENCIA OKTATÁSÁBAN _ Jeszenszky Péter Debreceni Egyetem, Informatikai Kar jeszenszky.peter@inf.unideb. SZOFTVERES SZEMLÉLTETÉS A MESTERSÉGES INTELLIGENCIA OKTATÁSÁBAN _ Jeszenszky Péter Debreceni Egyetem, Informatikai Kar jeszenszky.peter@inf.unideb.hu Mesterséges intelligencia oktatás a DE Informatikai

Részletesebben

Adatbázis rendszerek. dr. Siki Zoltán

Adatbázis rendszerek. dr. Siki Zoltán Adatbázis rendszerek I. dr. Siki Zoltán Adatbázis fogalma adatok valamely célszerűen rendezett, szisztéma szerinti tárolása Az informatika elterjedése előtt is számos adatbázis létezett pl. Vállalati személyzeti

Részletesebben