Gyakorlati bioinformatika

Save this PDF as:
 WORD  PNG  TXT  JPG

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "Gyakorlati bioinformatika"

Átírás

1 Gyakorlati bioinformatika Szekvenciaillesztés PhD kurzus 2. Szekvenciaillesztés Bagossi Péter Fajtái: - egyszer ill. többszörös illesztés - globális ill. lokális illesztés Alkalmazása: - adatbázisokban való keresés - szekvenciák összehasonlítása - szerkezet/funkció jóslása Algoritmusok: - Smith-Waterman - Pearson-Lipman - Needleman-Wunsch Programok: - FASTA - BLAST - ClustalW Pontozási rendszereket - PAM - BLOSUM - Overington Szekvenciaillesztés HIV proteinázok egyszer illesztése A hasonlóság egy megfigyelhet, mérhet mennyiség pl. pontszám, százalék), a homológia pedig az ebbl levont minségi következtetést jelenti, azaz hogy a két gén/fehérje közös evoluciós családfáról származik. Egy adott illesztéshez számolható egy adott pontszám, azonban fontos annak meghatározása, hogy ez a pontszám elég magas-e ahhoz, hogy bizonyítsa a homológiát. Az E érték annak az eseménynek a valószínségét mutatja, hogy az adatbázisban való keresés során véletlenül kapunk azonos nagyságú pontszámot, és nagysága függ az adott szekvencia hosszától, a hasonlóságtól és az adatbázis nagyságától. HIV- HIV-2 HIV- HIV-2 PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQY PQFSLWKRPVVTAHIEGQPVEVLLDTGADDSIVAGIELGNNYSPKIVGGIGGFINTKEY ** ** ** ** * ** * ******** * ** ******* * DQIPVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF KNVEIEVLNKKVRATIMTGDTPINIFGRNILTALGMSLNL * * * * ** ** *** ** * ** Retrovirális proteinázok többszörös illesztése Retrovirális proteinázok szerkezeti illesztése HIV- PQITLW..QRPLVTIRIG...GQLKEALLDTGADDTVLEE..MN...LPGKWK..PKMIGGIGGFIKVRQY HIV-2 PQFSLW..KRPVVTAHIE...GQPVEVLLDTGADDSIVAG..IE...LGNNYS..PKIVGGIGGFINTKEY SIV PQFSLW..RRPVVTAHIE...GQPVEVLLDTGADDSIVTG..IE...LGPHYT..PKIVGGIGGFINTKEY EIAV VTYNLE..KRPTTIVLIN...DTPLNVLLDTGADTSVLTTAHYNRLKYRGRKYQ..GTGIGGVGGNVETFST FIV -TTTTLE..KRPEILIFVN...GYPIKFLLDTGADITILNRRDFQ.VKN.SIENG..RQNMIGVGGGKRGTNY RSV LAMTMEHKDRPLVRVILTNTGSHPVKQRSVYITALLDSGADITIISEEDWP...TDWPVMEAANPQIHGIGGGIPMRKS ** *** *** * ** HIV-.DQIPVEICG...HKAIGTVLVG...PTPVNIIGRNLLTQIGCTLNF.. HIV-2.KNVEIEVLN...KKVRATIMTG...DTPINIFGRNILTALGMSLNL.. SIV.KNVEIEVLG...KRIKGTIMTG...DTPINIFGRNILTALGMSLNL.. EIAV.P.VTIKKKG...RHIKTRMLVA...DIPVTILGRDILQDLGAKLVL.. FIV.INVHLEIRDENYKT.QCIFGNVCVLEDNSLIQPLLGRDNMIKFNIRLVMAQ RSV RDMIELGVINRDGSLERPLLLFPAVA...MVRGSILGRDCLQGLGLRLTNL. **

2 Szekvenciaillesztés 2 3 Globális illesztés BLAST Lokális illesztés

3 Clustal-W Clustal-X 3

4 FASTA formátum PIR formátum 4

5 Gombák D. klockeri N. crassa C. krusei sütéleszt Molekuláris evolúció Madarak pingvin Emlsök tyúk Kétéltek kecskebéka Rovarok moly tehén kutya ló nyúl légy kenguru ponty pekingi kacsa galamb tekns tonhal macskacápa angolna búza Hüllk Halak Növények bab szezám ricinus napraforgó A természetes mutációs változások szimulálhatóak két vagy több szekvencia olyan illesztésével, amelyben a változtatások számát amely egyik szekvenciát átalakítja a másikká) minimalizálták. A filogenetikai fa ennek a függvénynek a grafikus megjelenítése, amelyben a mutációk száma arányos az egyes ágak hosszúságával. gypsy-dm:0.4506, gypsy-dv:0.630) :0.2933, bfv:0.2969, efv:0.9698) : , ffv: ) : , hfv: , sfvcpz: ) : , sfv: , sfv3: ) : ) :0.4790) :0.6035, ty3:0.4323) :0.0274, ty-at:0.3865, PHYLIP PHYLogeny Inference Package, consists of 35 programs. protpars: protein parsimony dollop: Dollo and polymorphism parsimony dnapars: DNA sequence parsimony dolpenny: Dollo and polymorphism branch and bound parsimony dnapenny: DNA parsimony branch and bound dolmove: Dollo and polymorphism interactive parsimony dnamove: interactive DNA parsimony clique: 0/ characters compatibility method dnacomp: DNA compatibility factor: Character recoding program dnaml: DNA maximum likelihood drawgram: Rooted tree drawing program dnamlk: DNA maximum likelihood with clock drawtree: Unrooted tree drawing program proml: Protein sequence maximum likelihood consense: Consensus tree program promlk: Protein sequence maximum likelihood with clock treedist: Tree distance program dnainvar: DNA invariants retree: interactive tree rearrangement program dnadist: DNA distance protdist: Protein sequence distance restdist: Restriction sites and fragments distances restml: Restriction sites maximum likelihood seqboot: Bootstrapping/Jackknifing fitch: Fitch-Margoliash distance matrix method kitsch: Fitch-Margoliash distance matrix with clock neighbor: Neighbor-Joining and UPGMA method contml: Maximum likelihood continuous characters and gene frequencies contrast: Contrast method gendist: Genetic distance pars: Unordered multistate parsimony mix: Mixed method parsimony penny: Branch and bound mixed method parsimony move: Interactive mixed method parsimony PHYLIP drawgram: rooted tree drawing program drawtree: unrooted tree drawing program 5

6 2. Gyakorlati feladat Töltsd le az adatbázisból az általad korábban választott humán gén - egér, sertés és csirke homológját, majd: - illesszd össze a nukleotid szekvenciákat ClustalW) - a szekvenciákat fordítsd le fehérje szintre Expasy) - illesszd össze a fehérje szekvenciákat ClustalW) - a fehérje szekvenciákat fordítsd vissza DNS szintre Expasy) - hasonlítsd össze az eredeti és a visszafordított DNS szekvenciát ClustalW) - készitsd el a gén és a fehérje filogenetikai fáját és hasonlítsd össze ket ClustalW, Phylip) Az egybeszerkesztett dokumentumot -ben küld el a cimre! 6

Problémák és megoldások a bioinformatikában. Válogatott fejezetek a bioinformatikából. Gyimesi Gergely, 2008. február 25.

Problémák és megoldások a bioinformatikában. Válogatott fejezetek a bioinformatikából. Gyimesi Gergely, 2008. február 25. Problémák és megoldások a bioinformatikában Válogatott fejezetek a bioinformatikából Gyimesi Gergely, 2008. február 25. Mik a fontos, megoldatlan biológiai problémák? Milyen módszereket, megoldási lehetıségeket

Részletesebben

A tárgy címe: Bioinformatika

A tárgy címe: Bioinformatika A tárgy címe: Bioinformatika Kötelezően választható tárgy IV. és V. évfolyamos biológus hallgatók számára; heti 2+3 óra Előkövetelmény: Biokémia főkollégium; genetika főkollégium; alapszintű számítógépes

Részletesebben

Az evolúció az adatok mögött

Az evolúció az adatok mögött Filogenetika Az evolúció az adatok mögött Ortutay Csaba, PhD 2013 április 9 Miről lesz ma szó? Nukleotid szubsztitúciós modellek Távolság alapú módszerek UPGMA Neighbor joining Modell alapú filogenetika

Részletesebben

Molekuláris evolúció második gyakorlat

Molekuláris evolúció második gyakorlat Molekuláris evolúció második gyakorlat Szekvenciák illesztése (alignment készítés) Szekvenciák szerkesztése Programok: ClustalX (http://evolution.genetics.washington.edu/phylip/software.html) GeneDoc (http://www.psc.edu/biomed/genedoc/)

Részletesebben

Orvosi Genomtudomány 2014 Medical Genomics 2014. Április 8 Május 22 8th April 22nd May

Orvosi Genomtudomány 2014 Medical Genomics 2014. Április 8 Május 22 8th April 22nd May Orvosi Genomtudomány 2014 Medical Genomics 2014 Április 8 Május 22 8th April 22nd May Hét / 1st week (9. kalendariumi het) Takács László / Fehér Zsigmond Magyar kurzus Datum/ido Ápr. 8 Apr. 9 10:00 10:45

Részletesebben

Filogenetikai analízis. Törzsfák szerkesztése

Filogenetikai analízis. Törzsfák szerkesztése Filogenetikai analízis Törzsfák szerkesztése Neighbor joining (szomszéd összevonó) módszer A fában egymás mellé kerülı objektumok kiválasztása a távolságmátrix értékei és az objektumoknak az összes többivel

Részletesebben

A humán mitokondriális genom: Evolúció, mutációk, polimorfizmusok, populációs vonatkozások. Egyed Balázs ELTE Genetikai Tanszék

A humán mitokondriális genom: Evolúció, mutációk, polimorfizmusok, populációs vonatkozások. Egyed Balázs ELTE Genetikai Tanszék A humán mitokondriális genom: Evolúció, mutációk, polimorfizmusok, populációs vonatkozások Egyed Balázs ELTE Genetikai Tanszék Endoszimbiotikus gén-transzfer (Timmis et al., 2004, Nat Rev Gen) Endoszimbiotikus

Részletesebben

Juhász Angéla MTA ATK MI Alkalmazott Genomikai Osztály SZEKVENCIA ADATBÁZISOK

Juhász Angéla MTA ATK MI Alkalmazott Genomikai Osztály SZEKVENCIA ADATBÁZISOK Juhász Angéla MTA ATK MI Alkalmazott Genomikai Osztály SZEKVENCIA ADATBÁZISOK Fehérjét kódol? Tulajdonságai? -Hol lokalizálódik? -Oldható? -3D szerkezete? -Accession #? -Annotációja elérhető? Már benne

Részletesebben

Bakteriális identifikáció 16S rrns gén szekvencia alapján

Bakteriális identifikáció 16S rrns gén szekvencia alapján Bakteriális identifikáció 16S rrns gén szekvencia alapján MOHR ANITA SIPOS RITA, SZÁNTÓ-EGÉSZ RÉKA, MICSINAI ADRIENN 2100 Gödöllő, Szent-Györgyi Albert út 4. info@biomi.hu, www.biomi.hu TÖRZS AZONOSÍTÁS

Részletesebben

MOLEKULÁRIS FILOGENETIKAI ELEMZÉSEK EGY DISZKRÉT MATEMATIKAI

MOLEKULÁRIS FILOGENETIKAI ELEMZÉSEK EGY DISZKRÉT MATEMATIKAI Doktori értekezés tézisei MOLEKULÁRIS FILOGENETIKAI ELEMZÉSEK EGY DISZKRÉT MATEMATIKAI MÓDSZER, A BOOLE ANALÍZIS SEGÍTSÉGÉVEL Ari Eszter Dr. Jakó Éena, tudományos főmunkatárs témavezető Dr. Szathmáry Eörs,

Részletesebben

A bakteriális kommunikáció és kooperáció génjeinek elhelyezkedése ismert genomokban.

A bakteriális kommunikáció és kooperáció génjeinek elhelyezkedése ismert genomokban. A bakteriális kommunikáció és kooperáció génjeinek elhelyezkedése ismert genomokban. Az AHL szabályzórendszer génjei. Pázmány Péter Katolikus Egyetem Információs Technológiai és Bionikai Kar Multidiszciplináris

Részletesebben

Technológiai-üzemeltetési stratégiák csoportosítása hisztorikus idsorok szimbolikus epizód reprezentációján alapulva

Technológiai-üzemeltetési stratégiák csoportosítása hisztorikus idsorok szimbolikus epizód reprezentációján alapulva Technológiai-üzemeltetési stratégiák csoportosítása hisztorikus idsorok szimbolikus epizód reprezentációján alapulva Balaskó B., Németh S., Abonyi J. Pannon Egyetem Folyamatmérnöki Tanszék Tartalom QTA:

Részletesebben

3. Páronkénti szekvencia összerendezés

3. Páronkénti szekvencia összerendezés 3. Páronkénti szekvencia összerendezés 1. Alapfogalmak 2. Hasonlósági mátrixok (PAM, BLOSUM) 3. Statisztikai szignifikancia 4. A pontábrázolás 5. Lokális és globális hasonlóság 6. Globális összerendezés:

Részletesebben

DNS-szekvencia meghatározás

DNS-szekvencia meghatározás DNS-szekvencia meghatározás Gilbert 1980 (1958) Sanger 3-1 A DNS-polimerázok jellemzői 5'-3' polimeráz aktivitás 5'-3' exonukleáz 3'-5' exonukleáz aktivitás Az új szál szintéziséhez kell: templát DNS primer

Részletesebben

Animal welfare, etológia és tartástechnológia

Animal welfare, etológia és tartástechnológia Animal welfare, etológia és tartástechnológia Animal welfare, ethology and housing systems Volume 4 Issue 2 Különszám Gödöllı 2008 468 EGYEDAZONOSÍTÁS ÉS SZÁRMAZÁSELLENİRZÉS HIPERPOLIMORF MIKROSZATELLITA

Részletesebben

Mai témák. Fehérjék dinamikájának jelentősége. Számítógépes modellezés jelentősége

Mai témák. Fehérjék dinamikájának jelentősége. Számítógépes modellezés jelentősége Mai témák Fehérjék szerkezetének predikciója, szerkezeti adatok felhasználása adatbázisok segítségével, a számítógépes molekuladinamikai modellezés alapjai Hegedűs Tamás tamas@hegelab.org Bevezetés szimulációk

Részletesebben

MOLEKULÁRIS FILOGENETIKAI ELEMZÉSEK EGY DISZKRÉT MATEMATIKAI

MOLEKULÁRIS FILOGENETIKAI ELEMZÉSEK EGY DISZKRÉT MATEMATIKAI Doktori értekezés MOLEKULÁRIS FILOGENETIKAI ELEMZÉSEK EGY DISZKRÉT MATEMATIKAI MÓDSZER, A BOOLE ANALÍZIS SEGÍTSÉGÉVEL Ari Eszter Dr. Jakó Éena, tudományos főmunkatárs témavezető Dr. Szathmáry Eörs, egyetemi

Részletesebben

BIOINFORMATIKA Ungvári Ildikó

BIOINFORMATIKA Ungvári Ildikó 1 BIOINFORMATIKA Ungvári Ildikó Az elmúlt évtizedekben a molekuláris biológiai, genomikai technológiák robbanásszerű fejlődése a biológiai adatok mennyiségének exponenciális növekedéséhez vezetett. Ebben

Részletesebben

Biokémiai hasonlóságok

Biokémiai hasonlóságok Biokémiai hasonlóságok Ha összehasonlítjuk a különböző fajok fehérjéit, arra a meglepő eredményre jutunk, hogy a vizsgálatok eredménye végső soron nem támogatja az evolúciós elképzelést. Sok ember számára

Részletesebben

DOKTORI ÉRTEKEZÉS TÉZISEI. Hepatitiszt okozó vírusok molekuláris vizsgálata. N. Szomor Katalin. Budapest 2009.

DOKTORI ÉRTEKEZÉS TÉZISEI. Hepatitiszt okozó vírusok molekuláris vizsgálata. N. Szomor Katalin. Budapest 2009. DOKTORI ÉRTEKEZÉS TÉZISEI Hepatitiszt okozó vírusok molekuláris vizsgálata N. Szomor Katalin Budapest 2009. 2 1. BEVEZETÉS A világ legjelentősebb népegészségügyi problémái közé tartozik a vírusok által

Részletesebben

Genomadatbázisok Ld. Entrez Genome: Összes ismert genom, hierarchikus szervezésben (kromoszóma, térképek, gének, stb.)

Genomadatbázisok Ld. Entrez Genome: Összes ismert genom, hierarchikus szervezésben (kromoszóma, térképek, gének, stb.) Genomika Új korszak, paradigmaváltás, forradalom: a teljes genomok ismeretében a biológia adatokban gazdag tudománnyá válik. Új kutatási módszerek, új szemlélet. Hajtóerõk: Genomszekvenálási projektek

Részletesebben

NÖVÉNYI GENOMIKA JÓRI BALÁZS

NÖVÉNYI GENOMIKA JÓRI BALÁZS NÖVÉNYI GENOMIKA JÓRI BALÁZS Eötvös Loránd Tudományegyetem, Növényélettani és Molekuláris Növénybiológia Tanszék, 1117 Budapest, Pázmány P. sétány 1/c. Elfogadva: 2004. december 29. Bot. Közlem. 91(1 2):

Részletesebben

Zárójelentés. Állati rotavírusok összehasonlító genomvizsgálata. c. OTKA kutatási programról. Bányai Krisztián (MTA ATK ÁOTI)

Zárójelentés. Állati rotavírusok összehasonlító genomvizsgálata. c. OTKA kutatási programról. Bányai Krisztián (MTA ATK ÁOTI) Zárójelentés Állati rotavírusok összehasonlító genomvizsgálata c. OTKA kutatási programról Bányai Krisztián (MTA ATK ÁOTI) 2012 1 Az Állati rotavírusok összehasonlító genomvizsgálata c. programban azt

Részletesebben

Szent István Egyetem Állatorvos-tudományi Doktori Iskola. Sertés circovírusok járványtani vizsgálata

Szent István Egyetem Állatorvos-tudományi Doktori Iskola. Sertés circovírusok járványtani vizsgálata Szent István Egyetem Állatorvos-tudományi Doktori Iskola Sertés circovírusok járványtani vizsgálata PhD dolgozat tézisei Készítette: Dr. Cságola Attila Témavezet : Dr. Tuboly Tamás 2009 Szent István Egyetem

Részletesebben

Bioinformatika előadás

Bioinformatika előadás Bioinformatika 2 11. előadás Prof. Poppe László BME Szerves Kémia és Technológia Tsz. Bioinformatika proteomika Előadás és gyakorlat 2016.11.28. Bioinformatics Szerkezeti genomika, proteomika, biológia

Részletesebben

Evolúcióbiológia. Biológus B.Sc tavaszi félév

Evolúcióbiológia. Biológus B.Sc tavaszi félév Evolúcióbiológia Biológus B.Sc. 2011. tavaszi félév A biológiában minden csak az evolúció fényében válik érthetővé Theodosius Dobzhansky : Nothing in biology makes sense except in the light of evolution.

Részletesebben

KIEGÉSZÍTŽ FELADATOK. Készlet Bud. Kap. Pápa Sopr. Veszp. Kecsk. 310 4 6 8 10 5 Pécs 260 6 4 5 6 3 Szomb. 280 9 5 4 3 5 Igény 220 200 80 180 160

KIEGÉSZÍTŽ FELADATOK. Készlet Bud. Kap. Pápa Sopr. Veszp. Kecsk. 310 4 6 8 10 5 Pécs 260 6 4 5 6 3 Szomb. 280 9 5 4 3 5 Igény 220 200 80 180 160 KIEGÉSZÍTŽ FELADATOK (Szállítási probléma) Árut kell elszállítani három telephelyr l (Kecskemét, Pécs, Szombathely) öt területi raktárba, melyek Budapesten, Kaposváron, Pápán, Sopronban és Veszprémben

Részletesebben

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Azonosító szám: TÁMOP-4.1.2-08/1/A-2009-0011 Az orvosi

Részletesebben

Az evolúció folyamatos változások olyan sorozata, melynek során bizonyos populációk öröklődő jellegei nemzedékről nemzedékre változnak.

Az evolúció folyamatos változások olyan sorozata, melynek során bizonyos populációk öröklődő jellegei nemzedékről nemzedékre változnak. Evolúció Az evolúció folyamatos változások olyan sorozata, melynek során bizonyos populációk öröklődő jellegei nemzedékről nemzedékre változnak. Latin eredetű szó, jelentése: kibontakozás Időben egymást

Részletesebben

FOLOSIREA BAZELOR DE DATE GENETICE ÎN EDUCAŢIE GENETIKAI ADATBÁZISOK FELHASZNÁLÁSA AZ OKTATÁSBAN

FOLOSIREA BAZELOR DE DATE GENETICE ÎN EDUCAŢIE GENETIKAI ADATBÁZISOK FELHASZNÁLÁSA AZ OKTATÁSBAN FOLOSIREA BAZELOR DE DATE GENETICE ÎN EDUCAŢIE GENETIKAI ADATBÁZISOK FELHASZNÁLÁSA AZ OKTATÁSBAN Prof. József Éva Liceul Teoretic Bolyai Farkas, Tg.Mureş, Mureş De ce să folosim baze de date genetice în

Részletesebben

Szent István Egyetem Állatorvos-tudományi Doktori Iskola

Szent István Egyetem Állatorvos-tudományi Doktori Iskola Szent István Egyetem Állatorvos-tudományi Doktori Iskola Kígyó-adeno- és parvovírus teljes genomjának szekvenciája és analízise, mindkét víruscsaládban az elsõ molekuláris elemzések hüllõ-eredetû izolátummal

Részletesebben

Biomassza alapú bioalkohol előállítási technológia fejlesztése metagenomikai eljárással

Biomassza alapú bioalkohol előállítási technológia fejlesztése metagenomikai eljárással Biomassza alapú bioalkohol előállítási technológia fejlesztése metagenomikai eljárással Kovács Zoltán ügyvezető DEKUT Debreceni Kutatásfejlesztési Közhasznú Nonprofit Kft. Problémadefiníció Első generációs

Részletesebben

NÖVÉNYGENETIKA. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP /1/A

NÖVÉNYGENETIKA. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP /1/A NÖVÉNYGENETIKA Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 A citológia és a genetika társtudománya Citogenetika A kromoszómák eredetét, szerkezetét, genetikai funkcióját,

Részletesebben

SZÁLLÍTÁSI FELADAT KÖRUTAZÁSI MODELL WINDOWS QUANTITATIVE SUPPORT BUSINESS PROGRAMMAL (QSB) JEGYZET Ábragyűjtemény Dr. Réger Béla LÉPÉSRŐL - LÉPÉSRE

SZÁLLÍTÁSI FELADAT KÖRUTAZÁSI MODELL WINDOWS QUANTITATIVE SUPPORT BUSINESS PROGRAMMAL (QSB) JEGYZET Ábragyűjtemény Dr. Réger Béla LÉPÉSRŐL - LÉPÉSRE SZÁLLÍTÁSI FELADAT KÖRUTAZÁSI MODELL WINDOWS QUANTITATIVE SUPPORT BUSINESS PROGRAMMAL (QSB) JEGYZET Ábragyűjtemény Dr. Réger Béla LÉPÉSRŐL - LÉPÉSRE KÖRUTAZÁSI MODELL AVAGY AZ UTAZÓÜGYNÖK PROBLÉMÁJA Induló

Részletesebben

Idősorok elemzése. Salánki Ágnes

Idősorok elemzése. Salánki Ágnes Idősorok elemzése Salánki Ágnes salanki.agnes@gmail.com 2012.04.13. Budapesti Műszaki és Gazdaságtudományi Egyetem Méréstechnika és Információs Rendszerek Tanszék 1 Idősorok analízise Alapfogalmak Komponenselemzés

Részletesebben

Mesterséges Intelligencia. Csató Lehel. Csató Lehel. Matematika-Informatika Tanszék Babeş Bolyai Tudományegyetem, Kolozsvár 2007/2008

Mesterséges Intelligencia. Csató Lehel. Csató Lehel. Matematika-Informatika Tanszék Babeş Bolyai Tudományegyetem, Kolozsvár 2007/2008 Matematika-Informatika Tanszék Babeş Bolyai Tudományegyetem, Kolozsvár 2007/2008 Az Előadások Témái Bevezető: mi a mesterséges intelligencia... Tudás reprezentáció stratégiák Szemantikus hálók / Keretrendszerek

Részletesebben

A HUMÁN GENOM PROJEKT Sasvári-Székely Mária* Semmelweis Egyetem, Orvosi Vegytani, Molekuláris Biológiai és Pathobiokémiai Intézet

A HUMÁN GENOM PROJEKT Sasvári-Székely Mária* Semmelweis Egyetem, Orvosi Vegytani, Molekuláris Biológiai és Pathobiokémiai Intézet A HUMÁN GENOM PROJEKT Sasvári-Székely Mária* Semmelweis Egyetem, Orvosi Vegytani, Molekuláris Biológiai és Pathobiokémiai Intézet *Levelezési cím: Dr. Sasvári-Székely Mária, Semmelweis Egyetem, Orvosi

Részletesebben

A mutáns fenotípushoz szorosan kapcsolt markerek (1N1R és U212D) segítségével BAC (Bacterial Artifical Chromosome) klónokat azonosítottunk egy másik

A mutáns fenotípushoz szorosan kapcsolt markerek (1N1R és U212D) segítségével BAC (Bacterial Artifical Chromosome) klónokat azonosítottunk egy másik A szimbiotikus gümő kialakulásában résztvevő két gén azonosítása Medicago truncatulaból térképezésen alapuló génizolálással c. OTKA pályázat (T046645) zárójelentése A pályázat célja a Sinorhizobium meliloti

Részletesebben

Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis

Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis Szerkezet Protein Data Bank (PDB) http://www.rcsb.org/pdb ~ 35 701 szerkezet közepes felbontás 1552 szerkezet d 1.5 Å 160 szerkezet d 1.0 Å 10 szerkezet d 0.8 Å (atomi felbontás) E globális minimum? funkció

Részletesebben

Interaktív, grafikus környezet. Magasszintû alkalmazási nyelv (KAL) Integrált grafikus interface könyvtár. Intelligens kapcsolat más szoftverekkel

Interaktív, grafikus környezet. Magasszintû alkalmazási nyelv (KAL) Integrált grafikus interface könyvtár. Intelligens kapcsolat más szoftverekkel Készítette: Szabó Gábor, 1996 Az Az IntelliCorp IntelliCorp stratégiája: stratégiája: Kifinomult, Kifinomult, objektum-orientált objektum-orientált környezetet környezetet biztosít biztosít tervezéséhez,

Részletesebben

Fehérjék szerkezetének predikciója, szerkezeti adatok felhasználása adatbázisok segítségével, a számítógépes molekuladinamikai modellezés alapjai

Fehérjék szerkezetének predikciója, szerkezeti adatok felhasználása adatbázisok segítségével, a számítógépes molekuladinamikai modellezés alapjai Fehérjék szerkezetének predikciója, szerkezeti adatok felhasználása adatbázisok segítségével, a számítógépes molekuladinamikai modellezés alapjai Hegedűs Tamás tamas@hegelab.org MTA-SE Membránbiológiai

Részletesebben

Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 projekt

Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 projekt Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 projekt ÁLLATGENETIKA Debreceni Egyetem Nyugat-magyarországi Egyetem Pannon Egyetem A projekt az Európai Unió támogatásával, az

Részletesebben

Mesterséges Intelligencia. Csató Lehel. Csató Lehel. Matematika-Informatika Tanszék Babeş Bolyai Tudományegyetem, Kolozsvár 2010/2011 1/363

Mesterséges Intelligencia. Csató Lehel. Csató Lehel. Matematika-Informatika Tanszék Babeş Bolyai Tudományegyetem, Kolozsvár 2010/2011 1/363 1/363 Matematika-Informatika Tanszék Babeş Bolyai Tudományegyetem, Kolozsvár 2010/2011 Az Előadások Témái 69/363 Bevezető: mi a mesterséges intelligencia... Tudás reprezentáció Gráfkeresési stratégiák

Részletesebben

1A-029-2006 1A-048-2006 A1-0069-2006 2006 2006 2006

1A-029-2006 1A-048-2006 A1-0069-2006 2006 2006 2006 A1 ndikátor 1A-029-2006 1A-048-2006 A1-0069-2006 2006 2006 2006 jelentés jelentés Eredményezett-e új nemzetközi projektet? (/N) eredményeit? (/N), milyen formában? gen, nappali, egyetemi hallgatók PhD

Részletesebben

Programozási módszertan. Dinamikus programozás: A leghosszabb közös részsorozat

Programozási módszertan. Dinamikus programozás: A leghosszabb közös részsorozat PM-07 p. 1/13 Programozási módszertan Dinamikus programozás: A leghosszabb közös részsorozat Werner Ágnes Villamosmérnöki és Információs Rendszerek Tanszék e-mail: werner.agnes@virt.uni-pannon.hu PM-07

Részletesebben

MUTÁCIÓK. A mutáció az örökítő anyag spontán, maradandó megváltozása, amelynek során új genetikai tulajdonság keletkezik.

MUTÁCIÓK. A mutáció az örökítő anyag spontán, maradandó megváltozása, amelynek során új genetikai tulajdonság keletkezik. MUTÁCIÓK A mutáció az örökítő anyag spontán, maradandó megváltozása, amelynek során új genetikai tulajdonság keletkezik. Pontmutáció: A kromoszóma egy génjében pár nukleotidnál következik be változás.

Részletesebben

Humán genom variációk single nucleotide polymorphism (SNP)

Humán genom variációk single nucleotide polymorphism (SNP) Humán genom variációk single nucleotide polymorphism (SNP) A genom ~ 97 %-a két különböző egyedben teljesen azonos ~ 1% különbség: SNP miatt ~2% különbség: kópiaszámbeli eltérés, deléciók miatt 11-12 millió

Részletesebben

ÁLLATTENYÉSZTÉSI TUDOMÁNYOK DOKTORI ISKOLA Doktori Iskola vezető: Dr. Bánszki Tamás, MTA doktora. Témavezetők: mezőgazdaság-tudomány kandidátusa

ÁLLATTENYÉSZTÉSI TUDOMÁNYOK DOKTORI ISKOLA Doktori Iskola vezető: Dr. Bánszki Tamás, MTA doktora. Témavezetők: mezőgazdaság-tudomány kandidátusa DEBRECENI EGYETEM AGRÁRTUDOMÁNYI CENTRUM MEZŐGAZDASÁGTUDOMÁNYI KAR ÁLLATTENYÉSZTÉS- ÉS TAKARMÁNYOZÁSTANI TANSZÉK ÁLLATTENYÉSZTÉSI TUDOMÁNYOK DOKTORI ISKOLA Doktori Iskola vezető: Dr. Bánszki Tamás, MTA

Részletesebben

Epigenetikai Szabályozás

Epigenetikai Szabályozás Epigenetikai Szabályozás Kromatin alapegysége a nukleoszóma 1. DNS Linker DNS Nukleoszóma mag H1 DNS 10 nm 30 nm Nukleoszóma gyöngy (4x2 hiszton molekula + 146 nukleotid pár) 10 nm-es szál 30 nm-es szál

Részletesebben

Természetismeret 4. osztály - 3. forduló -

Természetismeret 4. osztály - 3. forduló - MERJ A LEGJOBB LENNI! A TEHETSÉGGONDOZÁS FELTÉTELRENDSZERÉNEK FEJLESZTÉSE A GYOMAENDRŐDI KIS BÁLINT ISKOLA ÉS ÓVODÁBAN AZONOSÍTÓ SZÁM: TÁMOP-3.4.3-08/2-2009-0053 PROJEKT KEDVEZMÉNYEZETT: KIS BÁLINT ÁLTALÁNOS

Részletesebben

Fehérje expressziós rendszerek. Gyógyszerészi Biotechnológia

Fehérje expressziós rendszerek. Gyógyszerészi Biotechnológia Fehérje expressziós rendszerek Gyógyszerészi Biotechnológia Expressziós rendszerek Cél: rekombináns fehérjék előállítása nagy tisztaságban és nagy mennyiségben kísérleti ill. gyakorlati (therapia) felhasználásokra

Részletesebben

Molekuláris genetikai vizsgáló. módszerek az immundefektusok. diagnosztikájában

Molekuláris genetikai vizsgáló. módszerek az immundefektusok. diagnosztikájában Molekuláris genetikai vizsgáló módszerek az immundefektusok diagnosztikájában Primer immundefektusok A primer immundeficiencia ritka, veleszületett, monogénes öröklődésű immunhiányos állapot. Családi halmozódást

Részletesebben

PROKARIÓTA GENOMOK ÖSSZEHASONLÍTÓ ANALÍZISE BIOINFORMATIKAI MÓDSZEREKKEL. Doktori (Ph.D.) értekezés tézisei. Kassainé Jáger Edit Andrea

PROKARIÓTA GENOMOK ÖSSZEHASONLÍTÓ ANALÍZISE BIOINFORMATIKAI MÓDSZEREKKEL. Doktori (Ph.D.) értekezés tézisei. Kassainé Jáger Edit Andrea PROKARIÓTA GENOMOK ÖSSZEHASONLÍTÓ ANALÍZISE BIOINFORMATIKAI MÓDSZEREKKEL Doktori (Ph.D.) értekezés tézisei Kassainé Jáger Edit Andrea Biológia Doktori Iskola Vezetője: Dr. Erdei Anna egyetemi tanár, az

Részletesebben

Bioinformatika gyakorlat csilabusz

Bioinformatika gyakorlat csilabusz Bioinformatika gyakorlat csilabusz Cserháti Mátyás Szeged Tudományegyetem BioEdit Szekvencia szerkesztő és elemző program Honlap: http://www.mbio.ncsu.edu/bioedit/bioedit.html Telepítés: Elég egyszerű:

Részletesebben

7. Fehérjeszekvenciák és térszerkezetek analízise.

7. Fehérjeszekvenciák és térszerkezetek analízise. 7. Fehérjeszekvenciák és térszerkezetek analízise. 1. Egyszerû elemzések 2. Térszerkezet predikció 2.1. A probléma bonyolultsága 2.2. A predikció szintjei 2.3. 1D predikciók (másodlagos szerkezet, hozzáférhetõség,

Részletesebben

Bioinformatika 2 5.. előad

Bioinformatika 2 5.. előad 5.. előad adás Prof. Poppe László BME Szerves Kémia és Technológia Tsz. Bioinformatika proteomika Előadás és gyakorlat 2009. 03. 21. Fehérje térszerkezet t megjelenítése A fehérjék meglehetősen összetett

Részletesebben

A bakteriális kommunikáció és kooperáció génjeinek elhelyezkedése ismert genomokban.

A bakteriális kommunikáció és kooperáció génjeinek elhelyezkedése ismert genomokban. A bakteriális kommunikáció és kooperáció génjeinek elhelyezkedése ismert genomokban. Az AHL szabályzórendszer génjei. Pázmány Péter Katolikus Egyetem Információs Technológiai és Bionikai Kar Multidiszciplináris

Részletesebben

Szekvencia összehasonlítások II. Bioinformatika és genom analízis az orvostudományban (AOGENBIG_1M)

Szekvencia összehasonlítások II. Bioinformatika és genom analízis az orvostudományban (AOGENBIG_1M) Szekvencia összehasonlítások II. Bioinformatika és genom analízis az orvostudományban (AOGENBIG_1M) Miklós István SOTE, 21. október 28. DNS-szekvenciák összeszerelése Ún. shot-gun szekvenálással lehet

Részletesebben

AZ EGRI BORVIDÉK BOTRYTIS CINEREA POPULÁCIÓINAK GENETIKAI JELLEMZÉSE

AZ EGRI BORVIDÉK BOTRYTIS CINEREA POPULÁCIÓINAK GENETIKAI JELLEMZÉSE AZ EGRI BORVIDÉK BOTRYTIS CINEREA POPULÁCIÓINAK GENETIKAI JELLEMZÉSE Sándor Erzsébet 1 Váczy Kálmán 2 Kövics György János 1 Karaffa Levente 3 1 Debreceni Egyetem, Agrártudományi Centrum, Mez gazdaságtudományi

Részletesebben

BIOLÓGIA OSZTÁLYOZÓ VIZSGA ÉS JAVÍTÓVIZSGA KÖVETELMÉNYEK (2016)

BIOLÓGIA OSZTÁLYOZÓ VIZSGA ÉS JAVÍTÓVIZSGA KÖVETELMÉNYEK (2016) BIOLÓGIA OSZTÁLYOZÓ VIZSGA ÉS JAVÍTÓVIZSGA KÖVETELMÉNYEK (2016) 1 Biológia tantárgyból mindhárom évfolyamon (10.-11.-12.) írásbeli és szóbeli vizsga van. A vizsga részei írásbeli szóbeli Írásbeli Szóbeli

Részletesebben

TÉMAKÖRÖK. Ősi RNS világ BEVEZETÉS. RNS-ek tradicionális szerepben

TÉMAKÖRÖK. Ősi RNS világ BEVEZETÉS. RNS-ek tradicionális szerepben esirna mirtron BEVEZETÉS TÉMAKÖRÖK Ősi RNS világ RNS-ek tradicionális szerepben bevezetés BIOLÓGIAI MOLEKULÁK FEHÉRJÉK NUKLEINSAVAK DNS-ek RNS-ek BIOLÓGIAI MOLEKULÁK FEHÉRJÉK NUKLEINSAVAK DNS-ek RNS-ek

Részletesebben

Kutyafélék viselkedésgenetikája. Miklósi Ádám 2015

Kutyafélék viselkedésgenetikája. Miklósi Ádám 2015 Kutyafélék viselkedésgenetikája Miklósi Ádám 2015 Kutyagenom 2N = 78 kromoszóma (minden Canis-nak!) (hány faj?) C. lupus, C. latrans, C. aureus hibridek) Autoszómák acrocentrikusak (egy karúak) Nemi kromoszómák

Részletesebben

Szent István Egyetem Állatorvos-tudományi Doktori Iskola. Rágcsálók és denevérek adenovírusainak genetikai elemzése

Szent István Egyetem Állatorvos-tudományi Doktori Iskola. Rágcsálók és denevérek adenovírusainak genetikai elemzése Szent István Egyetem Állatorvos-tudományi Doktori Iskola Rágcsálók és denevérek adenovírusainak genetikai elemzése PhD értekezés tézisei Vidovszky Márton 2015 Szent István Egyetem Állatorvos-tudományi

Részletesebben

Fehérjék rövid bevezetés

Fehérjék rövid bevezetés Receptorfehérj rjék szerkezetének felderítése Homológia modellezés Fehérjék rövid bevezetés makromolekulák számos biológiai funkció hordozói: enzimatikus katalízis, molekula transzport, immunválaszok,

Részletesebben

A genomikai oktatás helyzete a Debreceni Egyetemen

A genomikai oktatás helyzete a Debreceni Egyetemen A genomikai oktatás helyzete a Debreceni Egyetemen Bálint Bálint L. GNTP Oktatás és Tudásmenedzsment Munkabizottság, 2009. június 10. Tények Debreceni Egyetemről 21000 nappali és 33000 összes hallgató

Részletesebben

TRYPODENDRON FAJOK (Coleoptera, Curculionidae, Scolytinae) FILOGENETIKAI ÖSSZEHASONLÍTÁSA

TRYPODENDRON FAJOK (Coleoptera, Curculionidae, Scolytinae) FILOGENETIKAI ÖSSZEHASONLÍTÁSA NYUGAT-MAGYARORSZÁGI EGYETEM ERDŐMÉRNÖKI KAR ERDŐMŰVELÉSI ÉS ERDŐVÉDELMI INTÉZET Eredics Attila TRYPODENDRON FAJOK (Coleoptera, Curculionidae, Scolytinae) FILOGENETIKAI ÖSSZEHASONLÍTÁSA Konzulens: Dr.

Részletesebben

A NIMROD SZUPERGÉNCSALÁD EVOLÚCIÓJA

A NIMROD SZUPERGÉNCSALÁD EVOLÚCIÓJA A NIMROD SZUPERGÉNCSALÁD EVOLÚCIÓJA Ph.D. értekezés tézisei Sipos Botond Témavezető: Dr. Pénzes Zsolt Konzulens: Dr. Somogyi Kálmán Szegedi Tudományegyetem Biológia Doktori Iskola MTA Szegedi Biológiai

Részletesebben

10. CSI. A molekuláris biológiai technikák alkalmazásai

10. CSI. A molekuláris biológiai technikák alkalmazásai 10. CSI. A molekuláris biológiai technikák alkalmazásai A DNS mint azonosító 3 milliárd bázispár az emberi DNS-ben (99.9%-ban azonos) 0.1%-nyi különbség elegendő az egyedek megkülönböztetéséhez Genetikai

Részletesebben

A genetikai lelet értelmezése monogénes betegségekben

A genetikai lelet értelmezése monogénes betegségekben A genetikai lelet értelmezése monogénes betegségekben Tory Kálmán Semmelweis Egyetem, I. sz. Gyermekklinika A ~20 ezer fehérje-kódoló gén a 23 pár kromoszómán A kromoszómán található bázisok száma: 250M

Részletesebben

Bioinformatikai algoritmusok

Bioinformatikai algoritmusok Bioinformatikai algoritmusok Készítette: Németh Andrea Nappali tagozat Programtervez matematikus szak Témavezet : Dr. Iványi Antal Miklós 2009. június 6. 1 Tartalomjegyzék 1. Bevezetés 2 2. Alap deníciók,

Részletesebben

11. évfolyam esti, levelező

11. évfolyam esti, levelező 11. évfolyam esti, levelező I. AZ EMBER ÉLETMŰKÖDÉSEI II. ÖNSZABÁLYOZÁS, ÖNREPRODUKCIÓ 1. A szabályozás információelméleti vonatkozásai és a sejtszintű folyamatok (szabályozás és vezérlés, az idegsejt

Részletesebben

Szakmai önéletrajz febr.16.

Szakmai önéletrajz febr.16. Szakmai önéletrajz Név: Dr. Milley György Máté Foglalkozás: általános orvos (79874) Beosztás: Ph.D. hallgató Jelenlegi munkahely: Semmelweis Egyetem (SE) Genomikai Medicina és Ritka Betegségek Intézete,

Részletesebben

Human Genome Project, 1990-2005 5 évvel a tervezett befezés előtt The race is over, victory for Craig Venter. The genome is mapped* - now what?

Human Genome Project, 1990-2005 5 évvel a tervezett befezés előtt The race is over, victory for Craig Venter. The genome is mapped* - now what? 2000 június 26 Új út kezdete, vagy egy út vége? Human Genome Project, 1990-2005 5 évvel a tervezett befezés előtt The race is over, victory for Craig Venter. The genome is mapped* - now what? 2000 június

Részletesebben

trns-ek identitásvizsgálata új, in silico módszerrel

trns-ek identitásvizsgálata új, in silico módszerrel trns-ek identitásvizsgálata új, in silico módszerrel Doktori (PhD) értekezés tézisei Szenes Áron Témavezetők: Dr. Pál Gábor docens és Dr. Jakó Éena tudományos főmunkatárs Eötvös Loránd Tudományegyetem

Részletesebben

avagy az ipari alkalmazhatóság kérdése biotechnológiai tárgyú szabadalmi bejelentéseknél Dr. Győrffy Béla, Egis Nyrt., Budapest

avagy az ipari alkalmazhatóság kérdése biotechnológiai tárgyú szabadalmi bejelentéseknél Dr. Győrffy Béla, Egis Nyrt., Budapest Iparilag alkalmazható szekvenciák, avagy az ipari alkalmazhatóság kérdése biotechnológiai tárgyú szabadalmi bejelentéseknél Dr. Győrffy Béla, Egis Nyrt., Budapest Neutrokin α - jelentős kereskedelmi érdekek

Részletesebben

A humán astrovírusok jellemzői és szerepük a hazai gasztroenterális fertőzésekben klinikai, molekuláris epidemiológiai és filogenetikai vizsgálatok

A humán astrovírusok jellemzői és szerepük a hazai gasztroenterális fertőzésekben klinikai, molekuláris epidemiológiai és filogenetikai vizsgálatok A humán astrovírusok jellemzői és szerepük a hazai gasztroenterális fertőzésekben klinikai, molekuláris epidemiológiai és filogenetikai vizsgálatok Ph.D. tézis Jakab Ferenc Programvezető: Prof. Dr. Emődy

Részletesebben

A KALPAIN ÉS A PROTEIN KINÁZ/FOSZFATÁZ RENDSZEREK VIZSGÁLATA

A KALPAIN ÉS A PROTEIN KINÁZ/FOSZFATÁZ RENDSZEREK VIZSGÁLATA EGYETEMI DOKTORI (Ph.D.) ÉRTEKEZÉS TÉZISEI A KALPAIN ÉS A PROTEIN KINÁZ/FOSZFATÁZ RENDSZEREK VIZSGÁLATA Kölcsönhatás a posztszintetikus fehérje módosító rendszerek között Kovács László DEBRECENI EGYETEM

Részletesebben

A gidrán fajta genetikai változatosságának jellemzése mitokondriális DNS polimorfizmusokkal Kusza Szilvia Sziszkosz Nikolett Mihók Sándor,

A gidrán fajta genetikai változatosságának jellemzése mitokondriális DNS polimorfizmusokkal Kusza Szilvia Sziszkosz Nikolett Mihók Sándor, 1 A gidrán fajta genetikai változatosságának jellemzése mitokondriális DNS polimorfizmusokkal Kusza Szilvia Sziszkosz Nikolett Mihók Sándor, (Debreceni Egyetem Állattenyésztéstani Tanszék) A bármilyen

Részletesebben

Alkalmazott Biotechnológia és Élelmiszer-tudományi Tanszék. TDK bemutató, 2014. március 12.

Alkalmazott Biotechnológia és Élelmiszer-tudományi Tanszék. TDK bemutató, 2014. március 12. Alkalmazott Biotechnológia és Élelmiszer-tudományi Tanszék TDK bemutató, 2014. március 12. A NIR spektroszkópia biotechnológiai alkalmazásai Prof. Salgó András Dr. Gergely Szilveszter salgo@mail.bme.hu

Részletesebben

Laboratóriumi vizsgálatok összehasonlító elemzése 2010-2013

Laboratóriumi vizsgálatok összehasonlító elemzése 2010-2013 Laboratóriumi vizsgálatok összehasonlító elemzése 2010-2013 dr. Kramer Mihály tanácsadó Magyar Diagnosztikum Gyártók és Forgalmazók Egyesülete (HIVDA) 2014.08.30 MLDT 57 Nyíregyháza 1 Célkitűzések Négy

Részletesebben

Érdekes informatika feladatok

Érdekes informatika feladatok A keres,kkel és adatbázissal ellátott lengyel honlap számos díjat kapott: Spirit of Delphi '98, Delphi Community Award, Poland on the Internet, Golden Bagel Award stb. Az itt megtalálható komponenseket

Részletesebben

Györffyné Jahnke Gizella 1 - Smidla József 2

Györffyné Jahnke Gizella 1 - Smidla József 2 Györffyné Jahnke Gizella 1 - Smidla József 2 MolMarker - Molekuláris markerekkel kapott kutatási eredmények értékelését segítő felhasználóbarát szoftver MolMarker - User-friendly software to help evaluate

Részletesebben

Conserved ortholog set (COS) markerek térképezése Aegilops kromoszómákon

Conserved ortholog set (COS) markerek térképezése Aegilops kromoszómákon Conserved ortholog set (COS) markerek térképezése Aegilops kromoszómákon Rövid tanulmányút 2011. 01.03-03. 30., John Inn Centre, Dept. of Crop Genetics, Norwich Research Park, Norwich NR4 7UH, UK Supervisor:

Részletesebben

2. Ismert térszerkezetű transzmembrán fehérjék adatbázisa: a PDBTM adatbázis. 3. A transzmembrán fehérje topológiai adatbázis, a TOPDB szerver

2. Ismert térszerkezetű transzmembrán fehérjék adatbázisa: a PDBTM adatbázis. 3. A transzmembrán fehérje topológiai adatbázis, a TOPDB szerver A 2005 és 2007 között megvalósított project célja transzmembrán fehérjék vizsgálata és az ehhez szükséges eljárások kifejlesztése volt. Ez utóbbi magába foglalta új adatbázisok és szerkezet becslő módszerek

Részletesebben

Gazdasági Matematika I. Megoldások

Gazdasági Matematika I. Megoldások . (4.feladatlap/2) Gazdasági Matematika I. Di erenciálszámítás alkalmazásai Megoldások a) Határozza meg az f(x) x 6x 2 + függvény x 2 helyen vett érint½ojének az egyenletét. El½oször meghatározzuk a pont

Részletesebben

Egy családfaszerkesztő alkalmazás leírása

Egy családfaszerkesztő alkalmazás leírása Egy családfaszerkesztő alkalmazás leírása 1. Projektleírás 1.1. Termék neve: Családfaszerkesztő 1.2. Csoporttagok: Bagoly Gellért Balogh Réka Szabó Ádám Imre Tokay Géza 1 2. Követelményspecifikáció 2.1.

Részletesebben

A MADÁRINFLUENZA ÉS AKTUÁLIS VONATKOZÁSAI

A MADÁRINFLUENZA ÉS AKTUÁLIS VONATKOZÁSAI Szent István Egyetem, Állatorvos-tudományi Kar, Járványtani és Mikrobiológiai Tanszék A MADÁRINFLUENZA ÉS AKTUÁLIS VONATKOZÁSAI Fodor László egyetemi tanár Magyar Állatorvosok Világszervezete Lviv/Lemberg,

Részletesebben

Taxonómiai kutatások jelene és jövője a bagolylepkészetben

Taxonómiai kutatások jelene és jövője a bagolylepkészetben Taxonómiai kutatások jelene és jövője a bagolylepkészetben Ronkay László MTM Állattára Nyitó megjegyzések - hiszen ha lehetne erről a témáról is kerekasztalbeszélgetést tartani... - miről és hogyan lehetne

Részletesebben

Gerinces és növényi ortológ promóter adatbázisok fejlesztése és elemzése. Eötvös Loránd Tudományegyetem Természettudományi Kar Biológia Doktori Iskola

Gerinces és növényi ortológ promóter adatbázisok fejlesztése és elemzése. Eötvös Loránd Tudományegyetem Természettudományi Kar Biológia Doktori Iskola Doktori értekezés tézisei Gerinces és növényi ortológ promóter adatbázisok fejlesztése és elemzése Sebestyén Endre Eötvös Loránd Tudományegyetem Természettudományi Kar Biológia Doktori Iskola Vezetője:

Részletesebben

Intelligens Rendszerek Elmélete. Párhuzamos keresés genetikus algoritmusokkal

Intelligens Rendszerek Elmélete. Párhuzamos keresés genetikus algoritmusokkal Intelligens Rendszerek Elmélete Dr. Kutor László Párhuzamos keresés genetikus algoritmusokkal http://mobil.nik.bmf.hu/tantargyak/ire.html login: ire jelszó: IRE0 IRE / A természet általános kereső algoritmusa:

Részletesebben

Alkímia Ma. az anyagról mai szemmel, a régiek megszállottságával. http://www.chem.elte.hu/alkimia_2015_16 KÖZÉPISKOLAI KÉMIAI LAPOK

Alkímia Ma. az anyagról mai szemmel, a régiek megszállottságával. http://www.chem.elte.hu/alkimia_2015_16 KÖZÉPISKOLAI KÉMIAI LAPOK Alkímia Ma az anyagról mai szemmel, a régiek megszállottságával http://www.chem.elte.hu/alkimia_2015_16 KÖZÉPISKOLAI KÉMIAI LAPOK ALKÍMIA MA KVÍZ Schiller Róbert Te miért gondolod, hogy vannak molekulák?

Részletesebben

Tapasztalataink és a diagnosztika nehézségei a hazai avian influenzajárvány során

Tapasztalataink és a diagnosztika nehézségei a hazai avian influenzajárvány során Tapasztalataink és a diagnosztika nehézségei a hazai avian influenzajárvány során Bistyák Andrea, Thuma Ákos PhD, Hortobágyi Eleonóra, Gyuris Éva, Bálint Ádám PhD, Dán Ádám PhD, Bányai Krisztián, Zalakaros,

Részletesebben

A DNS szerkezete. Genom kromoszóma gén DNS genotípus - allél. Pontos méretek Watson genomja. J. D. Watson F. H. C. Crick. 2 nm C G.

A DNS szerkezete. Genom kromoszóma gén DNS genotípus - allél. Pontos méretek Watson genomja. J. D. Watson F. H. C. Crick. 2 nm C G. 1955: 46 emberi kromoszóma van 1961: mrns 1975: DNS szekvenálás 1982: gén-bank adatbázisok 1983: R (polymerase chain reaction) Mérföldkövek 1 J. D. Watson F. H.. rick 2008 1953 2003 Watson genomja DNS

Részletesebben

Szekvenciákat tartalmazó adatmátrixok rendezése kemometriai módszerrel

Szekvenciákat tartalmazó adatmátrixok rendezése kemometriai módszerrel SZAKDOLGOZAT Szekvenciákat tartalmazó adatmátrixok rendezése kemometriai módszerrel Készítette: Szabó Attila informatikus vegyész szakos hallgató Témavezető: Tóth Gergely egyetemi docens Eötvös Loránd

Részletesebben

Telomerek a lineáris kromoszómák végei

Telomerek a lineáris kromoszómák végei Telomer Telomeráz Telomerek a lineáris kromoszómák végei Repetitív DNS szekvencia, TTAGGG gerincesekben Speciális telomerkötő fehérjék Telomer méret Telomer-3D lineáris? A telomerek szerkezete: t &D hurok

Részletesebben

Szent István Egyetem ŐSHONOS MAGYAR TYÚKÁLLOMÁNYOK GENETIKAI DIVERZITÁSÁNAK VIZSGÁLATA KÜLÖNBÖZŐ MOLEKULÁRIS GENETIKAI MARKEREK SEGÍTSÉGÉVEL

Szent István Egyetem ŐSHONOS MAGYAR TYÚKÁLLOMÁNYOK GENETIKAI DIVERZITÁSÁNAK VIZSGÁLATA KÜLÖNBÖZŐ MOLEKULÁRIS GENETIKAI MARKEREK SEGÍTSÉGÉVEL Szent István Egyetem ŐSHONOS MAGYAR TYÚKÁLLOMÁNYOK GENETIKAI DIVERZITÁSÁNAK VIZSGÁLATA KÜLÖNBÖZŐ MOLEKULÁRIS GENETIKAI MARKEREK SEGÍTSÉGÉVEL Doktori (Ph.D) értekezés tézisei Bodzsár Nóra Gödöllő 2012 A

Részletesebben

Tipizálási módszerek alkalmazása methicillin-rezisztens Staphylococcus aureus (MRSA) törzsek molekuláris epidemiológiai vizsgálatai során

Tipizálási módszerek alkalmazása methicillin-rezisztens Staphylococcus aureus (MRSA) törzsek molekuláris epidemiológiai vizsgálatai során Tipizálási módszerek alkalmazása methicillin-rezisztens Staphylococcus aureus (MRSA) törzsek molekuláris epidemiológiai vizsgálatai során Ungvári Erika, Tóth Ákos Magyar Infektológiai és Klinikai Mikrobiológiai

Részletesebben

Molekuláris biológiai adatbázisok és adatbázis keresések. Barta Endre Tóth Gábor MBK Bioinformatikai Csoport

Molekuláris biológiai adatbázisok és adatbázis keresések. Barta Endre Tóth Gábor MBK Bioinformatikai Csoport Molekuláris biológiai adatbázisok és adatbázis keresések Barta Endre Tóth Gábor MBK Bioinformatikai Csoport Adatbázisok: megvalósítás Szöveges adatbázis általában szekvenciális, néha indexelt megfelelő

Részletesebben

A madárinfluenza járványtani helyzete és újabb lehetőségek a vakcinás védekezésben

A madárinfluenza járványtani helyzete és újabb lehetőségek a vakcinás védekezésben A madárinfluenza járványtani helyzete és újabb lehetőségek a vakcinás védekezésben Összefoglaló a WVPA XVII. Kongresszusán témakörben elhangzott előadások alapján Tatár-Kis Tímea, Mató Tamás PhD és Palya

Részletesebben