Bevezetés a bioinformatikába

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "Bevezetés a bioinformatikába"


1 Bevezetésabioinformatikába őszifélév,biológiaBSC,levelezőképzés BálintBalázs

2 Információakurzusról I.elméletialapok(azévvégivizsgaanyaga) II.azelméletirészheztartozógyakorlatimunka(nemszámonkért) (szakirodalmazás,adatbázis bányászatszekvenciahomológia keresés,fehérjetérszerkezetvizsgálat,stb.) Vizsga:írásban,tesztek/rövidválasztigénylőkérdések

3 Abioinformatikadefiníciója informatika biológia hardverek,szoftverek megválaszolandókérdés, biológiaiadat Bioinformatika:biológiaiadatokszámítógépesanalízise.

4 Centrális dogma és a bioinformatika főbb területei a molekuláris biológiában Gén genomika DNS transzkripció, RNS szerkesztés RNS transzkriptomika degradáció transzláció, poszttranszlációs módosítás proteomika fehérje degradáció biokémiai aktivitás metabolikus útvonalak metabolomika

5 adnsafőbiológiaiinformációhordozó F. Griffith Avery 1944 Streptococcus pneumoniae a transzformáló anyag DNS proteáz RNáz DNáz abaktériummódosítható(transzformálható) egér meghal egér meghal egér túlél

6 Hershey és Chase ,Escherichiacoli tfertőztekradioaktívanjelöltt2fággal adnsp32 vel,afehérjeburoks35 teljelölve (adns bennincss,afehérjébennincsp) 2.,Abaktériumhoztapadtkiürültfágburkokat rázássalleválasztották 3.,Abaktériumokatésaszabaddávált fágburkokatcentrifugálássalelkülönítették felülúszó,(s35fág fehérje) baktériumpellet,p32 (fágdns)

7 DNSszerkezete(1953) "Nemkerülteelafigyelmünketaz,hogyazáltalunkfeltételezettpárosítási szabályegymásolásimechanizmustissugallagenetikaianyagszámára." JamesWatsonésFrancisCrick

8 DNSreplikáció RNSszintézis(transzkripció)

9 Fehérjeszintézis(transzláció)

10 Azuniverzálisgenetikaikód Másodikkarakter Els ő karakter Harmadikkarakter DNS:ATG RNS:AUG AS:Metionin

11 Hogyannyerjükkiaszekvenciainformációt? Fehérje DNS Könnyentisztítható Nehezebbentisztítható Stabil Számosinstabilfehérjelétezik Könnyebben,szekvenálható Aközvetlenfehérjeszekvenálás igennehézfeladat AszekvenciainformációkatzömmelDNSmolekulárólnyerik,amiket azutánszámítógéppel(insilico)fehérjeszekvenciárafordítanak.

12 ADNSinformációtartalmánakmegismerése akezdetkezdete P s t I ( 1) V a r ia t io n 1 V a r ia t io n 2 V a r ia t io n 3 M is c F e a t u r e 2 V a r ia t io n 4 C D S 4 A pali (4780) A v a I ( 16 3 ) C D S 5 R e p O r ig in 1 C D S 6 m R N A 2 p h i- x M is c F e a t u r e 1 C D S bp C D S 8 C D S 9 FrederickSanger C D S 1 1 m R N A 1 C D S 1 0 azelsőpublikáltteljesgenom(1977) kb.5000nukleotid(!)

13 Sanger félednsszekvenáláselve P P P P P P P láncterminációddgtpjelenlétében P termékkeverék

14 Sanger félednsszekvenáláselve ddgtp ddttp ddatp ddctp P P P P P P P P P P P P P P P zseb poliakrilamidgél futtatásiránya:

15 Egyigaziszekvenálólétra Szekvencia: 5 tcaactttgtcggcttgagaaagacctgggatctgggtat... Atechnológiakorlátai: emberpróbáló,extrémmunkaigényeseljárás igenkicsileolvasásihossz atermékekdetektálásap32izotópsegítségével

16 ASanger félednsszekvenálásautomatizálása Anégyféledideoxynukleotidanalógegyreakcióbanadva mindanégyddntpegyedifluoreszcensfestékkeljelölve atermékekméretszerintielválasztásakapillárisoszlopon adetektorelőttelhaladófestékek sorrendje=>bázissorrend teljesenautomatizáltberendezés ~ nukleotidhosszúDNSdarabokolvashatóak szekvenogram:festékintenzitásokváltozásaazidőben

17 1995Haemophilusinfluenzaegenomszekvencia Shotgunmódszer DNS tisztítás darabolás futtatás ideálisméretűdarabok (1,5 2kb)kinyerése midenklónból plazmidtisztítás inszert szekvenálása aplazmidok bejuttatása E.coli ba contigassembly agenomifragmentek plazmidokbaligálása

18 ASanger szekvenálásraalapozottshotgunmódszerkorlátai Könyvtárkészítésszükséges munkaigényes,időigényes,költségesfolyamat egyenetlenlefedettség,agazdára(e.coli)toxikusrégiókteljesenkimaradnak agazdagenomnyomokbanszennyeződéskéntmegjelenhet különbözőprojektekközöttikereszt szennyeződéskönnyenelőfordulhat Alacsonyáteresztőképesség azújszálszintéziseésabázissorrendmeghatározásakülönlépés kapilláriselektroforézislépésszükséges kevéssépárhuzamosítható(max96kapilláris/berendezés) magasköltség/szekvenálásireakció

19 Újgenerációsszekvenálásitechnológiák Roche454FLX IlluminaSolexa ABISolid Nincsszükséghagyományosgenomikönyvtárra KözvetlenülatisztítottgenomiDNSkerülagépbe AgDNS tfizikailagtörik,afragmentekethordozóhozrögzítik,majdpcr segítségévelfelsokszorozzák Óriásiátereszőképesség nagyfokúpárhuzamosítás:akártöbbmilliószekvenálásireakcióegyszerre azújszálszintéziseésanukleotidsorrendmeghatározásaegyidejűlegtörténik kisebbköltség/szekvenálásireakció

20 Elkészültgenomszekvenciákstatisztikája2009 Bakteriálisgenom 1001(714*) Eukariótagenomok 74(22*) Caenorhabditiselegans(talajlakófonalféreg) Ecetmuslica(Drosophilamelanogaster) Egér(Musmusculus) Ember(Homosapiens) Kutya(Canislupusfamiliaris) Lúdfű(Arabidopsisthaliana) Méh(Apismellifera) Patkány(Rattusnorvegicus) Rizs(Oryzasativa) Sertés(Susscrofa) Szarvasmarha(Bostaurus) Szőlő(Vitisvinifera) *2008 asadat

21 Összefogásanukleinsavadatbankokközött NIH USA NCBI GenBan k EMBL CIB DDBJ NIG Japan EBI EMBL Europe NIH:NationalInstituteofHealth >NCBI:NationalCenterforBiotechnologyInformation >GenBank NIG:NationalInstituteofGenetics >CIB:CenterofInformationBiology >DDBJ EMBL:EuropeanMolecularBiologyLaboratory >EBI >EuropeanBioinformaticsInstitute >EMBL

22 Miazadatbázis? számítógépesfájlstrukturáltadattartalommal szabványosítottadatszerkezet gyorsösszetettkeresésekvégezhetőek /indexelés/ rendszeresenfrissített,naprakész /újkiadások/ kapcsolatokmásadatbázisokfelé /kereszthivatkozások/ Megfelelőszoftverekkellenek,melyekkel adatlekérdezés,adatfrissítés,adattörlés,adathozzáadásvégezhető

23 Hogyanépülfelegyadatbank? szabványosítás,szabványosítás,szabványosítás Feladat: adatoktárolása:jóldokumentáltszekvenciaformátumban anyersszekvenciákonkívültovábbifontoskiegészítőinformációkat tároljon(szekvencialeírása,eredete,típusa,hossza,stb.stb.) lehessenkeresniezekbena"kiegészítő"információkban kereshetőlegyenaszekvencia akutatókújszekvenciákatküldhessenekbeazadatbankba legyenlehetőségahibajavításra(update) nelegyenredundáns minélinkábbautomatizáltlegyen Adatbázisok

24 Azadatbázisoktípusai Elsődlegesadatbázisok Akísérletezőkeredetielküldöttadatai Közvetlenkísérletieredményekettartalmaznak Pl.GeneBank,GEO(génexpressziósadatbank) Származtatottadatbázisok Elsődlegesadatokanalízisévelnyerttöbbletinformációkattárol Hivatkozásokazelsődlegesadatbáziseredetibejegyzéseire Néhánypélda: RefSNP(pontmutációadatbank) CDD(konzerváltdomainadatbázis), PFAM(fehérjecsaládokadatbázisa)

25 AGeneBankadatbázis 1979 benalapítva(losalamos). 1992ótaazNCBIgondozza(Bethesda). azadatbázissajátszekvenciaformátumaagenebank szekvenciainformáció szekvenciákhozkapcsolódóegyébinformációk,annotációk kereszthivatkozásokmásadatbankokkapcsolódóbejegyzéseire azadatbázisdivíziókraosztott: PRIfőemlősszekvenciák ROD rágcsálókszekvenciái PLNnővényi,gombaésalga BCT bakteriális EST expresszáltszekvenciadarabkák(cdns) ENV környezetimintákbólnyertszekvenciák PAT szabadalmakhozkapcsolódószekvenciák ~taxonómia szekvenciajellege

26 AGeneBankadatbázisgyarapodása 2009október Nukleotid (milliárdbp) 50 Szekvencia (milliódb) Töretlen,közelexponenciálisnövekedés

27 EgyGeneBankbejegyzés LOCUS DEFINITION ACCESSION VERSION KEYWORDS SOURCE ORGANISM REFERENCE AUTHORS TITLE JOURNAL MEDLINE PUBMED REFERENCE AUTHORS TITLE JOURNAL REFERENCE AUTHORS TITLE JOURNAL REMARK COMMENT AF bp mrna linear INV 23-OCT-2002 Limulus polyphemus myosin III mrna, complete cds. AF AF GI: Limulus polyphemus (Atlantic horseshoe crab) Limulus polyphemus Eukaryota; Metazoa; Arthropoda; Chelicerata; Merostomata; Xiphosura; Limulidae; Limulus. 1 (bases 1 to 3808) Battelle,B.-A., Andrews,A.W., Calman,B.G., Sellers,J.R., Greenberg,R.M. and Smith,W.C. A myosin III from Limulus eyes is a clock-regulated phosphoprotein J. Neurosci. 18 (12), (1998) (bases 1 to 3808) Battelle,B.-A., Andrews,A.W., Calman,B.G., Sellers,J.R., Greenberg,R.M. and Smith,W.C. Direct Submission Submitted (29-APR-1998) Whitney Laboratory, University of Florida, 9505 Ocean Shore Blvd., St. Augustine, FL 32086, USA 3 (bases 1 to 3808) Battelle,B.-A., Andrews,A.W., Calman,B.G., Sellers,J.R., Greenberg,R.M. and Smith,W.C. Direct Submission Submitted (02-MAR-2000) Whitney Laboratory, University of Florida, 9505 Ocean Shore Blvd., St. Augustine, FL 32086, USA Sequence update by submitter On Mar 2, 2000 this sequence version replaced gi:

28 EgyGeneBankbejegyzés lókusz LOCUS AF bp mrna linear INV 23-OCT-2002 DEFINITION Limulus polyphemus mrna, complete LOCUS AF myosin bp III mrna linear cds.inv 23-OCT-2002 ACCESSION AF VERSION AF GI: KEYWORDS. SOURCE Limulus polyphemus (Atlantic horseshoe crab) ORGANISM Limulus polyphemus Eukaryota; Metazoa; Arthropoda; Chelicerata; Merostomata; Xiphosura; Limulidae; Limulus. REFERENCE 1 (bases 1 to 3808) AUTHORS Battelle,B.-A., Andrews,A.W., Calman,B.G., Sellers,J.R., Greenberg,R.M. and Smith,W.C. TITLE A myosin III from Limulus eyes is a clock-regulated phosphoprotein JOURNAL J. Neurosci. 18 (12), (1998) MEDLINE PUBMED REFERENCE 2 (bases 1 to 3808) AUTHORS Battelle,B.-A., Andrews,A.W., Calman,B.G., Sellers,J.R., Greenberg,R.M. and Smith,W.C. TITLE Direct Submission JOURNAL Submitted (29-APR-1998) Whitney Laboratory, University of Florida, 9505 Ocean Shore Blvd., St. Augustine, FL 32086, USA REFERENCE 3 (bases 1 to 3808) AUTHORS Battelle,B.-A., Andrews,A.W., Calman,B.G., Sellers,J.R., Greenberg,R.M. and Smith,W.C. TITLE Direct Submission JOURNAL Submitted (02-MAR-2000) Whitney Laboratory, University of Florida, 9505 Ocean Shore Blvd., St. Augustine, FL 32086, USA REMARK Sequence update by submitter COMMENT On Mar 2, 2000 this sequence version replaced gi: Hossz Lókusz név Molekula típus Divízió Módosítás Dátum

29 AGeneBankazonosítók LOCUS DEFINITION ACCESSION VERSION KEYWORDS SOURCE ORGANISM AF bp mrna linear INV 23-OCT-2002 Limulus polyphemus myosin III mrna, complete cds. AF AF GI: Limulus polyphemus (Atlantic horseshoe crab) Limulus polyphemus Eukaryota; Metazoa; Arthropoda; Chelicerata; Merostomata; Xiphosura; Limulidae; Limulus. 1 (bases 1 to 3808) Battelle,B.-A., Andrews,A.W., Calman,B.G., Sellers,J.R., Greenberg,R.M. and Smith,W.C. A myosin III from Limulus eyes is a clock-regulated phosphoprotein J. Neurosci. 18 (12), (1998) (bases 1 to 3808) Battelle,B.-A., Andrews,A.W., Calman,B.G., Sellers,J.R., Greenberg,R.M. and Smith,W.C. Direct Submission Submitted (29-APR-1998) Whitney Laboratory, University of Florida, 9505 Ocean Shore Blvd., St. Augustine, FL 32086, USA 3 (bases 1 to 3808) Battelle,B.-A., Andrews,A.W., Calman,B.G., Sellers,J.R., Greenberg,R.M. and Smith,W.C. Direct Submission Submitted (02-MAR-2000) Whitney Laboratory, University of Florida, 9505 Ocean Shore Blvd., St. Augustine, FL 32086, USA Sequence update by submitter On Mar 2, 2000 this sequence version replaced gi: ACCESSION VERSION REFERENCE AUTHORS TITLE JOURNAL MEDLINE PUBMED REFERENCE AUTHORS TITLE JOURNAL REFERENCE AUTHORS TITLE JOURNAL REMARK COMMENT AF AF GI: Egyedi azonosító (fix) GB azonosító (változhat!)

30 GeneBankaszekvenciaeredete(Atlantitőrfarkú) LOCUS DEFINITION ACCESSION VERSION KEYWORDS SOURCE ORGANISM AF bp mrna linear INV 23-OCT-2002 Limulus polyphemus myosin III mrna, complete cds. AF AF GI: Limulus polyphemus (Atlantic horseshoe crab) Limulus polyphemus Eukaryota; Metazoa; Arthropoda; Chelicerata; Merostomata; Xiphosura; Limulidae; Limulus. SOURCE Limulus polyphemus (Atlantic horseshoe crab) REFERENCE 1 (bases 1 to 3808) ORGANISM Limulus polyphemus AUTHORS Battelle,B.-A., Andrews,A.W., Calman,B.G., Sellers,J.R., Eukaryota; Greenberg,R.M. and Metazoa; Smith,W.C.Arthropoda; Chelicerata; Merostomata; Xiphosura; Limulidae; Limulus. TITLE A myosin III from Limulus eyes is a clock-regulated phosphoprotein JOURNAL J. Neurosci. 18 (12), (1998) MEDLINE PUBMED REFERENCE 2 (bases 1 to 3808) AUTHORS Battelle,B.-A., Andrews,A.W., Calman,B.G., Sellers,J.R., Greenberg,R.M. and Smith,W.C. TITLE Direct Submission JOURNAL Submitted (29-APR-1998) Whitney Laboratory, University of Florida, 9505 Ocean Shore Blvd., St. Augustine, FL 32086, USA REFERENCE 3 (bases 1 to 3808) AUTHORS Battelle,B.-A., Andrews,A.W., Calman,B.G., Sellers,J.R., Greenberg,R.M. and Smith,W.C. TITLE Direct Submission JOURNAL Submitted (02-MAR-2000) Whitney Laboratory, University of Florida, 9505 Ocean Shore Blvd., St. Augustine, FL 32086, USA REMARK Sequence update by submitter COMMENT On Mar 2, 2000 this sequence version replaced gi: NCBI Taxonómia

31 GeneBankreferenciák LOCUS DEFINITION ACCESSION VERSION KEYWORDS SOURCE ORGANISM AF bp mrna linear INV 23-OCT-2002 Limulus polyphemus myosin III mrna, complete cds. AF AF GI: Limulus polyphemus (Atlantic horseshoe crab) Limulus polyphemus Eukaryota; Metazoa; Arthropoda; Chelicerata; Merostomata; Xiphosura; Limulidae; Limulus. REFERENCE 1 (bases 1 to 3808) AUTHORS Battelle,B.-A., Andrews,A.W., Calman,B.G., Sellers,J.R., Greenberg,R.M. and Smith,W.C. TITLE A myosin III from Limulus eyes is a clock-regulated phosphoprotein REFERENCE 1 (bases 1 to 3808) JOURNAL J. Neurosci. 18 (12), (1998) AUTHORS Battelle,B.-A., Andrews,A.W., Calman,B.G., Sellers,J.R., MEDLINE PUBMED Greenberg,R.M. and Smith,W.C. A myosin III from Limulus eyes is a clock-regulated REFERENCETITLE 2 (bases 1 to 3808) phosphoprotein AUTHORS Battelle,B.-A., Andrews,A.W., Calman,B.G., Sellers,J.R., JOURNAL J. Neurosci. 18 (12), (1998) Greenberg,R.M. and Smith,W.C. TITLE MEDLINE Direct Submission PUBMED JOURNAL Submitted (29-APR-1998) Whitney Laboratory, University of Florida, 9505 Ocean Shore Blvd., St. Augustine, FL 32086, USA REFERENCE 3 (bases 1 to 3808) AUTHORS Battelle,B.-A., Andrews,A.W., Calman,B.G., Sellers,J.R., Greenberg,R.M. and Smith,W.C. TITLE Direct Submission JOURNAL Submitted (02-MAR-2000) Whitney Laboratory, University of Florida, 9505 Ocean Shore Blvd., St. Augustine, FL 32086, USA REMARK Sequence update by submitter COMMENT On Mar 2, 2000 this sequence version replaced gi: szakirodalom kereszthivatkozás

32 AGeneBanktulajdonságtábla FEATURES source CDS Location/Qualifiers /organism="limulus polyphemus" /db_xref="taxon:6850" /tissue_type="lateral eye" /note="n-terminal protein kinase domain; C-terminal myosin heavy chain head; substrate for PKA" /codon_start=1 /product="myosin III" /protein_id="aac " /db_xref="gi: " /translation="meykcisehlpfetlpdpgdrfevqelvgtgtyatvysaidkqa NKKVALKIIGHIAENLLDIETEYRIYKAVNGIQFFPEFRGAFFKRGERESDNEVWLGI EFLEEGTAADLLATHRRFGIHLKEDLIALIIKEVVRAVQYLHENSIIHRDIRAANIMF SKEGYVKLIDFGLSASVKNTNGKAQSSVGSPYWMAPEVISCDCLQEPYNYTCDVWSIG ITAIELADTVPSLSDIHALRAMFRINRNPPPSVKRETRWSETLKDFISECLVKNPEYR PCIQEIPQHPFLAQVEGKEDQLRSELVDILKKNPGEKLRNKPYNVTFKNGHLKTISGQ 1201 a 689 c 782 g 1136 t /protein_id="aac " /db_xref="gi: " fehérje adatbank kereszthivatkozás BASE COUNT ORIGIN 1 tcgacatctg tggtcgcttt ttttagtaat aaaaaattgt attatgacgt cctatctgtt 3781 aagatacagt aactagggaa aaaaaaaa //



35 Konverziókülönféleszekvenciaformátumokközött Akülönféleszekvenciaformátumokkönnyenátkonvertálhatóakegymásba Seqret programazembosscsomagból helyilegtelepítettváltozattal (Bio)perlscriptsegítségével EBIReadSeqportálján

36 Másodikrész

37 Szekvenciaevolúció AlegtöbbDNSpolimeráznagyonhűenmásol. (AzE.coliDNSpolimerázanagyjábólegyhibátvéttízmilliónukleotidonként) Elegendőhosszúidőalattszámospontmutáció Kromoszómaátrendeződésselhirtelen,nagyobbváltozások(inszerció,deléció) történhetnek ADNS(vagyfehérje)szekvenciaösszehasonlításávalevolúciósrokonságifokis kimutatható: rdnsszekvenciaelemzésalapjánfelállítottuniverzálistörzsfa

38 Változásokaszekvenciákban A T C C T A T T C A C A G A T A A T C C A C A G A T A A T C C G A T T A A C A G A T A A T C C G A T T A A C A G A T A pontmutációk inszerció/deléció A T C C C C A A T A C A G A T A A T C C T A T T G GC A G A T A inverzió

39 Szekvenciaevolúció Homológszekvenciák: hasonlóak közösősrevezethetőekvissza Analógszekvenciák: hasonlóságközösevolúciósősnélkül leszármazott#2 leszármazott#1 (rombusz) (téglalap) közösős (paralelogramma) ortológ:ahomológfehérjékkétkülönfajbantalálhatók,afunkcióáltalábanazonos Pl.szarvasmarhainzulin emberiinzulin paralóg:ahomológfehérjékugyanazonfajbantalálhatók(általábannemteljesen azonosfunkció) Pl.emberihemoglobinAéshemoglobinBláncok

40 Homológiakeresésahőskorban:Dotplot zaj AkétszekvenciaazXilletveYtengelyrekerül MindenXpozíciótmindenYpozícióvalösszehasonlítunk Aholegyezésvan,odaegypontotteszünk Azközösrégiókátlósvonalkéntjelennekmeg

41 Homológiakeresés:szekvenciaillesztés Nukleinsavvagyfehérjeszekvenciákegymáshozrendezése Nagyonsokillesztéslehetséges Melyikalegjobb?Valóshasonlóságotmutat?Tényleghomológakétszekvencia? Azillesztésekkiértékeléséhezpontozásirendszerszükséges Szekvencia1 Szekvencia2 actaccagttcatttgatacttctcaaa taccattaccgtgttaactgaaaggacttaaagact actaccagttcatttgatacttctcaaa taccattaccgtgttaactgaaaggacttaaagact actaccagttcatttgatacttctcaaa taccattaccgtgttaactgaaaggacttaaagact actaccagttcatttgatacttctcaaa taccattaccgtgttaactgaaaggacttaaagact actaccagttcatttgatacttctcaaa taccattaccgtgttaactgaaaggacttaaagact actaccagttcatttgatacttctcaaa actaccagttcatttgatacttctcaaa taccattaccgtgttaactgaaaggacttaaagact taccattaccgtgttaactgaaaggacttaaagact actaccagttcatttgatacttctcaaa taccattaccgtgttaactgaaaggacttaaagact

42 Homológiakeresés:pontozás actaccagttcatttgatacttctcaaa Szekvencia1 taccattaccgtgttaactgaaaggacttaaagact Szekvencia2 Negatívértékbüntetiazeltéréseket: A T C G A T C -4-4 G Illeszkedik:5 Nemilleszkedik:19 Score:5x5+19x( 4)= 51

43 ADNSpontozásirendszerhibája CCTCCTTTGT Pont=50 CCTCCTTTGT Pro A A T C T G 4-4 Leu G 5-4 C CCTCCTTTGG Pont=32 CCTCCCTTAG Pro Leu Nemveszifigyelembe,hogyegyaminosavattöbbkodoniskódolhat(némamutációk)

44 Fehérjepontozásirendszer aháttér Azaminosavaknakkülönbözőfizikai kémiaitulajdonságaikvannak, ezekbefolyásoljákakicserélhetőségüket Példáulavalin(V)ésazizoleucin(I)kicserélhetőegymásra alifás L hidrofób P C S+S I M V pici A kicsi G CSH S K E D T F Y W H R aromás N Q pozitív poláris töltött A:alanin,R:arginin,N:aszparagin,D:aszparaginsav,C:cisztein,Q:glutamin,E:glutaminsav,G:glicerin, H:hisztidin,I:izoleucin,L:leucin,K:lizin,M:metionin,F:fenilalanin,P:prolin,S:serin,T:treonin, W:triptofán,Y:tirozin

45 Fehérjepontozásirendszerek(mátrixok) pontszámotrendelazösszeslehetségesaminosav aminosavcseréhez fehérjeszekvenciáktöbbszörösillesztésénekvizsgálatábólszármazóadatok Blossum62 esmátrix

46 Szekvenciaillesztés:globálisvagylokális Globálisillesztés:ateljesszekvenciátigyekszikoptimálisanelrendezni Σ 50pont Lokális:alegnagyobbjólilleszkedőközösszakasztkeresimeg Σ 55pont Természetesenakétmódszereltérőillesztéstad

47 BLAST:BasicLocalAlignmentTool BLAST:egyszerűlokálisszekvenciaillesztőeszköz azncbiportálonhozzáférhető: igengyors,igenelterjedt alkalmasnagyméretűszekvenciaadatbázisokbantörténőhomológiakeresésre programvariációk: szekvencia adatbázis program nukleotid nukleotid blastn fehérje fehérje blastp transzlált nukleotid fehérje blastx fehérje transzlált nukleotid tblastn transzlált nukleotid transzlált nukleotid tblastn

48 BLAST:BasicLocalAlignmentTool keresett szekvencia (query) Választhatófehérjeblastadatbankok: melyik adatbankban keressen nr ismétlődéstőlmentes,~genepept refseq jóljellemzett,felülvizsgáltadatok(ncbi) swissprot jóljellemzett,felülvizsgáltadatok(swissinstitute) pat szabadalmakhozkacspolódószekvenciák pdb ismert3d smodellelrendelkezőszekvenciák env környezetiszekvenálásokeredményei

49 Keresésfolyamatban... Becsülthátralévőidő(minimum)

50 Eredmények... Fajokszerintrendezve találatok Pontszám színkód

51 Eredmények... találatneve+hivatkozás találatleírása Eérték megengedettcsere azonosaminosavak deléció(gap) nemmegengedettcsere

52 Milyeninformációkatkaphatunkfehérjeszekvenciák vizsgálatával Afőkérdés:miazadottfehérjepontosszerepe,funkciója? Segítt easzekvenciaismereteafunkciómeghatározásában?

53 Fehérjeaminosavsorrendmeghatározzaatérszerkezetet Anfinsen,1961 UreahatásáraazRNázkicsapódik,(harmadlagostérszerkezeteelvész) AzureaeltávolításautánazRNázkülsősegítségnélkülvisszanyerteatérszerkezetét, ésazaktivitását! katalitikuszseb diszulfidhidak hidrofiloldalláncok hidrofóbmag

54 Fehérjeszekvenciaanalízisrévénfunkciójóslás Hasonlószekvenciakereséseadatbázisban,ismertfunkcióval Hasonlószekvenciakereséseadatbázisban,ismerttérszerkezettel Ismertfunkcióvalbíródomain ekazonosításaazismeretlenszekvencián Funkciójóslás Pusztánszekvenciaanalízisselafehérjefunkciójátnemlehetmegállapítani Abioinformatikaivizsgálatokötleteket,kiindulópontotadnakakísérletes munkához

55 ProteinDataBank Kísérletesenmeghatározottháromdimenziósfehérjeszerkezetimodellek

56 KeresésaPDBadatbázisban

57 CDDkonzerváltdomainadatbank Domain:afehérjénbelülirészegység,amelyjóldefiniáltstrukturálisvagyfunkcióbeli szerepettöltbe.egyfehérjénbelülgyakrantöbbdomainttalálunk,amelyek együttesenjárulnakhozzáafehérjeműködéséhez

58 CDDkonzerváltdomainadatbanktalálat azonosítottaktívközpont,szubsztrátkötőhelyek azonosítottdomain ek

59 NCBIportál azinformációözöne

60 Entrez:azNCBIintegráltkeresőmotorja OMIM PubMed PubMedCentral 3DDomains Journals Structure Books CDD/CDART Entrez Protein Taxonomy Genome GEO/GDS UniSTS UniGene Nucleotide PopSet SNP

61 Szakirodalmiadatbázis:Pubmed közel5300tudományosfolyóiratcikkeinekösszefoglalóibankereshetünk aszabadonletölthetőteljescikkekrehivatkozás

62 Szakirodalmiadatbázis:Pubmed amegtaláltösszefoglalómunkákat(reviewarticle)különiskilistázhatjuk

63 Szakirodalmiadatbázis:Pubmed különféleikonokjelzik,hogyamegtaláltteljescikkhozzáférhető e ingyenes hozzáférés

64 PubmedCentral 500szabadon,elektronikusanelérhetőfolyóirat

65 Mapviewer interaktívgenetikaitérképekazelkészültésafolyamatbanlévőgenomprojektekhez

66 Mapviewer Kulcsszavaskeresés találatokakromoszómákon

67 HumángenetikaiadatbázisOMIM Örökletesbetegségekkelkapcsolatosinformációk

68 Rendszertaniadatbázis(taxonómia)

69 Szabadonolvashatókönyvek:NCBIBooks

70 Szabadonolvashatókönyvek:NCBIBooks Berg,JeremyM.;Tymoczko,JohnL.;andStryer,Lubert. NewYork:W.H.FreemanandCo.;c2002 Biochemistry Cooper,GeoffreyM. Sunderland(MA):SinauerAssociates,Inc.;c2000 TheCell AMolecularApproach Gilbert,ScottF. Sunderland(MA):SinauerAssociates,Inc.;c2000 DevelopmentalBiology Janeway,CharlesA.;Travers,Paul;Walport,Mark;Shlomchik,Mark NewYorkandLondon:GarlandScience;c2001 Immunobiology Lodish,Harvey;Berk,Arnold;Zipursky,S.Lawrence; Matsudaira,Paul;Baltimore,David;Darnell,JamesE. NewYork:W.H.Freeman&Co.;c1999 MolecularCellBiology Coffin,JohnM.;Hughes,StephenH.;Varmus,HaroldE. Plainview(NY):ColdSpringHarborLaboratoryPress;c1997 Retroviruses

71 Egyébhasznosadatbankok:BRENDAenzimadatbázis Átfogóadatgyűjteményenzimekről azenzimhelyeametabolikushálózatban azenzimáltalkatalizáltreakciókleírása előforduláskülönféleélőlényekben,irodalmihivatkozások aktivitásadatok,enzimkinetikaiadatok optimálishőmérséklet,phadatok gátlószerekhatása

72 KEGGanyagcsereútvonaladatbázis

Juhász Angéla MTA ATK MI Alkalmazott Genomikai Osztály SZEKVENCIA ADATBÁZISOK

Juhász Angéla MTA ATK MI Alkalmazott Genomikai Osztály SZEKVENCIA ADATBÁZISOK Juhász Angéla MTA ATK MI Alkalmazott Genomikai Osztály SZEKVENCIA ADATBÁZISOK Fehérjét kódol? Tulajdonságai? -Hol lokalizálódik? -Oldható? -3D szerkezete? -Accession #? -Annotációja elérhető? Már benne


Molekuláris biológiai adatbázisok és adatbázis keresések. Barta Endre Tóth Gábor MBK Bioinformatikai Csoport

Molekuláris biológiai adatbázisok és adatbázis keresések. Barta Endre Tóth Gábor MBK Bioinformatikai Csoport Molekuláris biológiai adatbázisok és adatbázis keresések Barta Endre Tóth Gábor MBK Bioinformatikai Csoport Adatbázisok: megvalósítás Szöveges adatbázis általában szekvenciális, néha indexelt megfelelő


A tárgy címe: Bioinformatika

A tárgy címe: Bioinformatika A tárgy címe: Bioinformatika Kötelezően választható tárgy IV. és V. évfolyamos biológus hallgatók számára; heti 2+3 óra Előkövetelmény: Biokémia főkollégium; genetika főkollégium; alapszintű számítógépes



NÖVÉNYI GENOMIKA JÓRI BALÁZS NÖVÉNYI GENOMIKA JÓRI BALÁZS Eötvös Loránd Tudományegyetem, Növényélettani és Molekuláris Növénybiológia Tanszék, 1117 Budapest, Pázmány P. sétány 1/c. Elfogadva: 2004. december 29. Bot. Közlem. 91(1 2):





Bakteriális identifikáció 16S rrns gén szekvencia alapján

Bakteriális identifikáció 16S rrns gén szekvencia alapján Bakteriális identifikáció 16S rrns gén szekvencia alapján MOHR ANITA SIPOS RITA, SZÁNTÓ-EGÉSZ RÉKA, MICSINAI ADRIENN 2100 Gödöllő, Szent-Györgyi Albert út 4., TÖRZS AZONOSÍTÁS


DNS-szekvencia meghatározás

DNS-szekvencia meghatározás DNS-szekvencia meghatározás Gilbert 1980 (1958) Sanger 3-1 A DNS-polimerázok jellemzői 5'-3' polimeráz aktivitás 5'-3' exonukleáz 3'-5' exonukleáz aktivitás Az új szál szintéziséhez kell: templát DNS primer


Orvosi Genomtudomány 2014 Medical Genomics 2014. Április 8 Május 22 8th April 22nd May

Orvosi Genomtudomány 2014 Medical Genomics 2014. Április 8 Május 22 8th April 22nd May Orvosi Genomtudomány 2014 Medical Genomics 2014 Április 8 Május 22 8th April 22nd May Hét / 1st week (9. kalendariumi het) Takács László / Fehér Zsigmond Magyar kurzus Datum/ido Ápr. 8 Apr. 9 10:00 10:45


ő í í ü í ö ú í ö ú ö í ú ő í Ó ő ü í Í ö ö Í í í í í Í í ű ő ö í ő ö ö íá í íí í ő ö ő Í ö Ó ö ö ü ö ö ö ő É í í Í ő ő ő ő ő ő ő ő ö ú ő ú ú ő ö ö ú ú ö ú í ő Ó ö ő Í í ü í ö ú ő ö ő ú ő í ő ö ü Í í ö


A HUMÁN GENOM PROJEKT Sasvári-Székely Mária* Semmelweis Egyetem, Orvosi Vegytani, Molekuláris Biológiai és Pathobiokémiai Intézet

A HUMÁN GENOM PROJEKT Sasvári-Székely Mária* Semmelweis Egyetem, Orvosi Vegytani, Molekuláris Biológiai és Pathobiokémiai Intézet A HUMÁN GENOM PROJEKT Sasvári-Székely Mária* Semmelweis Egyetem, Orvosi Vegytani, Molekuláris Biológiai és Pathobiokémiai Intézet *Levelezési cím: Dr. Sasvári-Székely Mária, Semmelweis Egyetem, Orvosi


Makromolekulák. Fehérjetekeredé. rjetekeredés. Biopolimer. Polimerek

Makromolekulák. Fehérjetekeredé. rjetekeredés. Biopolimer. Polimerek Biopolimerek Makromolekulá Makromolekulák. Fehé Fehérjetekeredé rjetekeredés. Osztódó sejt magorsófonala 2011. November 16. Huber Tamá Tamás Dohány levél epidermális sejtjének aktin hálózata Bakteriofágból


Genetika. Tartárgyi adatlap: tantárgy adatai

Genetika. Tartárgyi adatlap: tantárgy adatai Genetika Előadás a I. éves Génsebészet szakos hallgatók számára Tartárgyi adatlap: tantárgy adatai 2.1. Tantárgy címe Genetika 2.2. Előadás felelőse Dr. Mara Gyöngyvér, docens 2.3. Egyéb oktatási tevékenységek


10. CSI. A molekuláris biológiai technikák alkalmazásai

10. CSI. A molekuláris biológiai technikák alkalmazásai 10. CSI. A molekuláris biológiai technikák alkalmazásai A DNS mint azonosító 3 milliárd bázispár az emberi DNS-ben (99.9%-ban azonos) 0.1%-nyi különbség elegendő az egyedek megkülönböztetéséhez Genetikai


Genetikai panel kialakítása a hazai tejhasznú szarvasmarha állományok hasznos élettartamának növelésére

Genetikai panel kialakítása a hazai tejhasznú szarvasmarha állományok hasznos élettartamának növelésére Genetikai panel kialakítása a hazai tejhasznú szarvasmarha állományok hasznos élettartamának növelésére Dr. Czeglédi Levente Dr. Béri Béla Kutatás-fejlesztés támogatása a megújuló energiaforrások és agrár


Bioinformatika előadás

Bioinformatika előadás Bioinformatika 2 11. előadás Prof. Poppe László BME Szerves Kémia és Technológia Tsz. Bioinformatika proteomika Előadás és gyakorlat 2016.11.28. Bioinformatics Szerkezeti genomika, proteomika, biológia


Biokémiai kutatások ma

Biokémiai kutatások ma Nyitray László Biokémiai Tanszék Hb Biokémiai kutatások ma Makromolekulák szerkezet-funkció kutatása Molekuláris biológia minden szinten Redukcionista molekuláris biológia vs. holisztikus rendszerbiológia


TDK lehetőségek az MTA TTK Enzimológiai Intézetben

TDK lehetőségek az MTA TTK Enzimológiai Intézetben TDK lehetőségek az MTA TTK Enzimológiai Intézetben Vértessy G. Beáta egyetemi tanár TDK mind 1-3 helyezettek OTDK Pro Scientia különdíj 1 második díj Diákjaink Eredményei Zsűri különdíj 2 első díj OTDK


MIT TEHET A FIZIKUS A RÁKKUTATÁSÉRT? Pipek Orsolya ELTE TTK Komplex rendszerek fizikája tanszék. Atomoktól a csillagokig, Budapest, február 23.

MIT TEHET A FIZIKUS A RÁKKUTATÁSÉRT? Pipek Orsolya ELTE TTK Komplex rendszerek fizikája tanszék. Atomoktól a csillagokig, Budapest, február 23. MIT TEHET A FIZIKUS A RÁKKUTATÁSÉRT? Pipek Orsolya ELTE TTK Komplex rendszerek fizikája tanszék Atomoktól a csillagokig, Budapest, 2017. február 23. Pipek Orsolya, ELTE TTK Komplex rendszerek fizikája


Molekuláris evolúció második gyakorlat

Molekuláris evolúció második gyakorlat Molekuláris evolúció második gyakorlat Szekvenciák illesztése (alignment készítés) Szekvenciák szerkesztése Programok: ClustalX ( GeneDoc (


Genomadatbázisok Ld. Entrez Genome: Összes ismert genom, hierarchikus szervezésben (kromoszóma, térképek, gének, stb.)

Genomadatbázisok Ld. Entrez Genome: Összes ismert genom, hierarchikus szervezésben (kromoszóma, térképek, gének, stb.) Genomika Új korszak, paradigmaváltás, forradalom: a teljes genomok ismeretében a biológia adatokban gazdag tudománnyá válik. Új kutatási módszerek, új szemlélet. Hajtóerõk: Genomszekvenálási projektek


Proteomika alapfogalmak, módszerek, példák a proteomika alkalmazására

Proteomika alapfogalmak, módszerek, példák a proteomika alkalmazására Proteomika alapfogalmak, módszerek, példák a proteomika alkalmazására Alapfogalmak és omikák : Genomika Teljes humán genom szekvenciájának meghatározása: 2001. február Genom: Winkler, 1920; GENes and chromosomes


I. Strukturális Genomika II. Funkcionális Genomika III. Integratív Genomika

I. Strukturális Genomika II. Funkcionális Genomika III. Integratív Genomika I. Strukturális Genomika II. Funkcionális Genomika III. Integratív Genomika A genomika főbb területei Strukturális (szerkezeti ) genomika Funkcionális (működési) genomika Transzkriptomika Proteomika Integratív


É ő ő íí í ú í ő Ő ő ü ü ü ü ü Ü Ü ő ő ő ő í ő ő ő í íí í ő ű í Ó Ó Ó í Ö Ö í Á Ö Ü Ö É í Ö í ő Ö Ö Ö Á í Á ő ő ő ő É Í Í ő ú Ú ú Ö í ő Á Ö ő Í Í ő ű í ő ú ü íí í Ö ő ő ő ő Í ő ő ő ő í ő ő ő ő í É É í


ö Á ö É É ü ü É É Ő ö É ö Á ó ü É Ó Ö Á ú é ü ö é Ö é ü é é ü ü é é Ü é ö ö Ö ö é Á é é é é é ó é é é é ü é ö ö ö í é ü ú é é é ü ü é é é ü é é ö é ö é é ó ö ü é é é é ó ó ö í ó é ó é é é ó é é é ű ö é


Á Ó Á Ü ő ű Ú ö í ő Ó ú ö Á ú Ű Ó ű Ó í ű ö í ö ő ö ö í ö ö ő É ö Á ű Ó ö Á Ó ö í Á í í ö ű ö ú ö ö ú ö Ú ö ű Ó Ú ö Á í Ó í í Í í í Í ö Ú ö Á ú í Ó ő í ú ö Á ú Á í ú ö Á ú í ö Á ú í Ó ö ű Ó Ú Ú ű ő ö ü


Á Á É Á Ü ö ű ű ő í ő ö ő í ő ö í É ő í ű ö ő ő í ö ü ő ő ü ő ü í ö ö ü ö ü ő ő ü ü ő ü ö ő ő ő ő íő ö ö ö ü ő ő ő ő í ú ő ő í ü ö ő í ű ü ö ő ő ő ő í ú ö ö ő ö ö ö ö ü ő ő ö ő ő í í ő ö ü ö í ö ö ö ö


ó Í ó ó Ü ó ő Ú ő É ó É Í ő Ö ő ő ó Íó ó Ú ó É Ö ó ő ő Ú Íő ő ő ő ő ő Ú ő ó ó ő ő ő ő ó ő ő ő ő ő ő Í ő ő ó ő ő ó ő Í ő ó ő ő ő ő ő ó ó ó ő ő ó ő ő ő ő ő ő ó ő ő ő ó ő ő Á ű ő ő ő ő ő ő Í ó ő ő ő ő ó ó


Á Á Í ó ó ó ö ó Ü ö ú Í ó ö ö ó ú ö ó ö ö Ü ö ú ó ó ó ó ö ü ó ö ö ü Ü ö ö ú ó ó ö ú ö ó ó ó ó ö ó ö ó ö ó ö ű ö ö ö ű ö ö ű ö ö ö ű ö ö ó ö ö ó ó ü ö ö ű ö ö ö ó ö ű ö Ü ö ö ú ó ö ó ü ü ö ü ü ö Í ö ü ö


ó ő ó ó ö ö ú Á Í ö ó ő ö ú Í ó ü ó ő ö ú ö ó ő ó ő ü ő ű ö ö ü ő ü ó Ó ö ó ó ő ő ő ö Í ó ö ö ö ó ő ö ő Í ü ö ö ö ö ö ö ő ö ö ö ö ú ú ű ö ű ó ó ö ö ő ű ö ú ö ö ö ö ö ó Á ö ö ö ő ő ó ő ő Ö ő ú ó ö ú ú ű


í ö ő í ú ö ö í íí ü Ú Í Á ú ü í ö í ő í ö ő ű Í í ö ü ü ő ő ú í ő í ő ü ü ő Í ő Í í ü ö ö ö ö í ű ő ö ö ö í ü í Ó ö í ő ő í í ő Ó Ú Ő Íő Ő Ó ő ö ő ü ű í í ü ú Ő Í ő ő ő í ü ő É í Ő í ü ü ö ő í ü ö ö ü


Í ö Í ű ú ö ö ú ö É í í ö Ó ű í ö ö í ö ö ö í í ö í í ö ö í ö ö ö ű í ö ö ö ö ö ö ö ú ö í ö ö í ö ö ö ö ö ú ű ű ú ö ö í ö É í ö ö í ö ö ö ú ű ö ö í ö ú ű ö ö í í ú ö ö í ö í í ö ö ö ú ö ö ö ö Í ö ú ö ú


ö Ö ö Ö ö ö ö ö ö ö ö Ö ö Ö ö ö ö ö ö ű ö ö ö ö Ö ö Ő Ü ö ö Ö Ö ö ö ö ö ö ö ö ö Ü ö ö ö ű ö ö ö ö ű ö ű ö Ö Ü Ü ö ö ú Ű ÍŐ Ö Ő ÍŐ ö ö ö ö ű ö Ö Ö Ó ö ö Ö ö ö Ö ö ö Ö ö ű ö ö É ö ö Í Á Á Ő ű ö ű ú Ö Ü Á


í ö Ö Á í ö í í ö í ö ö í í ö ö ö ö í í ö í ö í ö í ü í í ö í í í í í ö ö í í í ú ö í í ö Á Á Á ü ú í ö Á í í í ö í í ü ö ö ö ö í ö í í í ú í í ű ú í í í í ö í ű í ö ö ü ö ű ö ö í í í í í ö ü í ö í ö ű


Ő Ö ö Ö É Á Ü É ó É ó ü É É Ö Ö Á É Ő ú É Á ú Ő Ö Ü Ö Ö ü ó ó ü Ü ű ö ú ó Á í ó ö ö ö ö ó ü í í Á í Ó í ó ü Ö ö ú ó ó ö ü ó ó ö í í ű ö ó í ü í ö í í ű ö ü Ő ü ú Ö ö ó ö ó ö ö ö ü ó ö í ó Ö ö Ő ü Ö Ö ü


ű í ö ö Á ü ü ö ö ö í í É ú ú ö ö ű í ö ü ö ú ü ű ú ö í í ú ö ú í ö ü í í ö í Á Ó É í ű ö ü ö ü ú ü ö ü ú ű ö ü ű ü í ü ű ü ü ö ű í ü í ö ü í í í í ö í ö ö ö Á ű ú ű ö ö ű í ö ö í ú í í ű í ö ú ö ö í Á


ö é Ö é ü ö é ü ö é Ö é ü í ü ü ü é é ü é é Ö ö é é é é ö ü ö ü ö é é ö é é ö é é ö ö é í é ü é é é í é ö é é ö é ö é ü é ü ú é é é é é í é é é é ö ö é é ö ö é é í í é í é ü ö ü Á é ö Á í ö í é ö ü ö é


ö ú í í í ő ű Ü Ű Í í Ő Á Á Ö Ő Ű Í ö ú í í í ú ő ö ű í í í ö Ó ő í í í ö ú í ö ö ö ö Ü ő ö ö ö ú ű ő ú ű ö ö ú ö ö ő Ü ö ö í í ő ö í í í í í í ö ö í ö ö í í ő í ő ö ő í ú í ö í ö í í ö ű ö ö Ó Ü ö ő ő


ú ű ö ö ü ü Í ö ö ö ö É Í É ú ú É ú ú ö É ö Í Ü ú Í ö ö Í ú ö ö ö ö ü ö ö ú ü Ü ö ü Í ö ö ű ö ö Í ű ú ö ö ö ö Í ö ö ű ö ö Í ü Í ü ú Í É ö ö ü ö ö Ü ö ö Í ü Í ö ü Í Í ö Í ö Í ü ö ú Í ú Í ö É ú Í ö ö Í É


É ö ö Í Í Í Ó Í Í Á Ó Á Ü Ú Í Á Á ű Á Ó Í Í É Á Ó Á Á ö ö Á Í Á Á ö ö ű ö ö Í Í ű Ö ű ö ö ű Í Í Ü ö ö Ó ű Í ö ö Í ö ö Ó ö Ö Í ö ö Ö ö ű ö ö Ó Í ű Ó ö ö ű ö ű Ö Ü Ö ű ű ö ö ö ö ö ö Íö ö Í Ö Ó ű ö ű ö ö


Ő Ö Ü Ö Ö ő ü ó í ü ü ő ü ó Ö ó ő ó ó ő ó ő í ő í ü ő ö ö ö ü í ü ö ö ö ö Ö ő ő Ö ő í ó ő ó ő Ö í ő ő ő ő ü ő ő ö ó ű ö ó ö ú ő ő ó ü ö í ü ö ö ó í ú ő ó ő í ö ö ö í ő ö ő ő ó ü ö ú ü ő ó ó ő ó ő ó í í


É É É Ó Ö É í Ö ő ü ó ő ó ű Á ű ó ő ó ü ó ő ű ő Ö ü É É É ó É ó ü ű í Ö ü ó ű í ó ő ó ő ü ó ü ő ó É Í ő ő ő Ú ó ő ő ő ó ű ó ő ó ü ő ő ő í ü ő ü ő ó Ü ő ó ő ő ó ő Ú ő ő ó ő í ó ő ü ó Í ő ő ü ő É í ő ü ó


ú Ö ü ő ő ú ú ű ő í ó ó í ó ú ő ü ú ű ő í ó ó í ó ű í ó ő Í ő ü ú ő ő í ó ú Ö ő Ü ó ő ő É ó ó ó ó ő ő ú ű ő í ó ú ű ő ú ú ő ű ő í ő ó í ű ő ü ú ó ő ő ó ű ő ő í í í í ó ű ú ő Á ó ő Á ú ó ó ő ó í ó ű í í


ú ő ó ú ö ő ü ú ö ő ó ó ó ü ő í ö í ó ú ő ó ó ó ú ó ú ó ő ő ö ö ő ó ú ó ő ó ő í Á Á ö ö ó ő ú ö ő ú ó í ő ü ü ü í ú ü ü ü ó ú í ü í ó ő ó ő í ú ü ú ó ü ü ö ó ü ó í ü ó ő ö ö í ü ú ó ő ó í ó ő ó í ó ó í


Á ó ü ő Ö Á ü ó ü ő Í ü Í Ó ü ő ő ó ó ó Í ó ü ó ő ő ó ó ü ú Í ő ő ó Ó ő ó ü ó Á ü ó ő ó Í Á Í ő ó ó ó ő ő Á ó ó ú ő Í ő ű ó Ó ü ó ó ú ó ő ú ü ő ó ó ó ő ó ó Ö ó ó ő ó ő ó ő ü ű ő ó ó ő ú ő ú ü Í ü ő ó ó


ü ö Ö ü ó ü ó ó ó Á Ő É ö Ö ü ó ü ú ó ó ó ö ó í í ö ú Ó É ö Ö ü ó ü ü ó ó ó ö ó í ü ö Ö ó ü ü ü ó ó ó ö ó ü í í í ó í ú ű ű ü ű ú í ü ö ö í ö ú ü ó ú ú ű í ü ö ö ó ú ó í ü ú ó ü ó ó ű ó í ü ű ü í ű í


ü ó Ö ü í ü ü ü ö É ó ó í ó ó ö ó ö ö ö í í ű ü ü ü Í í ü ü ü ö í ó í ó ó í ó í É ü ö í Í É í ö ú í ó í ö ö ó í ö ó ó ó ö ó ö í í ó ó í ó ó Ö í ö ö ó ö ó ú ó ö ó í ó ó í í ü ó í ö ó ó ü ü ó ö ó ú í ó í


Í ú ó ú ó ú ó ó Á ó ó ö ű ú Á ú ó ó ó Í ó ö ö ö Í ö ó ó ö ó ó ó ö ó ö ö ö ö ó ö ó ö ó ü ó ó ü ó ü ö ö ö ö Ő ó ó Íó ó ó ü ó ű ó ó ű ű ó ö ü ö ú ö ü ű ö ö ö ö ó ú ö ö ö ü Í Í Í Á ó ó ú ü ú Á ü ö Á ó ü ó


ü Ü ö ö ú Í ó í í ó ó ó ü ó ű ó í ó ó í ö ó ö ú ü ö Í í í ó ó ó ó Í ó ü ű ó í ó ó í ó Í í ó ü ö ú ó ó ó í í ó í í ű í ü ö í ó í ö í ú ó í ú ü ú Í í ü Í í í ó ü ö í ó í ó ü ö ó Í í í ó Í É ó ó ó Í í ö ö


ó ö ó Í Í Ó Í Á Í Í Í Ó Ú ó Í Ó ó Ó ó Í Ó Ó Ó Ó Ó Ó Ó ó Á Ó Ó ó ö ó Ú Í Í Ó Ó Ó Í Ó Ú É Í Í Í Ú Ó ő Í Í Ó Ó Ú Ó Ó ó Í ó Á Ó Ó Ó ó ó Í Ó Ó Ó Ó Ó Í Ú Í Í É ö Ó Ó Í Ó Ú Ó Ú Ó Ö Í Í Ú Ó Ó ó Ű Ó Ó Ó Ó Ó Ó Ó


ö ö ü ü ű ö Í ö ö ö ű Í ü ű ö ö ö ü ű ö ö ö ö ö Í ű ű ü ü Ó ű ö ö É ü ö ö ö ü ü É ö ü ö Á ü Á ű ü ű ű ű ű Í ÍÁ ü ö ö ö ü ü ü É ü ü Á ö ü ü ö ö ű ü ö ü ü ü ö ü ü ü ö ü ü ü ö ö ü ű ö ű ü ö ü ü ö ű ü Í ü


Í ű Á Á ű ü ü ü ű Í ü ü ü ü Í ű ű ü ü ű ü ü ű ü Í Í É Á Á Á É Á Ö Á Á Á ü É Ó Á Á Á Á É É Á ű É É Á ű ű Á Í Á Í É Á Á Á Á Á Á Ó Á ű ű ü ű ű ű ű ű ü ű Ó ü ű ü ü ű ü ű Í Í ü ű ü ü ü ü ü ű ü ű ü ü ü ü ü ű


Humán genom variációk single nucleotide polymorphism (SNP)

Humán genom variációk single nucleotide polymorphism (SNP) Humán genom variációk single nucleotide polymorphism (SNP) A genom ~ 97 %-a két különböző egyedben teljesen azonos ~ 1% különbség: SNP miatt ~2% különbség: kópiaszámbeli eltérés, deléciók miatt 11-12 millió


ó ö ÍÁ í ó í Á Á Á Á Á ü ö í í ó Í ő í ó ö ő ó ó ő ö ő í ö ú í í ő ó í í ö ö í ő í í ü ó ü ö ö ó ó ö ó ö ö ő ü ö ö ő ó ő ö í ü ö ö ó í ö ó ó ó ö ö ö ü ö ó ó ö í ó ó ó ö í í ú ö í í í í ü ő ö ö ó ű í ő


Az örökítőanyag. Az élőlények örökítőanyaga minden esetben nukleinsav (DNS,RNS) (1)Griffith, (2)Avery, MacLeod and McCarty (3)Hershey and Chase

Az örökítőanyag. Az élőlények örökítőanyaga minden esetben nukleinsav (DNS,RNS) (1)Griffith, (2)Avery, MacLeod and McCarty (3)Hershey and Chase SZTE, Orv. Biol. Int., Mol- és Sejtbiol. Gyak., VIII. Az örökítőanyag Az élőlények örökítőanyaga minden esetben nukleinsav (DNS,RNS) (1)Griffith, (2)Avery, MacLeod and McCarty (3)Hershey and Chase Ez az


Poligénes v. kantitatív öröklődés

Poligénes v. kantitatív öröklődés 1. Öröklődés komplexebb sajátosságai 2. Öröklődés molekuláris alapja Poligénes v. kantitatív öröklődés Azok a tulajdonságokat amelyek mértékegységgel nem, vagy csak nehezen mérhetők, kialakulásuk kevéssé


A genetikai vizsgálatok jelene, jövője a Ritka Betegségek vonatkozásában

A genetikai vizsgálatok jelene, jövője a Ritka Betegségek vonatkozásában Budapest, 2014. február 22. Ritka Betegségek Világnapja A genetikai vizsgálatok jelene, jövője a Ritka Betegségek vonatkozásában dr. Kósa János PentaCore Laboratórium, Budapest Semmelweis Egyetem I. sz.


Könyvtári informatika

Könyvtári informatika Tanmenet 2015/2016 tavaszi félév Doktori Iskola Könyvtári informatika Tantárgyfelelős: Ortutayné dr. Léces Melinda Oktató: Farkas Boglárka Ortutayné dr. Léces Melinda Pándi Dóra Sötét Krisztina Cél: A


Fehérje expressziós rendszerek. Gyógyszerészi Biotechnológia

Fehérje expressziós rendszerek. Gyógyszerészi Biotechnológia Fehérje expressziós rendszerek Gyógyszerészi Biotechnológia Expressziós rendszerek Cél: rekombináns fehérjék előállítása nagy tisztaságban és nagy mennyiségben kísérleti ill. gyakorlati (therapia) felhasználásokra


A DNS szerkezete. Genom kromoszóma gén DNS genotípus - allél. Pontos méretek Watson genomja. J. D. Watson F. H. C. Crick. 2 nm C G.

A DNS szerkezete. Genom kromoszóma gén DNS genotípus - allél. Pontos méretek Watson genomja. J. D. Watson F. H. C. Crick. 2 nm C G. 1955: 46 emberi kromoszóma van 1961: mrns 1975: DNS szekvenálás 1982: gén-bank adatbázisok 1983: R (polymerase chain reaction) Mérföldkövek 1 J. D. Watson F. H.. rick 2008 1953 2003 Watson genomja DNS


12/4/2014. Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció. 1952 Hershey & Chase 1953!!!

12/4/2014. Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció. 1952 Hershey & Chase 1953!!! Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció 1859 1865 1869 1952 Hershey & Chase 1953!!! 1879 1903 1951 1950 1944 1928 1911 1 1. DNS szerkezete Mi az örökítő anyag? Friedrich Miescher


Fehérjék rövid bevezetés

Fehérjék rövid bevezetés Receptorfehérj rjék szerkezetének felderítése Homológia modellezés Fehérjék rövid bevezetés makromolekulák számos biológiai funkció hordozói: enzimatikus katalízis, molekula transzport, immunválaszok,


Gyakorlati bioinformatika

Gyakorlati bioinformatika Gyakorlati bioinformatika Szekvenciaillesztés PhD kurzus 2. Szekvenciaillesztés Bagossi Péter Fajtái: - egyszer ill. többszörös illesztés - globális ill. lokális illesztés Alkalmazása: - adatbázisokban


Adatgy jtés, bibliográfia, hivatkozások. Az adatgy jtés folyamata

Adatgy jtés, bibliográfia, hivatkozások. Az adatgy jtés folyamata Adatgy jtés, bibliográfia, hivatkozások Az adatgy jtés folyamata A tananyag nem tárgyalja a tudományos kutatás módszereit. Az egyes tudományágak sajátos kutatásmódszertannal rendelkeznek. A szakterületek


Iridovírus izolálása törpeharcsából Magyarországon

Iridovírus izolálása törpeharcsából Magyarországon Iridovírus izolálása törpeharcsából Magyarországon Juhász Tamás, Woynárovichné Láng Mária, Csaba György, Dán Ádám NÉBIH Állategészségügyi Diagnosztikai Igazgatóság 2013. január 29. Iridovírus CSALÁD: IRIDOVIRIDAE


TÉMAKÖRÖK. Ősi RNS világ BEVEZETÉS. RNS-ek tradicionális szerepben



A humán mitokondriális genom: Evolúció, mutációk, polimorfizmusok, populációs vonatkozások. Egyed Balázs ELTE Genetikai Tanszék

A humán mitokondriális genom: Evolúció, mutációk, polimorfizmusok, populációs vonatkozások. Egyed Balázs ELTE Genetikai Tanszék A humán mitokondriális genom: Evolúció, mutációk, polimorfizmusok, populációs vonatkozások Egyed Balázs ELTE Genetikai Tanszék Endoszimbiotikus gén-transzfer (Timmis et al., 2004, Nat Rev Gen) Endoszimbiotikus


10. Genomika 2. Microarrayek és típusaik

10. Genomika 2. Microarrayek és típusaik 10. Genomika 2. 1. Microarray technikák és bioinformatikai vonatkozásaik Microarrayek és típusaik Korrelált génexpresszió mint a funkcionális genomika eszköze 2. Kombinált megközelítés a funkcionális genomikában



BIOINFORMATIKA Ungvári Ildikó 1 BIOINFORMATIKA Ungvári Ildikó Az elmúlt évtizedekben a molekuláris biológiai, genomikai technológiák robbanásszerű fejlődése a biológiai adatok mennyiségének exponenciális növekedéséhez vezetett. Ebben


A genomikai oktatás helyzete a Debreceni Egyetemen

A genomikai oktatás helyzete a Debreceni Egyetemen A genomikai oktatás helyzete a Debreceni Egyetemen Bálint Bálint L. GNTP Oktatás és Tudásmenedzsment Munkabizottság, 2009. június 10. Tények Debreceni Egyetemről 21000 nappali és 33000 összes hallgató


Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Azonosító szám: TÁMOP-4.1.2-08/1/A-2009-0011 Az orvosi


Fehérjeszerkezet, és tekeredés. Futó Kinga

Fehérjeszerkezet, és tekeredés. Futó Kinga Fehérjeszerkezet, és tekeredés Futó Kinga Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983 H 211861 N


Á Í Á Ó É ö á í á ő á á Á ő ő á ő á í á ő á á á á í ő ö í á á í á á ö ő á í ő áí á á ő á í í á ú ü ö á ú ö á í á á á ö á á ő á á á ő á ő á ú ü á ő á í ő ő ő áí á á ö ő á ő á á ő ő á í á ő á ő á á á ü ő


DNS, RNS, Fehérjék. makromolekulák biofizikája. Biológiai makromolekulák. A makromolekulák TÖMEG szerinti mennyisége a sejtben NAGY

DNS, RNS, Fehérjék. makromolekulák biofizikája. Biológiai makromolekulák. A makromolekulák TÖMEG szerinti mennyisége a sejtben NAGY makromolekulák biofizikája DNS, RNS, Fehérjék Kellermayer Miklós Tér Méret, alak, lokális és globális szerkezet Idő Fluktuációk, szerkezetváltozások, gombolyodás Kölcsönhatások Belső és külső kölcsöhatások,


Hamar Péter. RNS világ. Lánczos Kornél Gimnázium, Székesfehérvár, 2014. október 21. 1 26

Hamar Péter. RNS világ. Lánczos Kornél Gimnázium, Székesfehérvár, 2014. október 21. 1 26 Hamar Péter RNS világ Lánczos Kornél Gimnázium, Székesfehérvár, 2014. október 21. 1 26 Főszereplők: DNS -> RNS -> fehérje A kód lefordítása Dezoxy-ribo-Nuklein-Sav: DNS az élet kódja megkettőződés (replikáció)


Ó Ö ő ü ü Ö ő ü ó í ó ő í ő ó ü ő ő ő Ő É Ü Ö ő ü ü Ö ő ü ó í ó ő ü Ö ő ü ő ü ó ó ó ő ő ő Ö Ö ó í í ü ő ó ó í ü ü Ö ű ő í í í í í í ő Ó ó Ó ó Ó ő Ö ű í ő ó Ó ó í ő ő ő ő ü í í ű í í í ő ü ő ú ű í ű ő ó


Oktatási azonosító Tantárgy Elért pontszám Magyar nyelv Matematika Magyar nyelv Matematika

Oktatási azonosító Tantárgy Elért pontszám Magyar nyelv Matematika Magyar nyelv Matematika Oktatási azonosító Tantárgy Elért pontszám 76894971600 Magyar nyelv 28 76894971600 Matematika 18 75983808936 Magyar nyelv 22 75983808936 Matematika 17 78988181589 Magyar nyelv 32 78988181589 Matematika


Fehérje szintézis 2. TRANSZLÁCIÓ Molekuláris biológia kurzus 7. hét. Kun Lídia Genetikai, Sejt- és immunbiológiai Intézet

Fehérje szintézis 2. TRANSZLÁCIÓ Molekuláris biológia kurzus 7. hét. Kun Lídia Genetikai, Sejt- és immunbiológiai Intézet Fehérje szintézis 2. TRANSZLÁCIÓ Molekuláris biológia kurzus 7. hét Kun Lídia Genetikai, Sejt- és immunbiológiai Intézet Gén mrns Fehérje Transzkripció Transzláció A transzkriptum : mrns Hogyan mutatható


BÁLINT András Beszámoló az AGRISAFE által támogatott tanulmányútról 2008 november 2009 február. 1. Az IPK bemutatása 2.

BÁLINT András Beszámoló az AGRISAFE által támogatott tanulmányútról 2008 november 2009 február. 1. Az IPK bemutatása 2. BÁLINT András Beszámoló az AGRISAFE által támogatott tanulmányútról 2008 november 2009 február 1. Az IPK bemutatása 2. A TILLING módszer Hol található az IPK? Gatersleben Általános adatok az IPK-ról Leibniz


Biomassza alapú bioalkohol előállítási technológia fejlesztése metagenomikai eljárással

Biomassza alapú bioalkohol előállítási technológia fejlesztése metagenomikai eljárással Biomassza alapú bioalkohol előállítási technológia fejlesztése metagenomikai eljárással Kovács Zoltán ügyvezető DEKUT Debreceni Kutatásfejlesztési Közhasznú Nonprofit Kft. Problémadefiníció Első generációs


A minimális sejt. Avagy hogyan alkalmazzuk a biológia több területét egy kérdés megválaszolására

A minimális sejt. Avagy hogyan alkalmazzuk a biológia több területét egy kérdés megválaszolására A minimális sejt Avagy hogyan alkalmazzuk a biológia több területét egy kérdés megválaszolására Anyagcsere Gánti kemoton elmélete Minimum sejt Top down: Meglevő szervezetek genomjából indulunk ki Bottom


Géntechnológia és fehérjemérnökség

Géntechnológia és fehérjemérnökség Géntechnológia és fehérjemérnökség Szerkesztette: Nyitray László Alexa Anita (12. és 13. fejezet) Fodor Krisztián (3. és 9. fejezet) Garai Ágnes (4. és 5. fejezet) Glatz Gábor (6. és 7. fejezet) Radnai


Tipizálási módszerek alkalmazása methicillin-rezisztens Staphylococcus aureus (MRSA) törzsek molekuláris epidemiológiai vizsgálatai során

Tipizálási módszerek alkalmazása methicillin-rezisztens Staphylococcus aureus (MRSA) törzsek molekuláris epidemiológiai vizsgálatai során Tipizálási módszerek alkalmazása methicillin-rezisztens Staphylococcus aureus (MRSA) törzsek molekuláris epidemiológiai vizsgálatai során Ungvári Erika, Tóth Ákos Magyar Infektológiai és Klinikai Mikrobiológiai


Bioinformatika 2 10.el

Bioinformatika 2 10.el 10.el őadás Prof. Poppe László BME Szerves Kémia és Technológia Tsz. Bioinformatika proteomika Előadás és gyakorlat 2009. 04. 24. Genomikavs. proteomika A genomika módszereivel nem a tényleges fehérjéket


CzB 2010. Élettan: a sejt

CzB 2010. Élettan: a sejt CzB 2010. Élettan: a sejt Sejt - az élet alapvető egysége Prokaryota -egysejtű -nincs sejtmag -nincsenek sejtszervecskék -DNS = egy gyűrű - pl., bactériumok Eukaryota -egy-/többsejtű -sejmag membránnal


Az információ fogalomköre, adatbázisok/adatbankok szerepe az orvosi gyakorlatban és a kutatásban

Az információ fogalomköre, adatbázisok/adatbankok szerepe az orvosi gyakorlatban és a kutatásban 1. Az információ fogalomköre, adatbázisok/adatbankok szerepe az orvosi gyakorlatban és a kutatásban 2. A orvosi-/bio-informatika mint interdiszciplina BIOLÓGIA BIOTECHNOLÓGIA FEJLŐDÉSTAN FIZIOMIKA (EGY


A fehérjék hierarchikus szerkezete

A fehérjék hierarchikus szerkezete Fehérjék felosztása A fehérjék hierarchikus szerkezete Smeller László Semmelweis Egyetem Biofizikai és Sugárbiológiai Intézet Biológiai funkció alapján Enzimek (pl.: tripszin, citokróm-c ) Transzportfehérjék


ESZTERHÁZY KÁROLY FŐISKOLA, EGER. Beszámoló könyvtári szakmai gyakorlatról

ESZTERHÁZY KÁROLY FŐISKOLA, EGER. Beszámoló könyvtári szakmai gyakorlatról ESZTERHÁZY KÁROLY FŐISKOLA, EGER Beszámoló könyvtári szakmai gyakorlatról Digitálisarchívum-fejlesztő szak Humán Informatika Tanszék Média Informatika Intézet Zádori Zsuzsanna Netpun kód: U5AT4N A szakmai


NÖVÉNYGENETIKA. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP /1/A

NÖVÉNYGENETIKA. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP /1/A NÖVÉNYGENETIKA Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 A citológia és a genetika társtudománya Citogenetika A kromoszómák eredetét, szerkezetét, genetikai funkcióját,


A HLTF koordinált fehérje és DNS átrendezése és aktivitásának összehasonlítása a Bloom szindróma helikáz fehérjével

A HLTF koordinált fehérje és DNS átrendezése és aktivitásának összehasonlítása a Bloom szindróma helikáz fehérjével A HLTF koordinált fehérje és DNS átrendezése és aktivitásának összehasonlítása a Bloom szindróma helikáz fehérjével Ph.D disszertáció tézisei Yathish Jagadheesh Achar Témavezető: Dr. Haracska Lajos Magyar


A genomiális medicina szép új világa

A genomiális medicina szép új világa A genomiális medicina szép új világa HALADÁS A REUMATOLÓGIA, IMMUNOLÓGIA ÉS OSTEOLÓGIA TERÜLETÉN 2012 2014 2015. ÁPRILIS 16. Falus András Semmelweis Egyetem Genetikai Sejt és Immunbiológiai Intézet A medicina


Előadások témája: Elsősorban a DNS, a gének és genomok molekuláris biológiája. Tételsorok mindenkinek a honlapon:

Előadások témája: Elsősorban a DNS, a gének és genomok molekuláris biológiája. Tételsorok mindenkinek a honlapon: MOLEKULÁRIS BIOLÓGIA Előadások témája: Elsősorban a DNS, a gének és genomok molekuláris biológiája Előadásokra járni kötelező, de nincs névsor olvasás. Zárthelyi dolgozat nincs. Vegyész és hidrobiológus


Génkifejeződési vizsgálatok. Kocsy Gábor

Génkifejeződési vizsgálatok. Kocsy Gábor Génkifejeződési vizsgálatok MTA Mezőgazdasági Kutatóintézete Növényi Molekuláris Biológia Osztály A génkifejeződés A sejtmag géneket tartalmaz; (fehérjéket, RNSeket kódoló); A gének átíródnak mrns; Pre-mRNS


RNS-ek. 1. Az ősi RNS Világ: - az élet hajnalán. 2. Egy már ismert RNS Világ: - a fehérjeszintézis ben résztvevő RNS-ek

RNS-ek. 1. Az ősi RNS Világ: - az élet hajnalán. 2. Egy már ismert RNS Világ: - a fehérjeszintézis ben résztvevő RNS-ek RNS-ek RNS-ek 1. Az ősi RNS Világ: - az élet hajnalán 2. Egy már ismert RNS Világ: - a fehérjeszintézis ben résztvevő RNS-ek 3. Egy újonnan felfedezett RNS Világ: - szabályozó RNS-ek 4. Transzkripció Ősi


Az Akadémiai Kiadó folyóirat-kiadási tapasztalatai

Az Akadémiai Kiadó folyóirat-kiadási tapasztalatai Az Akadémiai Kiadó folyóirat-kiadási tapasztalatai Dr. Bencsik Péter Természettudományi szerkesztőség vezetője 2015. október 7. Bölcsességfog mit tud erről a Scopus? Idősebb férfiak sokat nyafognak Mivel


Felhasználói segédlet a PubMed adatbázis használatához. Publikációk keresése, letöltése valamint importja

Felhasználói segédlet a PubMed adatbázis használatához. Publikációk keresése, letöltése valamint importja Felhasználói segédlet a PubMed adatbázis használatához. Publikációk keresése, letöltése valamint importja A PubMed Medline adatbázis internet címe:


DOKTORI ÉRTEKEZÉS. Molekuláris biológiai módszerek fejlesztése gluténmentesség ellenırzésére. Némedi Erzsébet

DOKTORI ÉRTEKEZÉS. Molekuláris biológiai módszerek fejlesztése gluténmentesség ellenırzésére. Némedi Erzsébet DOKTORI ÉRTEKEZÉS Molekuláris biológiai módszerek fejlesztése gluténmentesség ellenırzésére Némedi Erzsébet Központi Élelmiszer-tudományi Kutatóintézet Budapest 2009 TARTALOMJEGYZÉK JELÖLÉSEK ÉS RÖVIDÍTÉSEK


Biokatalízis, biokonverziók, biotranszformációk Rákhely, Gábor

Biokatalízis, biokonverziók, biotranszformációk Rákhely, Gábor Biokatalízis, biokonverziók, biotranszformációk Rákhely, Gábor Biokatalízis, biokonverziók, biotranszformációk Rákhely, Gábor Publication date 2012 Szerzői jog 2012 Szegedi Tudományegyetem TÁMOP-4.1.2.A/1-11/1





3. Sejtalkotó molekulák III.

3. Sejtalkotó molekulák III. 3. Sejtalkotó molekulák III. Fehérjék, fehérjeszintézis (transzkripció, transzláció, posztszintetikus módosítások). Enzimműködés 3.1 Fehérjék A genetikai információ egyik fő manifesztálódása Számos funkció
