A sejtek közötti kommunikáció módjai és mechanizmusa. kommunikáció a szomszédos vagy a távoli sejtek között intracellulári jelátviteli folyamatok

Save this PDF as:
 WORD  PNG  TXT  JPG

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "A sejtek közötti kommunikáció módjai és mechanizmusa. kommunikáció a szomszédos vagy a távoli sejtek között intracellulári jelátviteli folyamatok"

Átírás

1 A sejtek közötti kommunikáció módjai és mechanizmusa kommunikáció a szomszédos vagy a távoli sejtek között intracellulári jelátviteli folyamatok

2 A kommunikáció módjai szomszédos sejtek esetén autokrin és parakrin közvetlen kapcsolat gap junctions

3 A kommunikáció módjai távoli sejtek esetén endokrin idegi neurendokrin

4 Intracellulári jelátviteli folyamatok extracelluláris ligandok ioncsatornák

5 Ioncsatornák kis méretű, nagy szelektivitású protein komplexek ionok és víz molekulák transzportja nagy transzport sebesség a transzport gradiens irányába megy nem igényel energiát

6 Az ioncsatorna általános felépítése (struktúra) a membrán integráns fehérjéi több alegységből felépülő komplex molekulák alegység transzmembrán szegmentum a szegmentumokat összekötő hurkok (loop) a felelősek a regulációért és a fehérje-fehérje kölcsönhatásokért α helix alkotja a pórust - a csatorna pórusa töltéssel rendelkező oldalláncokkal bélelt szelektivitási filter szerkezetileg számos, eltérő családot alkotnak nincs mindíg nyitva = eltérő kapuzási mechanizmus

7 Az ioncsatornákat kódoló gének egy csatorna több gén terméke a csatornát kódoló géneknek több másolata is lehet a csatorna homológiák az általános strukturális felépítésen alapulnak és nem az ion szelektivitáson.

8 Az ioncsatorna tulajdonságai: 1. szelektivitás 2. kapuzás 3. aktiváció

9 1. szelektivitás: mi tud átjutni a csatornán? függ a pórus méretétől a pórust bélelő töltésektől - nem szelektív különböző ionok (kation, anion) kis szerves molekulák - töltés-szelektív csak ionok számára átjárható - ion-specifikus specifikus egy adott ionra

10 a csatorna pórusa töltéssel rendelkező oldalláncokkal bélelt (kation-szelektív csatorna negatívan töltött) a pórusban töltéseket változtatva, megváltozik a szelektivitás (pl. kation anion) a pórus régióban bekövetkező mutáció megváltoztatja a szelektivitást a specifikus kötőhely diszkriminál hasonló ionok között is (pl. Na + és K + ) csak a feszültség-függő ioncsatornák rendelkeznek nagyfokú szelektivitással. 1. A szelektivitási filter olyan transzmembrán hélixek, amelyek egymás mellett helyezkednek el a citoplazmatikus oldalon egy ion szűrőt formál tökéletes illeszkedés a nagy szelektivitású csatornákon az ionok dehidrált formában jutnak át A hidratált ionok rádiusza: K + < Na + << Ca 2+

11 2. Kapuzás, a csatorna működés szabályozása rövid távú szabályozás - kapuzás (gating) állandóan nyitott állapot két diszkrét állapot zárt, nyitott állapotok nyitott (vezetőképes) zárt (nincs vezetés)

12 2. Kapuzás, a csatorna működés szabályozása rövid távú szabályozás - kapuzás (gating) állandóan nyitott állapot két diszkrét állapot zárt, nyitott állapotok nyitott (vezetőképes) zárt (nincs vezetés) több diszkrét állapot zárt, nyitott, inaktív állapotok (=nyitott állapot de nem vezet) a csatorna struktura vagy externális részecske blokkolja a nyitott csatornát az állapotok közötti átmenetek feszültség és idő függőek hosszú távú expresszió - A sejtek a funkciójuktól függően különböző csatorna fehérjéket expresszálnak a csatorna expresszió szabályozható C O I

13 2. Mitől függ a csatorna kapuzása? nem kapuzó csatorna - mindíg nyitva van kapuzó csatornák feszültség különbség ligand mechanikai inger, hő (hőingadozás ) zárt nyitott

14 A csatorna nyitása és záródása, modellek A kapuzás mechanizmusai: a csatorna fehérjék konformáció változása felelős a pórus nyitásáért, záródásáért a fehérjék 3D strukturáját az atomi, elektromos és hidrofób erők alakítják az energiát, ami a proteinek konformáció változásához szükséges, a kapuzást előidéző okok biztosítják a csatorna egyes régióinak konformációváltozása a csatorna általános strukturális változása a csatorna pórusát blokkoló molekularész

15 3. Csatorna-aktiváció neurotranszmitterek, hormonok foszforiláció - intracelluláris jelátviteli kaszkádok feszültség a membrán disztorziója

16 Az ioncsatornák osztályozása - a kapuzás alapján: kapuzó nem-kapuzó - a csatorna megnyílását kontrolláló hatások szerint ligand-vezételt csatornák feszültség-vezérelt csatornák stretch aktivált csatornák - lokalizációjuk alapján: felszíni mebránban elhelyezkedő csatornák intracelluláris membránban elhelyezkedő csatornák intercelluláris csatornák - ionszelektivitás alapján: K +, Na +, Ca 2+, Cl - stb. - a csatornákat kódoló gének alapján Kir, K v, Ca v stb.

17 Feszültség-függő nátrium csatorna szerkezete - 4 homológ domain - 6 transzmembrán szegment/domain S4 transzmembrán szegment a feszültség szenzor - a II. és IV. domén közötti hurok (IG) a csatorna inaktivációs "kapuja" - a csatorna porusa 1.2 nm széles, ami a csatornán belül 0,3-0,5 nm-re szűkül

18 Feszültség vezérlés (Voltage gating) A csatorna a membránpotenciál változás hatására nyílik nyitott, inaktív és zárt állapotai vannak specifikus egy adott ionra hasonló domén struktúrával rendelkeznek pozitív töltéssel rendelkező oldalláncok (Lys, Arg) érzékelik a membránpotenciál változását (voltage sensor). hiperpolarizált (IC negatív ) : a kapu zárva van depolarizált (IC pozitív): a kapu nyitva van

19 Feszültség vezérelt csatornák nátrium : I, II, III, µ1, H1, PN3 kálium : K A, K v (1-5), K v (r), K v (s),k SR, BK Ca, IK Ca, SK Ca, K M, K ACh, Kir kalcium: L, N, P, Q, T klorid: ClC-0 - ClC-8

20 A ligand vezérelt csatorna - olyan ioncsatorna, amelyik neurotranszmitter kötőhellyel rendelkezik (IC vagy EC) - nem szelektív ioncsatornák - a ligand kötődése a receptor szerkezetének konformáció változását idézi elő, amely hatására a csatorna vezetőképessé válik. - néhány csatorna kettős vezérléssel rendelkezik, pl. NMDA receptorok, glutamát és depolarizáció kell a megnyílásához - az ionáram megváltoztatja a csatorna közelében a membránpotenciált, ami feszültség-függő csatornákat aktiválhat

21 Elektrotónusos potenciál Ligand 1 Ligand µm L1 0.1 µm L µm L1 0.1 µm L2 dekrementális terjedés

22 A ligand-vezérelt ioncsatorna családok jellemzői N-teminális ligand-kötő domain hidrofób intramembrán domének (M1-M4) töltéssel rendelkező pórus-bélelő domainek (M2) nagy intracelluláris loop az M3 és M4 domainek között

23 Ligand-vezérelt ioncsatornák = ionotróp receptorok receptor purinerg receptorok ligand ATP Cys-loop receptorok izom típusú nachr neuronális típusú nachr szerotonin 5-HT3R GABA A R glicin R ACh ACh szerotonin GABA glicin glutamát receptorok kainát AMPA NMDA glutamát, glicin

24 Extracelluláris ligand-vezérelt csatornák nicotin AChR (izmok): α 2 βγδ (embryonic), α 2 βεδ (adult) nicotin AChR (neuronalis): α(2-10), β(2-4) glutamate: NMDA, kainate, AMPA P2X (ATP) 5-HT 3 GABA A : α(1-6), β(1-4), γ (1-4), δ, ε, ρ(1-3) Glycine

25 Intracelluláris ligand-vezérelt csatornák leukotriene C4-gated Ca2+ ryanodine receptor Ca2+ IP3-gated Ca2+ IP4-gated Ca2+ Ca2+-gated K+ Ca2+-gated nonselective cation Ca 2+ -gated Cl camp cation cgmp cation camp chloride ATP Cl volume-regulated Cl arachidonic acidactivated K + Na + -gated K +

26 Stretch aktivált csatornák -kevéssé általános formája a csatorna szabályozásnak -a csatorna megnyílását a membrán disztorziója okozza - a szenzoros idegekre jellemző, pl tapintás - a nyomás a bőrön az idegvégződések disztorzióját okozza, aminek hatására megnyílnak a strech-aktivált csatornák - megváltozik a membránpotenciál, ami a Na + csatornák aktiválódásán keresztül akciós potenciált vált ki

27 ION PUMPÁK Az elektrokémiai grádiens ellenében transzportálják az ionokat strukturális különbségek eltérő funció strukturálisan hasonló hasonló funkció P-típusú V-típusú F-típusú ststrukturális különbségek eltérő funció

28 P-típusú pumpa -a legegyszerübb struktúráju pumpa -4 alegység, 2 α és 2 β - foszforilállódik (pl. a pumpa foszofrilálódása biztosítja az ionmozgatáshoz az energiát) -számos ion transzportját végzik (pl. kalcium, kálium, nátrium)

29 A Ca 2+ ATP-áz katalítikus ciklusa A kalcium-kötő forma foszforilációja szolgáltatja a transzporthoz az energiát. citoplazmatikus oldal lumen

30 F-típusú pumpa - komplex struktúra - ATP termelésben vesz részt - mitokondriumokban és kloroplasztokban fordul elő -proton pumpa

31 V- típusú pumpa - komplex struktúra (leglább 7 különböző fehérje alkotja számos alegységből áll) - nem foszforilálódik, közvetlenül az ATP energiáját használja fel - protonpumpa

32 Pumpaműködés szabályozása 1. a pumpafehérjék számának változása - hormonok fehérjeszintézis - dopamin csatorna traffiking 2. a pumpa aktivitásának módosítása - a membrán két oldalán lévő ionkoncentrációk - ATP, ADP, P i - membránpotenciál - camp-függő PKA, PKC -ph - kis horhonyzó fehérjék (ankyrin, adducin)

Az ioncsatorna fehérjék szerkezete, működése és szabályozása. A patch-clamp technika

Az ioncsatorna fehérjék szerkezete, működése és szabályozása. A patch-clamp technika Az ioncsatorna fehérjék szerkezete, működése és szabályozása. A patch-clamp technika Panyi György 2014. November 12. Mesterséges membránok ionok számára átjárhatatlanok Iontranszport a membránon keresztül:

Részletesebben

Egy idegsejt működése

Egy idegsejt működése 2a. Nyugalmi potenciál Egy idegsejt működése A nyugalmi potenciál (feszültség) egy nem stimulált ingerelhető sejt (neuron, izom, vagy szívizom sejt) membrán potenciálját jelenti. A membránpotenciál a plazmamembrán

Részletesebben

Gyógyszerészeti neurobiológia. Idegélettan

Gyógyszerészeti neurobiológia. Idegélettan Az idegrendszert felépítő sejtek szerepe Gyógyszerészeti neurobiológia. Idegélettan Neuronok, gliasejtek és a kémiai szinapszisok működési sajátságai Neuronok Információkezelés Felvétel Továbbítás Feldolgozás

Részletesebben

IONCSATORNÁK. I. Szelektivitás és kapuzás. III. Szabályozás enzimek és alegységek által. IV. Akciós potenciál és szinaptikus átvitel

IONCSATORNÁK. I. Szelektivitás és kapuzás. III. Szabályozás enzimek és alegységek által. IV. Akciós potenciál és szinaptikus átvitel IONCSATORNÁK I. Szelektivitás és kapuzás II. Struktúra és funkció III. Szabályozás enzimek és alegységek által IV. Akciós potenciál és szinaptikus átvitel V. Ioncsatornák és betegségek VI. Ioncsatornák

Részletesebben

A sejtek közöti kommunikáció formái. BsC II. Sejtélettani alapok Dr. Fodor János

A sejtek közöti kommunikáció formái. BsC II. Sejtélettani alapok Dr. Fodor János A sejtek közöti kommunikáció formái BsC II. Sejtélettani alapok Dr. Fodor János 2010. 03.19. I. Kommunikáció, avagy a sejtek informálják egymást Kémiai jelátvitel formái Az üzenetek kémiai úton történő

Részletesebben

S-2. Jelátviteli mechanizmusok

S-2. Jelátviteli mechanizmusok S-2. Jelátviteli mechanizmusok A sejtmembrán elválaszt és összeköt. Ez az információ-áramlásra különösen igaz! 2.1. A szignál-transzdukció elemi lépései Hírvivô (transzmitter, hormon felismerése = kötôdés

Részletesebben

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Azonosító szám: TÁMOP-4.1.2-08/1/A-2009-0011 Az orvosi

Részletesebben

9. előadás Sejtek közötti kommunikáció

9. előadás Sejtek közötti kommunikáció 9. előadás Sejtek közötti kommunikáció Intracelluláris kommunikáció: Elmozdulás aktin szálak mentén miozin segítségével: A mikrofilamentum rögzített, A miozin mozgékony, vándorol az aktinmikrofilamentum

Részletesebben

Receptorok és szignalizációs mechanizmusok

Receptorok és szignalizációs mechanizmusok Molekuláris sejtbiológia: Receptorok és szignalizációs mechanizmusok Dr. habil Kőhidai László Semmelweis Egyetem Genetikai, Sejt- és Immunbiológiai Intézet Sejtek szignalizációs kapcsolatai Sejtek szignalizációs

Részletesebben

NÖVÉNYGENETIKA. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP /1/A

NÖVÉNYGENETIKA. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP /1/A NÖVÉNYGENETIKA Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 A NÖVÉNYI TÁPANYAG TRANSZPORTEREK az előadás áttekintése A tápionok útja a növényben Növényi tápionok passzív és

Részletesebben

A szívizomsejt ioncsatornái és azok működése

A szívizomsejt ioncsatornái és azok működése A szívizomsejt ioncsatornái és azok működése Dr. Bárándi László Viktor Passzív transzport Egyszerű diffúzió: H 2 O, O 2, CO 2, lipid oldékony anyagok, ionok Csatornán át történő diffúzió: Permeabilitás:

Részletesebben

Receptorok, szignáltranszdukció jelátviteli mechanizmusok

Receptorok, szignáltranszdukció jelátviteli mechanizmusok Receptorok, szignáltranszdukció jelátviteli mechanizmusok Sántha Péter 2016.09.16. A sejtfunkciók szabályozása - bevezetés A sejtek közötti kommunikáció fő típusai: Endokrin Parakrin - Autokrin Szinaptikus

Részletesebben

Membránpotenciál. Nyugalmi membránpotenciál. Akciós potenciál

Membránpotenciál. Nyugalmi membránpotenciál. Akciós potenciál Membránpotenciál Vig Andrea 2014.10.29. Nyugalmi membránpotenciál http://quizlet.com/8062024/ap-11-nervous-system-part-5-electrical-flash-cards/ Akciós potenciál http://cognitiveconsonance.info/2013/03/21/neuroscience-the-action-potential/

Részletesebben

Az akciós potenciál (AP) 2.rész. Szentandrássy Norbert

Az akciós potenciál (AP) 2.rész. Szentandrássy Norbert Az akciós potenciál (AP) 2.rész Szentandrássy Norbert Ismétlés Az akciós potenciált küszöböt meghaladó nagyságú depolarizáció váltja ki Mert a feszültségvezérelt Na + -csatornákat a depolarizáció aktiválja,

Részletesebben

A jel-molekulák útja változó hosszúságú lehet. A jelátvitel. hírvivő molekula (messenger) elektromos formában kódolt információ

A jel-molekulák útja változó hosszúságú lehet. A jelátvitel. hírvivő molekula (messenger) elektromos formában kódolt információ A jelátvitel hírvivő molekula (messenger) elektromos formában kódolt információ A jel-molekulák útja változó hosszúságú lehet 1. Endokrin szignalizáció: belső elválasztású mirigy véráram célsejt A jelátvitel:

Részletesebben

MULTICELLULÁRIS SZERVEZŐDÉS: SEJT-SEJT (SEJT-MÁTRIX) KÖLCSÖNHATÁSOK 1. Bevezetés (2.)Extracelluláris mátrix (ECM) (Kollagén, hialuron sav,

MULTICELLULÁRIS SZERVEZŐDÉS: SEJT-SEJT (SEJT-MÁTRIX) KÖLCSÖNHATÁSOK 1. Bevezetés (2.)Extracelluláris mátrix (ECM) (Kollagén, hialuron sav, MULTICELLULÁRIS SZERVEZŐDÉS: SEJT-SEJT (SEJT-MÁTRIX) KÖLCSÖNHATÁSOK 1. Bevezetés (2.)Extracelluláris mátrix (ECM) (Kollagén, hialuron sav, proteoglikánok) (3.)Multiadhéziós fehérjék és sejtfelszíni receptorok

Részletesebben

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Azonosító szám: TÁMOP-4.1.2-08/1/A-2009-0011 Az orvosi

Részletesebben

In vitro elektrofiziológiai technikák Mike Árpád

In vitro elektrofiziológiai technikák Mike Árpád In vitro elektrofiziológiai technikák Mike Árpád 2011-05-20 1. A sejt szintű elektrofiziológia alapjai: Története Technikák Ionáramok szelektivitása, iránya, nagysága, hatása a membránpotenciálra 2. FAQ

Részletesebben

A transzportfolyamatok és a sejtek közötti kommunikáció

A transzportfolyamatok és a sejtek közötti kommunikáció A transzportfolyamatok és a sejtek közötti kommunikáció A sejtmembrán protektív és szelektív barrier kompartmentalizáció: sejtfelszín és sejtorganellumok borítása 1926 szénhidrát 1943 zsírsav 1972 poláros

Részletesebben

Szignáltranszdukció Mediátorok (elsődleges hírvivők) az információ kémiailag kódolt

Szignáltranszdukció Mediátorok (elsődleges hírvivők) az információ kémiailag kódolt Szignáltranszdukció Mediátorok (elsődleges hírvivők) az információ kémiailag kódolt apoláros szerkezet (szabad membrán átjárhatóság) szteroid hormonok, PM hormonok, retinoidok hatásmech.: sejten belül

Részletesebben

BIOFIZIKA. Membránpotenciál és transzport. Liliom Károly. MTA TTK Enzimológiai Intézet

BIOFIZIKA. Membránpotenciál és transzport. Liliom Károly. MTA TTK Enzimológiai Intézet BIOFIZIKA 2012 10 15 Membránpotenciál és transzport Liliom Károly MTA TTK Enzimológiai Intézet liliom@enzim.hu A biofizika előadások temamkája 1. 09-03 Biofizika: fizikai szemlélet, modellalkotás, biometria

Részletesebben

A szívizom akciós potenciálja, és az azt meghatározó ioncsatornák

A szívizom akciós potenciálja, és az azt meghatározó ioncsatornák A szívizom akciós potenciálja, és az azt meghatározó ioncsatornák Dr. Jost Norbert SZTE, ÁOK Farmakológiai és Farmakoterápiai Intézet Az ingerület vezetése a szívben Conduction velocity in m/s Time to

Részletesebben

Intracelluláris ion homeosztázis I.-II. Február 15, 2011

Intracelluláris ion homeosztázis I.-II. Február 15, 2011 Intracelluláris ion homeosztázis I.II. Február 15, 2011 Ca 2 csatorna 1 Ca 2 1 Ca 2 EC ~2 mm PLAZMA Na /Ca 2 cserélő Ca 2 ATPáz MEMBRÁN Ca 2 3 Na ATP ADP 2 H IC ~100 nm citoszol kötött Ca 2 CR CSQ SERCA

Részletesebben

A sejtfelszíni receptorok három fő kategóriája

A sejtfelszíni receptorok három fő kategóriája A sejtfelszíni receptorok három fő kategóriája 1. Saját enzimaktivitás nélküli receptorok 1a. G proteinhez kapcsolt pl. adrenalin, szerotonin, glukagon, bradikinin receptorok 1b. Tirozin kinázhoz kapcsolt

Részletesebben

4. Egy szarkomer sematikus rajza látható az alanti ábrán. Aktív kontrakció esetén mely távolságok csökkenése lesz észlelhető? (3)

4. Egy szarkomer sematikus rajza látható az alanti ábrán. Aktív kontrakció esetén mely távolságok csökkenése lesz észlelhető? (3) Budapesti Műszaki és Gazdaságtudományi Egyetem, Budapest, 2009. jan. 6. Villamosmérnöki és Informatikai Kar Semmelweis Egyetem Budapest Egészségügyi Mérnök Mesterképzés Felvételi kérdések orvosi élettanból

Részletesebben

A harántcsíkolt izom struktúrája általános felépítés

A harántcsíkolt izom struktúrája általános felépítés harántcsíkolt izom struktúrája általános felépítés LC-2 Izom LC1/3 Izom fasciculus LMM S-2 S-1 HMM rod Miozin molekula S-1 LMM HMM S-2 S-1 Izomrost H Band Z Disc csík I csík M Z-Szarkomér-Z Miofibrillum

Részletesebben

MEMBRÁNSZERKEZET, MEMBRÁNPOTENCIÁL, AKCIÓS POTENCIÁL. Biofizika szeminárium

MEMBRÁNSZERKEZET, MEMBRÁNPOTENCIÁL, AKCIÓS POTENCIÁL. Biofizika szeminárium MEMBRÁNSZERKEZET, MEMBRÁNPOTENCIÁL, AKCIÓS POTENCIÁL Biofizika szeminárium 2012. 09. 24. MEMBRÁNSZERKEZET Biológiai membránok (citoplazma, sejten belüli membránféleségek) közös jellemzője: Nem kovalens

Részletesebben

Nyugalmi potenciál, akciós potenciál és elektromos ingerelhetőség. A membránpotenciál mérése. Panyi György

Nyugalmi potenciál, akciós potenciál és elektromos ingerelhetőség. A membránpotenciál mérése. Panyi György Nyugalmi potenciál, akciós potenciál és elektromos ingerelhetőség. A membránpotenciál mérése. Panyi György Nyugalmi membránpotenciál: TK. 284-285. Akciós potenciál: TK. 294-301. Elektromos ingerelhetőség:

Részletesebben

A somatomotoros rendszer

A somatomotoros rendszer A somatomotoros rendszer Motoneuron 1 Neuromuscularis junctio (NMJ) Vázizom A somatomotoros rendszer 1 Neurotranszmitter: Acetil-kolin Mire hat: Nikotinos kolinerg-receptor (nachr) Izom altípus A parasympathicus

Részletesebben

Biológiai membránok és membrántranszport

Biológiai membránok és membrántranszport Biológiai membránok és membrántranszport Biológiai membránok A citoplazma membrán funkciói: térrészek elválasztása (egész sejt, organellumok) transzport jelátvitel Milyen a membrán szerkezete? lipidek

Részletesebben

OZMÓZIS. BIOFIZIKA I Október 25. Bugyi Beáta PTE ÁOK Biofizikai Intézet

OZMÓZIS. BIOFIZIKA I Október 25. Bugyi Beáta PTE ÁOK Biofizikai Intézet BIOFIZIKA I 2011. Október 25. Bugyi Beáta PTE ÁOK Biofizikai Intézet Áttekintés 1. Diffúzió rövid ismétlés 2. Az ozmózis jelensége és leírása 4. A diffúzió és ozmózis orvos biológiai jelentősége Diffúzió

Részletesebben

Transzportfolyamatok a biológiai rendszerekben

Transzportfolyamatok a biológiai rendszerekben A nyugalmi potenciál jelentősége Transzportfolyamatok a biológiai rendszerekben Transzportfolyamatok a sejt nyugalmi állapotában a sejt homeosztázisának (sejttérfogat, ph) fenntartása ingerlékenység érzékelés

Részletesebben

16. A sejtek kommunikációja: jelátviteli folyamatok (szignál-transzdukció)

16. A sejtek kommunikációja: jelátviteli folyamatok (szignál-transzdukció) 16. A sejtek kommunikációja: jelátviteli folyamatok (szignál-transzdukció) 2016. február 25. Lippai Mónika lippai@elte.hu Minden sejt érzékel többféle, más sejtek által kibocsájtott jelmolekulát. - A jeleket

Részletesebben

JELÁTVITEL I A JELÁTVITELRŐL ÁLTALÁBAN, RECEPTOROK INTRACELLULÁRIS (NUKLEÁRIS) RECEPTOROK G FEHÉRJÉHEZ KÖTÖTT RECEPTOROK

JELÁTVITEL I A JELÁTVITELRŐL ÁLTALÁBAN, RECEPTOROK INTRACELLULÁRIS (NUKLEÁRIS) RECEPTOROK G FEHÉRJÉHEZ KÖTÖTT RECEPTOROK JELÁTVITEL I A JELÁTVITELRŐL ÁLTALÁBAN, RECEPTOROK INTRACELLULÁRIS (NUKLEÁRIS) RECEPTOROK G FEHÉRJÉHEZ KÖTÖTT RECEPTOROK A jelátvitel hírvivő molekula (messenger) elektromos formában kódolt információ

Részletesebben

Izomműködés. Az izommozgás. az állati élet legszembetűnőbb külső jele a mozgás amőboid, ostoros ill. csillós és izomösszehúzódással

Izomműködés. Az izommozgás. az állati élet legszembetűnőbb külső jele a mozgás amőboid, ostoros ill. csillós és izomösszehúzódással Izomműködés Az izommozgás az állati élet legszembetűnőbb külső jele a mozgás amőboid, ostoros ill. csillós és izomösszehúzódással történő mozgás van Galenus id. II.szd. - az idegekből animal spirit folyik

Részletesebben

A sejtmembrán szabályozó szerepe fiziológiás körülmények között és kóros állapotokban

A sejtmembrán szabályozó szerepe fiziológiás körülmények között és kóros állapotokban A sejtmembrán szabályozó szerepe fiziológiás körülmények között és kóros állapotokban 17. Központi idegrendszeri neuronok ingerületi folyamatai és szinaptikus összeköttetései 18. A kalciumháztartás zavaraira

Részletesebben

MEDICINÁLIS ALAPISMERETEK BIOKÉMIA A BIOLÓGIAI MEMBRÁNOK 1. kulcsszó cím: MEMBRÁNOK

MEDICINÁLIS ALAPISMERETEK BIOKÉMIA A BIOLÓGIAI MEMBRÁNOK 1. kulcsszó cím: MEMBRÁNOK Modul cím: MEDICINÁLIS ALAPISMERETEK BIOKÉMIA A BIOLÓGIAI MEMBRÁNOK 1. kulcsszó cím: MEMBRÁNOK A membránok minden sejtnek lényeges alkotórészei. Egyrészt magát a sejtet határolják - ez a sejtmembrán vagy

Részletesebben

Sejt - kölcsönhatások az idegrendszerben

Sejt - kölcsönhatások az idegrendszerben Sejt - kölcsönhatások az idegrendszerben dendrit Sejttest Axon sejtmag Axon domb Schwann sejt Ranvier mielinhüvely csomó (befűződés) terminális Sejt - kölcsönhatások az idegrendszerben Szinapszis típusok

Részletesebben

Az idegsejt elektrokémiai és

Az idegsejt elektrokémiai és Mottó: Mert az angyal a részletekben lakik. Petri György: Mosoly Az idegsejt elektrokémiai és fiziológiai működésének alapjai. ELTE, 2006. október 6. Tartalom Az idegsejt felépítése Az idegi elektromosság

Részletesebben

Jelátviteli útvonalak 1

Jelátviteli útvonalak 1 Jelátviteli útvonalak 1 Információ metabolizmus Szignál transzdukció 1 Jelátviteli séma Mi lehet a jel? Hormonok Növekedési faktorok Fejlődési szignálok Neurotranszmitterek Antigének Sejtfelszíni glikoproteinek

Részletesebben

1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói

1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói 1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói Plazmamembrán Membrán funkciói: sejt integritásának fenntartása állandó hő, energia, és információcsere biztosítása homeosztázis

Részletesebben

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Azonosító szám: TÁMOP-4.1.2-08/1/A-2009-0011 Az orvosi

Részletesebben

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Azonosító szám: TÁMOP-4.1.2-08/1/A-2009-0011 Az orvosi

Részletesebben

KÉSZÍTETTE: BALOGH VERONIKA ELTE IDEGTUDOMÁNY ÉS HUMÁNBIOLÓGIA SZAKIRÁNY MSC 2015/16 II. FÉLÉV

KÉSZÍTETTE: BALOGH VERONIKA ELTE IDEGTUDOMÁNY ÉS HUMÁNBIOLÓGIA SZAKIRÁNY MSC 2015/16 II. FÉLÉV KÉSZÍTETTE: BALOGH VERONIKA ELTE IDEGTUDOMÁNY ÉS HUMÁNBIOLÓGIA SZAKIRÁNY MSC 2015/16 II. FÉLÉV TÉNYEK, CÉLOK, KÉRDÉSEK Kísérlet központja Neuronok és réskapcsolatokkal összekötött asztrocita hálózatok

Részletesebben

Membránszerkezet. Membránszerkezet, Membránpotenciál, Akciós potenciál. Folyékony mozaik modell. Membrán-modellek. Biofizika szeminárium

Membránszerkezet. Membránszerkezet, Membránpotenciál, Akciós potenciál. Folyékony mozaik modell. Membrán-modellek. Biofizika szeminárium Membránszerkezet, Membránpotenciál, Akciós potenciál Membránszerkezet Biológiai membránok (citoplazma, sejten belüli membránféleségek) közös jellemzője: Nem kovalens kötésekkel összetartott lipidekből

Részletesebben

Kommunikáció. Sejtek közötti kommunikáció

Kommunikáció. Sejtek közötti kommunikáció Kommunikáció Sejtek közötti kommunikáció soksejtűekben elengedhetetlen összehangolni a sejtek működését direkt és indirekt kommunikáció direkt kommunikáció: rés-illeszkedés (gap junction) 6 connexin =

Részletesebben

A membránpotenciál. A membránpotenciál mérése

A membránpotenciál. A membránpotenciál mérése A membránpotenciál Elektromos potenciál különbség a membrán két oldala közt, E m Cink Galvani (1791) Réz ideg izom A membránpotenciál mérése Mérési elv: feszültségmérő áramkör Erősítő (feszültségmérő műszer)

Részletesebben

térrészek elválasztása transzport jelátvitel Milyen a membrán szerkezete? Milyen a membrán szerkezete? lipid kettısréteg, hidrofil/hidrofób részek

térrészek elválasztása transzport jelátvitel Milyen a membrán szerkezete? Milyen a membrán szerkezete? lipid kettısréteg, hidrofil/hidrofób részek Biológiai membránok A citoplazma membrán funkciói: Biológiai membránok és membrántranszport térrészek elválasztása (egész sejt, organellumok) transzport jelátvitel Milyen a membrán szerkezete? lipidek

Részletesebben

A glükóz reszintézise.

A glükóz reszintézise. A glükóz reszintézise. A glükóz reszintézise. A reszintézis nem egyszerű megfordítása a glikolízisnek. A glikolízis 3 irrevezibilis lépése más úton játszódik le. Ennek oka egyrészt energetikai, másrészt

Részletesebben

Bari Ferenc egyetemi tanár SZTE ÁOK-TTIK Orvosi Fizikai és Orvosi Informatikai Intézet

Bari Ferenc egyetemi tanár SZTE ÁOK-TTIK Orvosi Fizikai és Orvosi Informatikai Intézet A membránpotenciál eredete. A diffúziós potenciál, Donnan-potenciál, Goldmann-potenciál, a Nernst-Planckegyenlet. A nyugalmi és akciós potenciál (általános jellemzői, ionáramok). Bari Ferenc egyetemi tanár

Részletesebben

Intracelluláris és intercelluláris kommunikáció

Intracelluláris és intercelluláris kommunikáció Intracelluláris és intercelluláris kommunikáció Transzportfolyamatok a sejten belül Ciklózis: Az endoplazma sejten belüli (sejtmag körüli) áramlása A ciklózis teszi lehetővé, hogy a sejten belül az egyik

Részletesebben

Kevéssé fejlett, sejthártya betüremkedésekből. Citoplazmában, cirkuláris DNS, hisztonok nincsenek

Kevéssé fejlett, sejthártya betüremkedésekből. Citoplazmában, cirkuláris DNS, hisztonok nincsenek 1 A sejtek felépítése Szerkesztette: Vizkievicz András A sejt az élővilág legkisebb, önálló életre képes, minden életjelenséget mutató szerveződési egysége. Minden élőlény sejtes szerveződésű, amelyek

Részletesebben

Az elmúlt években végzett kísérleteink eredményei arra utaltak, hogy az extracelluláris ph megváltoztatása jelentősen befolyásolja az ATP és a cink

Az elmúlt években végzett kísérleteink eredményei arra utaltak, hogy az extracelluláris ph megváltoztatása jelentősen befolyásolja az ATP és a cink A cystás fibrosis (CF) a leggyakoribb autoszomális, recesszív öröklődés menetet mutató halálos kimenetelű megbetegedés a fehérbőrű populációban. Hazánkban átlagosan 2500-3000 élveszületésre jut egy CF

Részletesebben

Orvosi élettan. Bevezetés és szabályozáselmélet Tanulási támpontok: 1.

Orvosi élettan. Bevezetés és szabályozáselmélet Tanulási támpontok: 1. Orvosi élettan Bevezetés és szabályozáselmélet Tanulási támpontok: 1. Prof. Sáry Gyula 1 anyagcsere hőcsere Az élőlény és környezete nyitott rendszer inger hő kémiai mechanikai válasz mozgás alakváltoztatás

Részletesebben

A plazmamembrán felépítése

A plazmamembrán felépítése A plazmamembrán felépítése Folyékony mozaik membrán Singer-Nicholson (1972) Lipid kettősréteg Elektronmikroszkópia Membrán kettősréteg Intracelluláris Extracelluláris 1 Lipid kettősréteg foszfolipidek

Részletesebben

JELUTAK 2. A Jelutak Komponensei

JELUTAK 2. A Jelutak Komponensei JELUTAK 2. A Jelutak Komponensei TARTALOM - 1. Előadás: A jelutak komponensei 1. Egy egyszerű jelösvény 2. Jelmolekulák 3. Receptorok 4. Intracelluláris jelmolekulák 1 1.1. Egy tipikus jelösvény sémája

Részletesebben

RECEPTOROK JELÁTVITEL Sperlágh Beáta

RECEPTOROK JELÁTVITEL Sperlágh Beáta RECEPTOROK JELÁTVITEL perlágh Beáta Összefoglalás A receptorok az élővilág jelfelismerésre specializálódott makromolekulái, központi szerepet játszanak a sejtek közötti információátvitelben. Az ezernél

Részletesebben

-Két fő korlát: - asztrogliák rendkívüli morfológiája -Ca szignálok értelmezési nehézségei

-Két fő korlát: - asztrogliák rendkívüli morfológiája -Ca szignálok értelmezési nehézségei Nature reviewes 2015 - ellentmondás: az asztrociták relatív lassú és térben elkent Ca 2+ hullámokkal kommunikálnak a gyors és pontos neuronális körökkel - minőségi ugrás kell a kísérleti és analitikai

Részletesebben

Kálium ioncsatornák eltérő funkciói

Kálium ioncsatornák eltérő funkciói Kálium ioncsatornák eltérő funkciói Elektrofiziológia kurzus 2016/17 őszi szemeszter 2016. 10. 12 Prorok János, PhD Farmakológiai és Farmakoterápiai Intézet Tartalmi áttekintés A K+ csatornákat érintő

Részletesebben

Natív antigének felismerése. B sejt receptorok, immunglobulinok

Natív antigének felismerése. B sejt receptorok, immunglobulinok Natív antigének felismerése B sejt receptorok, immunglobulinok B és T sejt receptorok A B és T sejt receptorok is az immunglobulin fehérje család tagjai A TCR nem ismeri fel az antigéneket, kizárólag az

Részletesebben

CzB 2010. Élettan: a sejt

CzB 2010. Élettan: a sejt CzB 2010. Élettan: a sejt Sejt - az élet alapvető egysége Prokaryota -egysejtű -nincs sejtmag -nincsenek sejtszervecskék -DNS = egy gyűrű - pl., bactériumok Eukaryota -egy-/többsejtű -sejmag membránnal

Részletesebben

Integráció. Csala Miklós. Semmelweis Egyetem Orvosi Vegytani, Molekuláris Biológiai és Patobiokémiai Intézet

Integráció. Csala Miklós. Semmelweis Egyetem Orvosi Vegytani, Molekuláris Biológiai és Patobiokémiai Intézet Integráció Csala Miklós Semmelweis Egyetem Orvosi Vegytani, Molekuláris Biológiai és Patobiokémiai Intézet Anyagcsere jóllakott állapotban Táplálékkal felvett anyagok sorsa szénhidrátok fehérjék lipidek

Részletesebben

7. előadás: A plazma mebrán szerkezete és funkciója. Anyagtranszport a plazma membránon keresztül.

7. előadás: A plazma mebrán szerkezete és funkciója. Anyagtranszport a plazma membránon keresztül. 7. előadás: A plazma mebrán szerkezete és funkciója. Anyagtranszport a plazma membránon keresztül. A plazma membrán határolja el az élő sejteket a környezetüktől Szelektív permeabilitást mutat, így lehetővé

Részletesebben

TRANSZPORTFOLYAMATOK A SEJTEKBEN

TRANSZPORTFOLYAMATOK A SEJTEKBEN 16 A sejtek felépítése és mûködése TRANSZPORTFOLYAMATOK A SEJTEKBEN 1. Sejtmembrán elektronmikroszkópos felvétele mitokondrium (energiatermelõ és lebontó folyamatok) citoplazma (fehérjeszintézis, anyag

Részletesebben

Elektrosztatikus számítások. Elektrosztatikus számítások. Elektrosztatikus számítások. Elektrosztatikus számítások Definíciók

Elektrosztatikus számítások. Elektrosztatikus számítások. Elektrosztatikus számítások. Elektrosztatikus számítások Definíciók Jelentősége szubsztrát kötődés szolvatáció ionizációs állapotok (pka) mechanizmus katalízis ioncsatornák szimulációk (szerkezet) all-atom dipolar fluid dipolar lattice continuum Definíciók töltéseloszlás

Részletesebben

Interneurális kommunikáció

Interneurális kommunikáció Interneurális kommunikáció 2010/2011 Sejtélettan II. Szinapszisok osztályozása Na channel Transmitter vesicle Local circuit current Na 2+ Ca channel PRE- SYNAPTIC Ca++ PRE- SYNAPTIC Ca-induced exocytosis

Részletesebben

2006 1. Nemszinaptikus receptorok és szubmikronos Ca2+ válaszok: A két-foton lézermikroszkópia felhasználása a farmakológiai vizsgálatokra.

2006 1. Nemszinaptikus receptorok és szubmikronos Ca2+ válaszok: A két-foton lézermikroszkópia felhasználása a farmakológiai vizsgálatokra. 2006 1. Nemszinaptikus receptorok és szubmikronos Ca 2+ válaszok: A két-foton lézermikroszkópia felhasználása a farmakológiai vizsgálatokra. A kutatócsoportunkban Közép Európában elsőként bevezetett két-foton

Részletesebben

OZMÓZIS, MEMBRÁNTRANSZPORT

OZMÓZIS, MEMBRÁNTRANSZPORT OZMÓZIS, MEMBRÁNTRANSZPORT Vig Andrea PTE ÁOK Biofizikai Intézet 2014.10.28. ÁTTEKINTÉS DIFFÚZIÓ BROWN-MOZGÁS a részecskék rendezetlen hőmozgása DIFFÚZIÓ a részecskék egyenletlen (inhomogén) eloszlásának

Részletesebben

Szerkezet és funkció kapcsolata a membránműködésben. Folyadékkristályok típusai (1) Dr. Voszka István

Szerkezet és funkció kapcsolata a membránműködésben. Folyadékkristályok típusai (1) Dr. Voszka István MODELLMEMBRÁNOK (LIPOSZÓMÁK) ORVOSI, GYÓGYSZERÉSZI ALKALMAZÁSA 2015/2016 II. félév Időpont: szerda 17 30-19 00 Helyszín Elméleti Orvostudományi Központ Szent-Györgyi Albert előadóterme II. 3. Szerkezet

Részletesebben

LIPID ANYAGCSERE (2011)

LIPID ANYAGCSERE (2011) LIPID ANYAGCSERE LIPID ANYAGCSERE (2011) 5 ELİADÁS: 1, ZSÍRK EMÉSZTÉSE, FELSZÍVÓDÁSA + LIPPRTEINEK 2, ZSÍRSAVAK XIDÁCIÓJA 3, ZSÍRSAVAK SZINTÉZISE 4, KETNTESTEK BIKÉMIÁJA, KLESZTERIN ANYAGCSERE 5, MEMBRÁN

Részletesebben

MITOCHONDRIUM. Molekuláris sejtbiológia: Dr. habil. Kőhidai László egytemi docens Semmelweis Egyetem, Genetikai, Sejt- és Immunbiológiai Intézet

MITOCHONDRIUM. Molekuláris sejtbiológia: Dr. habil. Kőhidai László egytemi docens Semmelweis Egyetem, Genetikai, Sejt- és Immunbiológiai Intézet Molekuláris sejtbiológia: MITOCHONDRIUM külső membrán belső membrán lemezek / crista matrix Dr. habil. Kőhidai László egytemi docens Semmelweis Egyetem, Genetikai, Sejt- és Immunbiológiai Intézet Tudomány-történet

Részletesebben

glutamát felszabadulás gluthation mennyisége

glutamát felszabadulás gluthation mennyisége A kutatómunka lényegében a szerződésben vállaltaknak megfelelő ütemben és eredményességgel folyt, annak ellenére, hogy a résztvevők személye az évek során változott. Kollár Anna a Ph.D tanulmányait feladva

Részletesebben

Novák Béla: Sejtbiológia Membrántranszport

Novák Béla: Sejtbiológia Membrántranszport Membrántranszport folyamatok A lipid kettos réteg gátat jelent a poláros molekulák számára. Ez a gát alapveto fontosságú a citoszól és az extracelluláris "milieu" közti koncentráció különbségek biztosításában.

Részletesebben

1. SEJT-, ÉS SZÖVETTAN. I. A sejt

1. SEJT-, ÉS SZÖVETTAN. I. A sejt 1. SEJT-, ÉS SZÖVETTAN SZAKMAI INFORMÁCIÓTARTALOM I. A sejt A sejt cellula az élő szervezet alapvető szerkezeti és működési egysége, amely képes az önálló anyag cserefolyamatokra és a szaporodásra. Alapvetően

Részletesebben

MEDICINÁLIS ALAPISMERETEK BIOKÉMIA AZ IZOMMŰKÖDÉS 1. kulcsszó cím: A SZERVEZETBEN ELŐFORDULÓ IZOM- SZÖVETEK TÍPUSAI 1. képernyő cím: Sima izomszövet

MEDICINÁLIS ALAPISMERETEK BIOKÉMIA AZ IZOMMŰKÖDÉS 1. kulcsszó cím: A SZERVEZETBEN ELŐFORDULÓ IZOM- SZÖVETEK TÍPUSAI 1. képernyő cím: Sima izomszövet Modul cím: MEDICINÁLIS ALAPISMERETEK BIOKÉMIA AZ IZOMMŰKÖDÉS 1. kulcsszó cím: A SZERVEZETBEN ELŐFORDULÓ IZOM- SZÖVETEK TÍPUSAI 1. képernyő cím: Sima izomszövet G001 akaratunktól függetlenül működik; lassú,

Részletesebben

A Sejtmembrán Szerkezete Nyugalmi Membránpotenciál

A Sejtmembrán Szerkezete Nyugalmi Membránpotenciál A Sejtmembrán Szerkezete Nyugalmi Membránpotenciál 2012.09.25. A biológiai membránok fő komponense. Foszfolipidek foszfolipid = diglicerid + foszfát csoport + szerves molekula (pl. kolin). Poláros fej

Részletesebben

HUMÁN ÉLETTAN I. ELİADÁSOK TEMATIKÁJA GYÓGYSZERÉSZ HALLGATÓKNAK

HUMÁN ÉLETTAN I. ELİADÁSOK TEMATIKÁJA GYÓGYSZERÉSZ HALLGATÓKNAK HUMÁN ÉLETTAN I. ELİADÁSOK TEMATIKÁJA GYÓGYSZERÉSZ HALLGATÓKNAK 2006/2007 A tananyag elsajátításához Fonyó: Élettan gyógyszerész hallgatók részére (Medicina, Budapest, 1998) címő könyvet ajánljuk. Az Élettani

Részletesebben

Szerkezet és funkció kapcsolata a membránműködésben. Folyadékkristályok típusai (1) Dr. Voszka István

Szerkezet és funkció kapcsolata a membránműködésben. Folyadékkristályok típusai (1) Dr. Voszka István MODELLMEMBRÁNOK (LIPOSZÓMÁK) ORVOSI, GYÓGYSZERÉSZI ALKALMAZÁSA 2012/2013 II. félév II. 7. Szerkezet és funkció kapcsolata a membránműködésben Dr. Voszka István II. 21. Liposzómák előállítási módjai Dr.

Részletesebben

Sejt - kölcsönhatások. az idegrendszerben és az immunrendszerben

Sejt - kölcsönhatások. az idegrendszerben és az immunrendszerben Sejt - kölcsönhatások az idegrendszerben és az immunrendszerben A sejttől a szervezetig A sejtek között, ill. a sejtek és környezetük közötti jelátviteli folyamatok összessége az a struktúrált kölcsönhatásrendszer,

Részletesebben

Biológiai membránok és membrántranszport

Biológiai membránok és membrántranszport Biológiai membránok és membrántranszport Szántó G. Tibor 2015.XI.2. TK. 88. 94. oldal TK. 276. 284. oldal A citoplazma membrán fő funkciói IC és EC térrész elválasztása elektromos szigetelés (ellenállás

Részletesebben

Biofizika I 2013-2014 2014.12.02.

Biofizika I 2013-2014 2014.12.02. ÁTTEKINTÉS AZ IZOM TÍPUSAI: SZERKEZET és FUNKCIÓ A HARÁNTCSÍKOLT IZOM SZERKEZETE MŰKÖDÉSÉNEK MOLEKULÁRIS MECHANIZMUSA IZOM MECHANIKA Biofizika I. -2014. 12. 02. 03. Dr. Bugyi Beáta PTE ÁOK Biofizikai Intézet

Részletesebben

TDK lehetőségek az MTA TTK Enzimológiai Intézetben

TDK lehetőségek az MTA TTK Enzimológiai Intézetben TDK lehetőségek az MTA TTK Enzimológiai Intézetben Vértessy G. Beáta egyetemi tanár TDK mind 1-3 helyezettek OTDK Pro Scientia különdíj 1 második díj Diákjaink Eredményei Zsűri különdíj 2 első díj OTDK

Részletesebben

Helyi érzéstelenítőszerek szívelektrofiziológiai hatásai

Helyi érzéstelenítőszerek szívelektrofiziológiai hatásai EGYETEMI DOKTORI (Ph.D.) ÉRTEKEZÉS Helyi érzéstelenítőszerek szívelektrofiziológiai hatásai Dr. Szabó Adrienne Témavezetők: Dr. Nánási Péter és Dr. Márton Ildikó DEBRECENI EGYETEM KLINIKAI ORVOSTUDOMÁNYOK

Részletesebben

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin.

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin. Myoglobin Fehérje-szerkezetek! MGLSDGEWQLVLNVWGKVEADIPGGQEVLIRLFK GPETLEKFDKFKLKSEDEMKASE DLKKGATVLTALGGILKKKGEAEIKPLAQSA TKKIPVKYLEFISECIIQVLQSK PGDFGADAQGAMNKALELFRKDMASNYKELGFQG Fuxreiter Mónika! Debreceni

Részletesebben

Energiatermelés a sejtekben, katabolizmus. Az energiaközvetítő molekula: ATP

Energiatermelés a sejtekben, katabolizmus. Az energiaközvetítő molekula: ATP Energiatermelés a sejtekben, katabolizmus Az energiaközvetítő molekula: ATP Elektrontranszfer, a fontosabb elektronszállító molekulák NAD: nikotinamid adenin-dinukleotid FAD: flavin adenin-dinukleotid

Részletesebben

Sántha Péter Sejtek: a szervezet morfológiai és funkcionális alapegységei

Sántha Péter Sejtek: a szervezet morfológiai és funkcionális alapegységei Sejtélettan - membránfiziológia A sejtmembrán felépítése és funkciói. Transzportfolyamatok. Sántha Péter 2016.09.09. Sejtek: a szervezet morfológiai és funkcionális alapegységei Plazmamembrán (sejtmembrán):

Részletesebben

6.1. Ca 2+ forgalom - - H-6. Kalcium háztartás. 4 g H + Albumin - Fehérjéhez kötött Összes plazma Ca. Ca 2+ Belsô Ca 2+ forgalom

6.1. Ca 2+ forgalom - - H-6. Kalcium háztartás. 4 g H + Albumin - Fehérjéhez kötött Összes plazma Ca. Ca 2+ Belsô Ca 2+ forgalom Ionizált Ca Ca komplex Fehérjéhez kötött Összes plazma Ca H6. Kalcium háztartás 6.1. Ca 2 forgalom 1.2 mm 0.15 mm 1.15 mm 2.5 mm Albumin H Ca 2 Külsô Ca 2 forgalom Belsô Ca 2 forgalom 0.8 g Colon Jejunum

Részletesebben

klorid ioncsatorna az ABC (ATP Binding Casette) fehérjecsaládba tartozik, amelyek általánosságban részt vesznek a gyógyszerek olyan alapvetı

klorid ioncsatorna az ABC (ATP Binding Casette) fehérjecsaládba tartozik, amelyek általánosságban részt vesznek a gyógyszerek olyan alapvetı Szegedi Tudományegyetem Farmakológiai és Farmakoterápiai Intézet Igazgató: Prof. Dr. Varró András 6720 Szeged, Dóm tér 12., Tel.: (62) 545-682 Fax: (62) 545-680 e-mail: varro.andras@med.u-szeged.hu Opponensi

Részletesebben

Membránok, nanopórusok, ioncsatornák és elektrokémiai kettősrétegek tulajdonságainak vizsgálata számítógépes szimulációkkal

Membránok, nanopórusok, ioncsatornák és elektrokémiai kettősrétegek tulajdonságainak vizsgálata számítógépes szimulációkkal Membránok, nanopórusok, ioncsatornák és elektrokémiai kettősrétegek tulajdonságainak vizsgálata számítógépes szimulációkkal Cél: A címben felsorolt inhomogén elektrolitikus rendszerek tulajdonságainak

Részletesebben

A kémiai energia átalakítása a sejtekben

A kémiai energia átalakítása a sejtekben A kémiai energia átalakítása a sejtekben A sejtek olyan mikroszkópikus képződmények amelyek működése egy vegyi gyárhoz hasonlítható. Tehát a sejtek mikroszkópikus vegyi gyárak. Mi mindenben hasonlítanak

Részletesebben

A veseműködés élettana, a kiválasztás funkciója, az emberi test víztereinek élettana (5)

A veseműködés élettana, a kiválasztás funkciója, az emberi test víztereinek élettana (5) A veseműködés élettana, a kiválasztás funkciója, az emberi test víztereinek élettana (5) Dr. Attila Nagy 2016 Kalcium és foszfátháztartás (Tanulási támpont: 63) A szabályozásban a pajzsmirigy, mellékpajzsmirigy

Részletesebben

A szívizomsejtek ionáramai

A szívizomsejtek ionáramai A szívizomsejtek ionáramai Dr. Szentesi Péter DE OEC Élettani Intézet 2009 A szivet alkotó szívizomsejtek A sejtmembrán szerkezete Csatornák Pórus Szőrı Kapu A Patch Clamp módszer Egyedi csatorna izolálása

Részletesebben

A légzési lánc és az oxidatív foszforiláció

A légzési lánc és az oxidatív foszforiláció A légzési lánc és az oxidatív foszforiláció Csala Miklós Semmelweis Egyetem Orvosi Vegytani, Molekuláris Biológiai és Patobiokémiai Intézet intermembrán tér Fe-S FMN NADH mátrix I. komplex: NADH-KoQ reduktáz

Részletesebben

A BAKTERIORODOPSZIN. Péter Imre AINLHQ

A BAKTERIORODOPSZIN. Péter Imre AINLHQ A BAKTERIORODOPSZIN Péter Imre AINLHQ BEVEZETÉS A napfény energiáját az élőlények (növények, algák) egy bonyolult folyamat, a fotoszintézis során alakítják át és tárolják. Létezik egy baktérium, a Halobacterium

Részletesebben

CELLULÁRIS SZÍV- ELEKTROFIZIOLÓGIAI MÉRÉSI TECHNIKÁK. Dr. Virág László

CELLULÁRIS SZÍV- ELEKTROFIZIOLÓGIAI MÉRÉSI TECHNIKÁK. Dr. Virág László CELLULÁRIS SZÍV- ELEKTROFIZIOLÓGIAI MÉRÉSI TECHNIKÁK Dr. Virág László Intracelluláris mikroelektród technika Voltage clamp technika Patch clamp technika Membrane potentials and excitation of impaled single

Részletesebben

Látás. Látás. A környezet érzékelése a látható fény segítségével. A szem a fényérzékelés speciális, páros szerve (érzékszerv).

Látás. Látás. A környezet érzékelése a látható fény segítségével. A szem a fényérzékelés speciális, páros szerve (érzékszerv). Látás A szem felépítése és működése. Optikai leképezés a szemben, akkomodáció. Képalkotási hibák. A fotoreceptorok tulajdonságai és működése. A szem felbontóképessége. A színlátás folyamata. 2014/11/18

Részletesebben

Orvosi élettan. Bevezetés és szabályozáselmélet Tanulási támpontok: 1.

Orvosi élettan. Bevezetés és szabályozáselmélet Tanulási támpontok: 1. Orvosi élettan Bevezetés és szabályozáselmélet Tanulási támpontok: 1. Prof. Sáry Gyula 1 1. Szabályozáselmélet Definiálja a belső környezet fogalmát és magyarázza el, miért van szükség annak szabályozására.

Részletesebben

Élettan szemináriumok 1. félév Bevezetés. Dr. Domoki Ferenc Szeptember 6

Élettan szemináriumok 1. félév Bevezetés. Dr. Domoki Ferenc Szeptember 6 Élettan szemináriumok 1. félév Bevezetés Dr. Domoki Ferenc 2016. Szeptember 6 Témák A kurzus célkitűzései A szemináriumok programja Évközi feleletválogatásos tesztek A tesztek kitöltésének módszertana

Részletesebben

A BIOLÓGIAI JELENSÉGEK FIZIKAI HÁTTERE Zimányi László

A BIOLÓGIAI JELENSÉGEK FIZIKAI HÁTTERE Zimányi László A BIOLÓGIAI JELENSÉGEK FIZIKAI HÁTTERE Zimányi László Összefoglalás A négy alapvető fizikai kölcsönhatás közül az elektromágneses kölcsönhatásnak van fontos szerepe a biológiában. Atomi és molekuláris

Részletesebben

Nyugalmi és akciós potenciál

Nyugalmi és akciós potenciál Nyugalmi és akciós potenciál A sejtmembrán ingerlékenysége 2/14 az állati sejtek belseje negatívabb, mint a környezet - nyugalmi potenciál az ideg-, izom-, és egyes érzéksejtekben ez a feszültség átmenetileg

Részletesebben