A 100 éves röntgendiffrakció a gyógyszerkutatásban

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "A 100 éves röntgendiffrakció a gyógyszerkutatásban"


1 10 Magyar Kémiai Folyóirat - Előadások A 100 éves röntgendiffrakció a gyógyszerkutatásban BOMBICZ Petra * és KÁLMÁN Alajos MTA Természettudományi Kutatóközpont, Szerves Kémiai Intézet: Pusztaszeri út , 1025 Budapest, Magyarország 1. Bevezetés A klasszikus kristálytan után a modern krisztallográfia születését az 1912-ben Laue, Friedrich és Knipping által elvégzett els röntgendiffrakciós kísérlethez kötik. Az anyag szerkezetének atomi felbontású megismerése a tudománytörténet egyik legfontosabb felfedezése, mely forradalmasította a természettudományok minden ágát: fizikát, kémiát, biológiát, föld- és anyagtudományokat 1. Az anyag fizikai-kémiai, makroszkópikus tulajdonságának megértéséhez ismernünk kell a szerkezeti felépítését. 100 év elteltével a krisztallográfia még mindig a tudomány élvonalában van 2. Az ENSZ döntése értelmében 2014 a krisztallográfia éve lesz. A cikkben a centenáriumi megemlékezés után példákat láthatunk a röntgendiffrakció gyógyszerkutatásban való alkalmazására els sorban a kiralitás szerepér l és a polimorfia jelenségér l. Ez magában foglalja a szerkezet és tulajdonság összefüggéseit, a teljes és parciális izostrukturalitás témakörét, a másodlagos kölcsönhatások szerepét, kokristályok vizsgálatát és a kristályhabitus befolyásolását a szerkezet ismeretében. 2. A röntgendiffrakció száz éve 100 éve, március végén hajtotta végre Max von Laue, Walter Friedrich és Paul Knipping az els röntgendiffrakciós kisérletet. Az, hogy atomi szinten láthatóvá vált az anyagok szerkezete, forradalmi változást hozott a természettudományban, valamint új tudományágak születtek. A röntgendiffrakció módszerével vizsgálhatunk ásványokat, ionos szerkezeteket, szervetlen és szerves vegyületeket, fehérjéket és vírusokat. Miért éppen a röntgensugárzás tette ezt lehet vé? A röntgensugárzás egy viszonylag könnyen el állítható rövid hullámhosszú elektromágneses sugárzás, melynek hullámhossza összemérhet az atomi távolságokkal. Laboratóriumi méretekben hagyományos röntgencsövet, forgóanódos röntgencsövet, vagy az elmúlt években kifejlesztett mikroforrásokat használhatunk. Ezek alkalmazásával mára a röntgendiffrakció egyre inkább rutin módszerré válik. Nagyobb intenzitású és hullámhosszban hangolható röntgensugárzást kapunk szinkrotron forrásnál, melyben a relativisztikus sebességre gyorított töltött részecskék által kibocsátott röntgensugárzást alkalmazzuk. A diffrakciós módszerek között kell megemlítenünk a neutrondiffrakció módszerét is. Míg a röntgensugarak az elektronfelh n, addig a neutronok az atommagokon szóródnak, így pontos atomi hely meghatározást tesznek lehet vé még a hidrogén atom esetében is. Hátrány, hogy a kisebb intenzitású sugárzás miatt nagyobb kristályra van szükség, és a mérési id is hosszabb, heteket vesz igénybe az atomreaktornál. A nagym szer igény miatt a két utóbbi módszer még nem tekinthet rutin eljárásnak. * Tel.: / 201; Röntgendiffrakcióval vizsgálhatunk porokat és egykristályokat. Pordiffrakció esetén elveszik az az információ, hogy a kristály melyik síkjáról származik az adott reflexió. Ezért szerkezetmeghatározás céljára az egykristálydiffrakció terjedt el. Azonban az egykristály röntgendiffrakciós szerkezetmeghatározás sz k keresztmetszete éppen az egykristály el állítása. Ha ez nem sikerül, a pordiffrakció módszeréhez fordulunk. A pordiffrakciót elterjedten alkalmazzák analitikai célokra, fázis és cella meghatározásra. Azonban kisebb vegyületek vagy nagyobb szimmetriával bíró molekulák szerkezete nagyfelbontású mérésb l már meghatározható. A röntgendiffrakciós módszer el nye a kis anyagigény, 1-2 mg anyagból 1-2 ml oldószerrel már lehet kristályt növeszteni. Az egykristály röntgendiffrakció alkalmas a molekula- és kristályszerkezet megismerésére. Megtudjuk, milyen a molekula kompozíciója, konstitúciója, konformációja és konfigurációja. A kristályszerkezetb l megismerjük, hogyan épül fel a kristály molekulákból vagy ionokból, hogyan illeszkednek a szimmetriák által egymáshoz rendelt egységek és milyen intermolekuláris kölcsönhatások vannak a molekulák között. Mindezek célja, hogy kapcsolatot találjunk a szerkezet és a kristály fizikai és kémiai tulajdonságai között. Ennek megismerésével lehet vé válik megkívánt fizikai-kémiai tulajdonságú anyagok el állítása. A krisztallográfia jelent ségét mutatja a krisztallográfiai munkákért odaítélt Nobel-díjak (1. táblázat). Néhányat kiemelve: Az els Nobel-díjat Wilhelm Conrad Röntgen kapta ben a róla elnevezett sugárzás felfedezéséért ben kapta Max von Laue a kitüntetést az els diffrakciós kisérlet elvégzéséért. Rá egy évre, 1915-ben William Henry és William Lawrence Bragg, apa és fia, kapta a Nobel-díjat az els szerkezetek megoldásáért ben Max F. Perutz és John C. Kendrew munkáját a globuláris fehérjék kutatásáért kémiai Nobel-díjjal jutalmazták, míg Francis C. Crick, James D. Watson és Maurice Wilkins fiziológiai Nobel-díjat kapott a DNS helikális szerkezetének felismeréséért ben Dorothy C. Hodgkint biológiailag fontos molekulák szerkezetmeghatázozásáért jutalmazták, mint pl. a B 12 vitamin és a penicillinek ben Herbert Hauptman és Jerome Karle kapta a krisztallográfiai fázisprobléma un. direkt módszerrel történ megoldásáért a kitüntetést. Itt kell megemlítenünk, hogy Oszlányi Gábor és Süt András charge flipping módszere, melyet 2005-ben publikáltak, egyre szélesebb körben kerül felhasználásra, nem utolsó sorban problémás szerkezetek meghatározására ben Venkatraman Ramakrishnan, Thomas A. Steitz és Ada E. Yonath riboszóma kutatásait jutalmazták. A tavalyi kémiai Nobel-díjat Daniel Shechtman kapta a kvázikristályok felfedezéséért.

2 Magyar Kémiai Folyóirat - Előadások Táblázat. A kriszallográfiához köt d Nobel-díjak Kémiai R. J. Lefkowitz és B. K. Kobilka G-protein-kapcsolt receptorok felfedezéséért és m ködésük leírásáért 2011 Kémiai D. Shechtman Kvázikristályok felfedezéséért 2010 Fizikai A. Geim és K. Novoselov A grafént felfedez kísérletekért 2009 Kémiai V. Ramakrishnan, T. A. Steitz és A. E. Yonath Riboszómák szerkezetének és szerepének tanulmányozásáért 2006 Kémiai R. D. Kornberg Az eukarióta sejtekben zajló DNS-transzkripció molekuláris alapjainak kutatásáért 2003 Kémiai R. MacKinnon Kálium csatornák felépítésének és m ködésének tanulmányozásáért 1997 Kémiai P. D. Boyer, J. E. Walker és J. C. Skou Az ATP-szintetáz enzimmel katalizált ATP-szintézis vizsgálatáért 1996 Kémiai R.Curl, H. Kroto és R. Smalley Fullerének felfedezéséért 1994 Fizikai C. Shull és N. Brockhouse A neutron diffrakció felfedezéséért 1992 Fizikai G. Charpak A sokszálas proporcionális kamra kifejlesztéséért 1991 Fizikai P.-G. de Gennes A rendezettségi jelenségek tanulmányozásáért, melyet általánosítva folyadékkristályok és polimerek tanulmányozására is használni lehet 1988 Kémiai J. Deisenhofer, R. Huber és H. Michel A fotoszintetikus reakció központ 3 dimenziós felépítésének meghatározásáért 1985 Kémiai H. Hauptman és J. Karle A kristályszerkezet meghatározáshoz használt direkt módszerek kifejlesztéséért 1982 Kémiai A. Klug A krisztallográfiai elektronmikroszkópia kifejlesztéséért és a biológiailag fontos nukleinsavfehérje-komplexek szerkezetének kutatásáért 1976 Kémiai W. N. Lipscomb A boránok szerkezetének kutatásáért 1972 Kémiai C. B. Anfinsen A ribonukleázok terén végzett kutatásaiért 1964 Kémiai D. Hodgkin Biokémiai anyagok szerkezetének krisztallográfiával történı vizsgálatáért, pl. B 12 vitamin 1962 Orvosi F. Crick, J. Watson és M. Wilkins DNS helikális szerkezetének felismeréséért 1962 Kémiai J. C. Kendrew és M. Perutz Globuláris fehérjék kutatásában elért eredményeikért 1954 Kémiai L. C. Pauling A kémiai kötés természetének kutatásáért, és a komplex vegyületek szerkezetmeghatározásban történ felhasználásáért 1946 Kémiai J. B. Sumner A felfedezésért, hogy az enzimek kristályosíthatók 1937 Fizikai C. J. Davisson és G. Thompson Az elektronok kristályokon történ diffrakciójának felfedezéséért 1936 Kémiai P. J. W. Debye A molekulaszerkezet vizsgálatáért a dipólusmomentum és gázokban lejátszódó röntgendiffrakció és elektrondiffrakció segítségével 1929 Fizikai L.-V. de Broglie Az elektron hullámtermészetének felfedezéséért 1917 Fizikai C. G. Barkla Az elemek karakterisztikus röntgensugárzásának felfedezéséért 1915 Fizikai W. H. Bragg és W. L. Bragg A kristályszerkezet röntgensugárzással történ vizsgálatával kapcsolatos szolgálataiért 1914 Fizikai M. Von Laue A röntgensugárzás kristályokon történ diffrakciójának felfedezéséért 1901 Fizikai W. C. Röntgen A röntgensugárzás felfedezéséért A krisztallográfia azonban sokkal távolabbi múltra tekint vissza ben ismerte fel Steno a lapszögek állandóságának törvényét, mely szerint a kristálylapok ill. a síknormálisok által bezárt szögek a kristály habitusától függetlenül azonos h fokon és nyomáson állandók ben publikálta Haüy abbé morfológiai vizsgálatait, a kristályok mechanikai, h tani, optikai, elektromos tulajdonságairól. Felismerte, hogy a kristályok anizotróp hasadása során keletkez parallelepipedonok meg rzik a kiindulási kristály tulajdonságait ben fedezte fel Röntgen az X-sugárzást. A röntgensugár abszopción alapuló orvosi felhasználása gyorsan, széles körben elterjedt. Az els diffrakciós kísérlet 1912-ben egyidej leg igazolta a sugárzás elektromágneses hullámtermészetét, és az anyag atomi rácsszerkezetét (1. ábra). Egy évre rá 1913-ban oldották meg Braggék az els egyszer bb kristályszerkezeteket. k dolgozták ki az un. Bragg egyenletet (n = 2dsin ), mely a diffrakció jelenségének zseniális, de bizonyos szempontból túlegyszer sített leírása. A második világháború után robbanásszer fejl dés következett be az egykristálydiffrakció területén az egyre gyorsabb számítógépek és az automatizált diffraktométereknek köszönhet en. A szerves kémiai krisztallográfia születését 1961-re, Kitajgorodszkij a témából kiadott könyvének 3 megjelenésére datálják. Az 1970-es években a szerkezetek meghatározása - mérés és számítások - még hónapokat, éveket vett igénybe. Az 1980-as és az 1990-es években még hetekig tartott a szerkezetmeghatározás. Az es évek végén a térdetektorok megjelenésével és a gyors számítógépek alkalmazásával nehány órára, egy napra csökkent ez az id.

3 12 Magyar Kémiai Folyóirat - Előadások (S,R) konfiguráció esetén az N-formilfenilalanin eltér térbeli elrendez dése miatt a kett skötés oxigén nem fordul kifelé az oszlop irányából, másodlagos kölcsönhatás kialakulásának nincs meg a feltétele, a hidrofób oszlopok elrendez dése nehézkes, a kristálynövekedés radiális irányban gátolt. 1. Ábra. Laue, Friedrich és Knipping által készített els diffrakciós felvétel rézgálic kristályról. A készülék fényképe. 3. Röntgendiffrakciós szerkezet meghatározás és kiralitás A nagy érzékenység - szcintillációs, ccd és image plate - detektorok megjelenésével bebizonyosodott, hogy a Friedel törvény nem érvényes és lehet vé vált az oxigén vagy annál nagyobb rendszámú elemek anomális diszperziójának mérése, és ezáltal az abszolút konfiguráció meghatározása. Enantiomerek elválasztásának egyik módszere a diasztereomer sóképzéssel végzett reszolválás, melyben a racém vegyülettel rokon szerkezet reszolválószert alkalmaznak. Az N-formilfenilalanin (S)-1-feniletilaminnal történ reszolválása során 4 a királis megkülönböztetés a diasztereomer asszociátumok közötti stabilitás különbségen alapul (2. ábra). Ez a másodlagos kölcsönhatások eltér térbeli elrendez désére vezethet vissza. Az ibuprofén (2-(4-izobutilfenil)-propionsav) egy nemszteroid gyulladáscsökkent, fájdalom- és lázcsillapító hatású szer. Királis és akirális additívok hatását vizsgálták 5 racém ibuprofén szétválasztására szuperkritikus extrakcióval. A (+)-(R)-feniletilaminnal történ reszolválás során mind a (+)-(R)-feniletilamin-(-)-(R)-(2-(4-izobutilfenil)-propionát és a (+)-(R)-feniletilamin-(+)-(S)-(2-(4-izobutilfenil)- propionát hasonló felépítés kristályt ad (P ). A kation és az anion aránya 1:1, a kétfogású csavartengely mentén elhelyezked molekulák oszlopokba rendez dnek, melyekben a másodlagos köt er k rendszere azonos, akár az R, akár az S ibuprofén alkotja. Amennyiben a királis (+)- (R)-feniletilamin helyett a szerkezetileg rokon, de akirális benzilamint alkalmazzuk, a keletkez racém termékben (P-1) az ibuprofén és a benzilamin sztöchiometriai aránya 2:1, egyaránt a szuperkritikus extrakcióval történ elválasztás eredményeként és az oldószerb l növesztett egykristályban is. Az egykristály röntgendiffrakció módszerével sikerült bizonyítani, hogy a nem várt sztöchiometriai arány úgy alakul ki, hogy a keletkez só oszlopához két oldalról még egy-egy semleges ibuprofén kapcsolódik a kristályrácsban (4. ábra). Azaz egy ko-kristályon belül az ibuprofén semleges és ionos formája is megtalálható. 2. Ábra. Diasztereomer sóképzéssel történ enantiomer elválasztás. Az (S,R) konfigurációjú nagyobb oldhatóságú diasztereomernél a kristálynövekedés radiális irányban gátolt, t s kristályok kötege keletkezik. Az (S,S) konfigurációjú kisebb oldhatóságú diasztereomer gyorsabban kristályosodik, és szép egykristály növekszik. Az elválasztási eljárásban kinetikus kontroll érvényesül. A diasztereomer agglomerátum az er s másodlagos kölcsönhatásoknak köszönhet en gyorsan növekszik a kétfogású csavartengely irányában (3. ábra). 4. Ábra. A benzilamin-(2-(4-izobutilfenil)-propionát) és (2-(4- izobutilfenil)-propionsavból álló kokristály szerkezete. A semleges ibuprofént vonalas rajz mutatja, az anionos formát világosszürke térkitölt s modell ábrázolja. 4. Röntgendiffrakciós szerkezet meghatározás és polimorfia 3. Ábra. Az (S)-( )-1-feniletilammónium-(S)-(+)-N-formilfenil-alaninát só kristálya (P ): a kétfogású csavartengely iránya a.) a lap síkjában és b.) arra mer legesen helyezkedik el. Az oszlopon belül található az er s másodlagos kötésrendszer, míg kifelé állnak a molekula apoláros részei. Az (S,S) konfiguráció esetén az N-formilfenilalanin kett skötés oxigénje kifelé fordul az oszlop irányából, így lehet ség nyílik az oszlopok között egy gyenge, de jelenléte miatt lényeges C-H...O típusú hidrogénkötés kialakítására, mely el segíti a kristálynövekedést radiális irányban. Az A polimorfia jelensége és a molekula konformáció szorosan összefüggnek. A kristályban ható er k gyakran elegend en nagyok, hogy flexibilis molekulák intramolekuláris torziós szögeit befolyásolják, amely kiemeli a másodlagos gyenge kölcsönhatások szerepének fontosságát. A cimetidint felváltó, annál 30-szor hatékonyabb famotidin polimorfia vizsgálatai a szer kifejlesztését l napjainkig tartanak. A famotidin egy hisztamin H 2 -receptor antagonista, a gyomorsav termelést gátolja ben hozta forgalomba

4 Magyar Kémiai Folyóirat - Előadások 13 a japán Yamanouchi gyógyszergyár. Generikumát t l gyártja a Richter Gedeon NyRT. A japán kutatók csak a nyitott transz konformációjú famotidin szerkezetét írták le. Magyar kutatók pár évvel kés bb el állították és meghatározták a cisz forma szerkezetét 6 (5. ábra) Az, hogy melyik forma kristályosodik, függ többek között a kiindulási koncentrációtól, az oldószert l, a h tési sebességt l, a nukleációs h mérséklett l és a beoltástól 7. A B formában található, alacsonyabb olvadáspontú, hajt alakú cisz konformációjú metastabil termék a kinetikailag kedvez bb. A nyitott transz konformációjú A forma a termodinamikailag stabilabb 8. Az A formában lév molekula nagyobb bels energiájú összehasonlítva az izolált monomer alacsonyabb bels energiájával, bár konformációjuk hasonló. A nagyobb bels energiát kompenzálják a kedvez bb elektrosztatikus és polarizációs kölcsönhatási energiák, a nagyobb intermolekuláris kölcsönhatási energia. 5. Ábra. A famotidin monotróp polimorfiája. A famotidin két konformere: A transz és B cisz forma. Szerkezeti szempontból érdekes esetek az elt n polimorfok, amikor a stabilabb forma megjelenése után a kevésbé stabil módosulat többet nem állítható el. Ez azért zavaró, mert elveszítjük a kontrollt a megfelel forma el állításának folyamata felett, sokkal kifinomultabb technikákat kell alkalmazni a megkívánt polimorf el állítására. Az 1,2,3,5-tetra-O-acetil- -D-ribofuranóz molekula esete klasszikus példája az elt n polimorfoknak ben állították el el ször. A rákövetkez években három kontinensen, Európában, Amerikában és Ausztráliában számoltak be arról, hogy ahol felt nt a stabilabb módosulat, ott átalakult az instabil módosulat a stabilabbá, és többet nem tudták az instabilis formát el állítani (6. ábra). Magyarországon sikerült 1981-ben az instabilis módosulatot újra el állítani 9. A szobah mérséklet röntgendiffrakciós mérés során t nt fel, hogy rövid, taszító intermolekuláris kölcsönhatás valószín síthet a szerkezetben. Ezért el bb alacsony h mérséklet (110K) röntgendiffrakciós mérést, majd 25 K-en neutrondiffrakciós mérést végeztünk a pontos hidrogén atomi pozíciók meghatározására 10. A h tés során fázisátalakulás nem következett be. Az instabilis formában rövid, 1,949(7) Å-ös hidrogén-hidrogén intermolekuláris távolságot találtunk a gy r hidrogének között (6. ábra), mely a stabilis formában nincs jelen. Ez a szerves kristályokban valaha talált legrövidebb intermolekuláris távolság mind a mai napig. A számolt intramolekuláris potenciális energia alapján az instabilis kristálymódosulatban megtalálható stabilabb geometriájú molekula a kisebb molekula térfogatú, mely egy nagyobb s r ség kristályrácsban szorosabban illeszkedve kristályosodik. Ennek ellenére mégis ez lesz az instabilis módosulat, a kristályban jelenlév taszító intermolekuláris hidrogén-hidrogén kölcsönhatás miatt. A -laktám gy r számos antibiotikum család központi magjának része (pl. penicillin), a baktériumok sejtfal 6. Ábra. Konformáció, intermolekuláris távolságok és kölcsönhatások, polimorfia: az 1,2,3,5-tetra-O-acetil- -D-ribofuranóz módosulatai. A két módosulat konformációja. a.) A: instabil (világos szürke) monoklin, P ; B: stabil (sötét szürke) rombos, P. b.) A taszító H...H intermolekuláris kölcsönhatás az instabil formában. bioszintézisének gátlásával hatnak. A transz-13-azabiciklo [10.2.0]tetradekán-14-on két polimorfja ismert 11 (7. ábra). Mindkét forma ugyanabban a tércsoportban kristályosodik, és cella paramétereik nagyon hasonlóak. Ennek ellenére nem izostruktúrálisak, a két formában a hidrogénkötések iránya a homokirális láncokban eltér. Ennek oka, hogy a molekula egy nem-krisztallográfiai kétfogású tengely körül elfordul: a makrociklus konformációja közel azonos marad, azonban a nitrogén és az oxigén kvázi helyet cserél a -laktám gy r átfordulásával, a másodlagos kötések elrendez dése a kétfogású csavartengelyhez képest átalakul. A metanolból kristályosított I-es formában az N-C=O N intermolekuláris torziós szög antiperiplanáris, míg az acetonból kristályosodott II formában szünperiplanáris. 7. Ábra. A transz-13-azabiciklo[10.2.0]tetradekán-14-on két polimorfja: az I forma, a II forma és a kétfajta kristálybeli elrendez dés sematikus ábrázolása. A hidrogénkötések irányát nyíl mutatja. Dipólus indukálta polimorfiára példa a transz-2- hidroxicikloheptánkarboxilsav esete 12. A két formában (8. ábra) a kristályszimmetriák egyformák, azzal a különbséggel az elrendez désükben, hogy a b és c tengely megcserél dik (Pna és Pn a). A cellaparaméterek 8. Ábra. A transz-2-hidroxicikloheptánkarboxilsav két polimorfja: az I forma, a II forma és a heterokirális rétegek lehetséges illeszkedési mintázatainak sematikus ábrázolása. a mérési hibán belül azonosak. A különbség a szerkezetek között a molekuláris rétegek elrendez désében van. Mindkét formában az ábrán felül bemutatott rétegben az O-H O kötés iránya jobbról balra halad. Ehhez képest a következ réteg paralell elrendez dés a dibutil-éter és n-hexán keverékb l kristályosított I forma gyengébb min ség egykristálya esetén, melynek szerkezetét

5 14 Magyar Kémiai Folyóirat - Előadások nehezebb volt megoldani, és kevésbé finomodott. A bután- 2-on és n-hexán keverékb l kristályosodott II formában az els t követ következ réteg antiparallel elrendez dés. A dipólusok közvetlenül kioltódnak, a kristály jó min ség, jól finomodik. Az I forma kristályára is teljesül a dipólus momentumok egyensúlya a teljes rács szintjén. Parallel elrendez dés domének váltogatják egymást, a domének határán a II formának megfelel antiparallel elrendez dés alakul ki. Minden szerkezet meghatározás célja, hogy kapcsolatot találjunk a szerkezet és a fizikai-kémiai tulajdonságok között. Erre jó példa a 4-(1-hidroxi-1,2-difeniletil)piridin sósavas sójának szublimációja 13. A f thet tárgyasztalú mikroszkópon a só szublimál, a szublimátum egykristály formájában az anyakristály bizonyos lapjain válik ki (9. ábra). A kiindulási és a szublimációval nyert egykristályokat megvizsgálva megállapítható volt, hogy a hidroklorid só a h hatására elbomlik, tiszta 4-(1-hidroxi-1,2-difeniletil)piridin keletkezik. A só és a szerves molekula egykristálya parciálisan izostruktúrális. A szublimátum az anyakristály azon lapjaira válik ki, ahol ez a részleges izostrukturalitás megvalósul, a kristályokban a piridinszármazék szerkezete a leginkább hasonló. 9. Ábra. A 4-(1-hidroxi-1,2-difeniletil)piridin HCl sójának szublimációja. A szublimátum, mely csak a szerves vegyületet tartalmazza, az anyakristály azon lapjaira válik ki, melyekkel parciális izostrukturalitást mutat. 5. Röntgendiffrakciós szerkezet meghatározás és kristály morfológia A megkívánt gyógyszerhatóanyag birtokában a röntgendiffrakció a formuláláshoz is nyújthat segítséget a megfelel morfológiájú kristály el állítására. A krisztallográfia I. alaptörvénye a lapszögek állandóságának törvénye (1669 Steno). Prof Alessia Bacchi és kutatócsoportja 14 egy Ru komplex peldáján mutatja be (10. ábra), hogy miként változik egy kristály habitusa annak függvényében, hogy milyen oldószerb l kristályosították. A sematikus ábra világos szürke kristálya azt a kristályformát ábrázolja, amely akkor keletkezne, ha a kristály egyes lapjainak növekedési sebessége azonos lenne. A bennük feltüntetett sötétszürke kristály az egyes oldószerekb l növekv kristály alakját jelzi, mely megfelel a felettük lefényképezett kristályok formájának. A különböz oldószerek különböz mértékben befolyásolták az egyes lapok növekedési sebességét. A fényképeken látható kristályok mind kémiai, mind kristályszerkezet szempontjából azonosak, bár megjelenésük különböz. 6. Röntgendiffrakciós szerkezet meghatározás és az adatbankok A röntgendiffrakció száz éve alatt meghatározott szerkezeteket adatbankokban gy jtötték össze, az anyagi min ség szerint csoportosítva. A fémek és ötvözetek a CRYSTMET adatbankban (www.tothcanada.com), a szervetlen szerkezeteket a karlsruhei Szervetlen Szerkezeti Adatbankban (www.fiz-informationsdienste.de/ en/db/icsd/), a szerves és fémorganikus vegyületek, komplexek a Cambridge-i Krisztallográfiai Adatbázisban (CSD) (www.ccdc.cam.ac.uk), a 24 egységnél nagyobb polipeptideket és poliszacharinok tartalmazó vegyületek a Protein Adatbankban (PDB) (www.rcsb.org/pdb/) az oligonukleotidok a Nukleinsav Adatbankban (NADB) (ndbserver.rutgers.edu/) találhatók. A Cambridge-i Krisztallográfiai Adatbázis 15 tartalmaz minden legalább egy szénatomot tartalmazó szerves és fémorganikus vegyületet, melynek szerkezetét röntgen vagy neutron diffrakcióval, egykristály vagy pordiffrakcióval határozták meg. Az adatbank ma már több mint félmillió szerkezetet tartalmaz. A Cambridge-i Szerkezeti Adatbázis leggyakoribb felhasználási területei: F bb molekuláris dimenziók, fém koordinációs szféra geometriájának meghatározása. Modell koordináták szolgáltatása szerkezet validáláshoz, szerkezet finomításban használt megkötésekhez nyújt adatokat. Konformációs analízis és háromdimenziós farmakofor elrendez dések meghatározása. Hidrogén kötések és más nem-köt kölcsönhatások el fordulásának, geometriájának vizsgálata. Szerkezeti korreláció és reakcióút analízis. Kristály építészet (crystal engineering) és kristályszerkezet jóslás. Molekula modellezés és racionális gyógyszerhatóanyag tervezés, protein-ligandum kölcsönhatások tanulmányozása. 7. Összefoglalás 10. Ábra. Egy Ru komplex vegyület kristályai 14, melyek szerkezete azonos, megjelenésük különböz a kristályosító oldószer függvényében. A kutatási irányok súlypontjai a röntgendiffrakció 100 éve alatt változtak. Az els h si id kben az egyszer sók és ásványok szerkezetének felderítése zajlott. A XX. század hatvanas évei a kovalens molekulák szerkezeti megismerésének id szaka. A kismolekulás szerkezetkutatás egyik legfontosabb területe manapság az intermolekuláris kölcsönhatások megismerése. Jean-Marie Lehn mondta ki, aki szupramolekuláris kémiai kutatásaiért 1988-ban kapott

6 Magyar Kémiai Folyóirat - Előadások 15 Nobel-díjat, hogy az anyag tulajdonsága egyrészt függ az alkotóelemek természetét l, másrészt a közöttük lév kölcsönhatásoktól. Így a másodlagos kölcsönhatásoknak szerepük van a gyógyszerkémia területén a molekuláris felismerési folyamatokban és a biológiai makromolekulák aktivitásában. Láthattuk, hogy minden bemutatott példa szerkezetben mennyire meghatározó szerepe volt az intermolekuláris kölcsönhatásoknak. Összefoglalva a röntgendiffrakció szerepét a gyógyszerkutatásban a bemutatott eseteken látható, hogy a molekula- és kristályszerkezet ismerete milyen sokrét információval járul hozzá az új gyógyszerek kifejlesztéséhez, gyártásához. A röntgendiffrakció módszerével információt kaphatunk az anyag összetételér l, konformációjáról, kiralitásáról, izostrukturalitásáról vagy polimorfiájáról, a másodlagos kölcsönhatások rendszerér l, az anyag szerkezete és fizikai-kémiai tulajdonságainak kapcsolatáról, a kristály morfológiájáról, s mindezek az ismeretek összegy jtve teszik lehet vé a tudatos kristály tervezést (crystal engineering), s az egyre megbízhatóbbá váló kristályszerkezet jóslást. A röntgendiffrakció széles körben alkalmazható, mint a gyógyszerkutatás m szeres módszere, de meghatározó módszer a mineralógiában, metallográfiában, kémiában, szilárdtest fizikában, molekuláris biológiában, anyagtudományokban stb. egyaránt. Egy eredeti kreatív vívmány szinte sohasem hirtelen megvilágosodás eredménye, nincs fejünkben kigyulladó villanykörte, hanem hosszú évek kemény munkájának gyümölcse. 16 Laue, Friedrich és Knipping el tt sokan sokféle anyagot kitettek röntgen sugárzásnak, de mindenki figyelme a direkt sugárzás abszorpciójára korlátozódott. A kristály rácsszerkezete elméletének ismerete hozta az elképzelést, hogy megvizsgálják a direkt sugár környezetét, a gyenge diffraktált sugárzást. Ez a különbség a tudás vezérelt kutatás és a véletlen felfedezés között 17. A szerz k a cikket a legid sebb él magyar krisztallográfusnak dedikálják. Sasvári Kálmán (1912- ) születése alig két hónappal el zte meg az els röntgendiffrakciós kísérlet elvégzését. Egyúttal tisztelettel emlékezünk Simon Kálmánra ( ), aki a Chinoin Zrt gyárban megteremtette a röntgendiffrakciós szerkezetkutatást. Köszönetnyilvánítás A szerz k köszönetüket fejezik ki az OTKA (100801) támogatásáért. Hivatkozások 1. Schwarzenbach, D.: Acta Cryst. 2012, A68, Schmahl, W.W.; Steurer, W.: Acta Cryst. 2012, A68, Kitaigorodskii, A.I.: Organic Chemical Crystallography. Consultant Bureau, New York Bereczki, L.; Pálovics, E.; Bombicz, P.; Pokol, G.; Fogassy, E.; Marthi, K.: Tetrahedron: Asymmetry 2007, 18, Molnár, P.; Bombicz, P.; Varga, C.; Bereczki, L.; Székely, E.; Pokol, G.; Fogassy, E.; Simándi, B.: Chirality 2009, 21, Heged s, B.; Bod, P.; Harsányi, K.; Péter, I.; Kálmán, A.; Párkányi, L.: J. Pharm. Biomed., 1989, 7, Lu, J.; Wang, X.J.; Yang, X.; Ching, C.B.: Crystal Growth and Design, 2007, 7, Ferenczy, G.G.; Párkányi, L.; Ángyán, J.G.; Kálmán, A.; Heged s, B.: J.Mol.Struct.:THEOCHEM, 2003, 503, Czugler, M.; Kálmán, A.; Kovács, J.; Pintér, I.: Acta Cryst. 1981, B37, Bombicz, P.; Czugler, M.; Tellgren, R.; Kálmán, A.: Angewandte Chemie 2003, 17, Fábián, L.; Kálmán, A.; Argay, G.; Bernáth G.; Gyarmati, Z.C.: Chem.Commun. 2004, Kálmán, A.; Fábián, L.; Argay, G.; Bernáth G.; Gyarmati, Z.C.: J. Am. Chem. Soc. 2003, 125, Báthori, N.B.; Bombicz, P.; Bourne, S.A.; Venter, G.: New Journal of Chemistry, 2010, 34, (címlap). 14. Bacchi, A.; Cantoni, G.; Cremona, D.; Pelagatti, P.; Ugozzoli, F.: Angewandte Chemie 2011, 50, Allen, F.H.: Acta Cryst. 2002, B58, Csíkszentmihályi Mihály: Kreativitás. A flow és a felfedezés avagy a találékonyság pszichológiája. Akadémiai Kiadó Schmahl, W.W.; Steurer, W.: Acta Cryst., 2012, A68, 1-2. The 100 years old X-ray diffraction in the pharmaceutical sciences Experiencing classical crystallography for hundreds of years, the birth of modern crystallography took place 100 years ago, when Max von Laue, Walter Friedrich and Paul Knipping carried out the experiment that showed that X-rays were diffracted by crystals. Knowledge of the structure of matter at atomic resolution has revolutionary consequences for all branches of natural sciences: physics, chemistry, biology, earth sciences and material science 1. In order to understand the physical-chemical properties, the macroscopic characteristics of matter we must know its structure. 100 years after the Laue experience crystallography is still at the cutting edge of science 2. Declared by the United Nations 2014 will officially be the International Year of Crystallography IYCr2014. After a reminiscence of the centenary of the discovery of X-ray diffraction the paper presents applications of X-ray diffraction in the pharmaceutical sciences primarily on the role of chirality and the appearance of polymorphy. It includes structure - property relationship, whole and partial isostructurality, intermolecular interactions, cocrystal formation, crystal engineering and the affect of crystal habit in the knowledge of the structure.

Röntgendiffrakció módszerével vizsgálható szerkezetek kismolekulák makromolekulák szervetlen vegyületek, szerves vegyületek, proteinek, vírusok

Röntgendiffrakció módszerével vizsgálható szerkezetek kismolekulák makromolekulák szervetlen vegyületek, szerves vegyületek, proteinek, vírusok A 100 éves röntgendiffrakció a gyógyszerkutatásban Bombicz Petra és Kálmán Alajos MTA Természettudományi Kutatóközpont Szerves Kémiai Intézet, Szerkezeti Kémiai Osztály Röntgendiffrakció módszerével vizsgálható


Röntgen sugárzás. Wilhelm Röntgen. Röntgen feleségének keze

Röntgen sugárzás. Wilhelm Röntgen. Röntgen feleségének keze Röntgendiffrakció Kardos Roland 2010.03.08. Előadás vázlata Röntgen sugárzás Interferencia Huygens teória Diffrakció Diffrakciós eljárások Alkalmazás Röntgen sugárzás 1895 röntgen sugárzás felfedezés (1901


Kémiai krisztallográfia: kristály építészet

Kémiai krisztallográfia: kristály építészet Magyar Kémiai Folyóirat - Előadások 171 Kémiai krisztallográfia: kristály építészet BOMBICZ Petra * MTA Természettudományi Kutatóközpont, Szerves Kémiai Intézet 1. Bevezetés A Magyar Tudományos Akadémia


Kötések kialakítása - oktett elmélet

Kötések kialakítása - oktett elmélet Kémiai kötések Az elemek és vegyületek halmazai az atomok kapcsolódásával - kémiai kötések kialakításával - jönnek létre szabad atomként csak a nemesgázatomok léteznek elsődleges kémiai kötések Kötések


Röntgensugárzás a tudományban

Röntgensugárzás a tudományban Röntgensugárzás a tudományban Faigel Gyula, MTA Wigner FK SZFI, 2015 Bevezetés Röntgensugárzás a - biológiában -kémiában - szilárdtestfizikában, anyagtudományban - archeológiában és művészetekben Zárszó


Új utak a röntgensugárzással való atomi szintű anyagszerkezet meghatározásban Faigel Gyula MTA SZFKI 2006

Új utak a röntgensugárzással való atomi szintű anyagszerkezet meghatározásban Faigel Gyula MTA SZFKI 2006 Új utak a röntgensugárzással való atomi szintű anyagszerkezet meghatározásban Faigel Gyula MTA SZFKI 2006 Bevezető Röntgensugárzással való szerkezet-meghatározás: Hagyományos diffrakciós módszerek Új röntgen


Tartalmi követelmények kémia tantárgyból az érettségin K Ö Z É P S Z I N T

Tartalmi követelmények kémia tantárgyból az érettségin K Ö Z É P S Z I N T 1. Általános kémia Atomok és a belőlük származtatható ionok Molekulák és összetett ionok Halmazok A kémiai reakciók A kémiai reakciók jelölése Termokémia Reakciókinetika Kémiai egyensúly Reakciótípusok


Fizikai kémia Diffrakciós módszerek. Bevezetés. Történeti áttekintés

Fizikai kémia Diffrakciós módszerek. Bevezetés. Történeti áttekintés 06.08.. Fizikai kémia. 6. Diffrakciós módszerek Dr. Berkesi Ottó SZTE Fizikai Kémiai és Anyagtudományi Tanszéke 05 Bevezetés A kémiai szerkezet vizsgálatához használatos módszerek közül eddig a különöző


Atomszerkezet. Atommag protonok, neutronok + elektronok. atompályák, alhéjak, héjak, atomtörzs ---- vegyérték elektronok

Atomszerkezet. Atommag protonok, neutronok + elektronok. atompályák, alhéjak, héjak, atomtörzs ---- vegyérték elektronok Atomszerkezet Atommag protonok, neutronok + elektronok izotópok atompályák, alhéjak, héjak, atomtörzs ---- vegyérték elektronok periódusos rendszer csoportjai Periódusos rendszer A kémiai kötés Kémiai


Röntgendiffrakció, tömegspektrometria, infravörös spektrometria.

Röntgendiffrakció, tömegspektrometria, infravörös spektrometria. A biomolekuláris szerkezet és dinamika vizsgálómódszerei: Röntgendiffrakció, tömegspektrometria, infravörös spektrometria. Smeller László A molekuláris szerkezet és dinamika vizsgáló módszereinek áttekintése


Magfizika tesztek. 1. Melyik részecske nem tartozik a nukleonok közé? a) elektron b) proton c) neutron d) egyik sem

Magfizika tesztek. 1. Melyik részecske nem tartozik a nukleonok közé? a) elektron b) proton c) neutron d) egyik sem 1. Melyik részecske nem tartozik a nukleonok közé? a) elektron b) proton c) neutron d) egyik sem 2. Mit nevezünk az atom tömegszámának? a) a protonok számát b) a neutronok számát c) a protonok és neutronok


Az atommag összetétele, radioaktivitás

Az atommag összetétele, radioaktivitás Az atommag összetétele, radioaktivitás Az atommag alkotórészei proton: pozitív töltésű részecske, töltése egyenlő az elektron töltésével, csak nem negatív, hanem pozitív: 1,6 10-19 C tömege az elektron


A kovalens kötés polaritása

A kovalens kötés polaritása Általános és szervetlen kémia 4. hét Kovalens kötés A kovalens kötés kialakulásakor szabad atomokból molekulák jönnek létre. A molekulák létrejötte mindig energia csökkenéssel jár. A kovalens kötés polaritása


Az atom- olvasni. 1. ábra Az atom felépítése 1. Az atomot felépítő elemi részecskék. Proton, Jele: (p+) Neutron, Jele: (n o )

Az atom- olvasni. 1. ábra Az atom felépítése 1. Az atomot felépítő elemi részecskék. Proton, Jele: (p+) Neutron, Jele: (n o ) Az atom- olvasni 2.1. Az atom felépítése Az atom pozitív töltésű atommagból és negatív töltésű elektronokból áll. Az atom atommagból és elektronburokból álló semleges kémiai részecske. Az atommag pozitív





T I T - M T T. Hevesy György Kémiaverseny. A megyei forduló feladatlapja. 8. osztály. A versenyző jeligéje:... Megye:...

T I T - M T T. Hevesy György Kémiaverseny. A megyei forduló feladatlapja. 8. osztály. A versenyző jeligéje:... Megye:... T I T - M T T Hevesy György Kémiaverseny A megyei forduló feladatlapja 8. osztály A versenyző jeligéje:... Megye:... Elért pontszám: 1. feladat:... pont 2. feladat:... pont 3. feladat:... pont 4. feladat:...


Az élő sejt fizikai Biológiája:

Az élő sejt fizikai Biológiája: Az élő sejt fizikai Biológiája: Modellépítés, biológiai rendszerek skálázódása Kellermayer Miklós Fizikai biológia Ma már nem csak kvalitatív megfigyeléseket, hanem kvantitatív méréseket végzünk (biológiai


A feladatok megoldásához csak a kiadott periódusos rendszer és számológép használható!

A feladatok megoldásához csak a kiadott periódusos rendszer és számológép használható! 1 MŰVELTSÉGI VERSENY KÉMIA TERMÉSZETTUDOMÁNYI KATEGÓRIA Kedves Versenyző! A versenyen szereplő kérdések egy része általad már tanult tananyaghoz kapcsolódik, ugyanakkor a kérdések másik része olyan ismereteket



KÉMIA FELVÉTELI DOLGOZAT KÉMIA FELVÉTELI DOLGOZAT I. Egyszerű választásos teszt Karikázza be az egyetlen helyes, vagy egyetlen helytelen választ! 1. Hány neutront tartalmaz a 127-es tömegszámú, 53-as rendszámú jód izotóp? A) 74


41. ábra A NaCl rács elemi cellája

41. ábra A NaCl rács elemi cellája 41. ábra A NaCl rács elemi cellája Mindkét rácsra jellemző, hogy egy tetszés szerint kiválasztott pozitív vagy negatív töltésű iont ellentétes töltésű ionok vesznek körül. Különbség a közvetlen szomszédok


A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin.

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin. Myoglobin Fehérje-szerkezetek! MGLSDGEWQLVLNVWGKVEADIPGGQEVLIRLFK GPETLEKFDKFKLKSEDEMKASE DLKKGATVLTALGGILKKKGEAEIKPLAQSA TKKIPVKYLEFISECIIQVLQSK PGDFGADAQGAMNKALELFRKDMASNYKELGFQG Fuxreiter Mónika! Debreceni


Az elemeket 3 csoportba osztjuk: Félfémek vagy átmeneti fémek nemfémek. fémek

Az elemeket 3 csoportba osztjuk: Félfémek vagy átmeneti fémek nemfémek. fémek Kémiai kötések Az elemeket 3 csoportba osztjuk: Félfémek vagy átmeneti fémek nemfémek fémek Fémek Szürke színűek, kivétel a színesfémek: arany,réz. Szilárd halmazállapotúak, kivétel a higany. Vezetik az


Sillabusz orvosi kémia szemináriumokhoz 1. Kémiai kötések

Sillabusz orvosi kémia szemináriumokhoz 1. Kémiai kötések Sillabusz orvosi kémia szemináriumokhoz 1. Kémiai kötések Pécsi Tudományegyetem Általános Orvostudományi Kar 2010-2011. 1 A vegyületekben az atomokat kémiai kötésnek nevezett erők tartják össze. Az elektronok


ALKÍMIA MA Az anyagról mai szemmel, a régiek megszállottságával. www.chem.elte.hu/pr

ALKÍMIA MA Az anyagról mai szemmel, a régiek megszállottságával. www.chem.elte.hu/pr ALKÍMIA MA Az anyagról mai szemmel, a régiek megszállottságával www.chem.elte.hu/pr Kvíz az előző előadáshoz 1) Mikor kapott Paul Ehrlich orvosi Nobel-díjat? A) Idén. B) Pont 100 éve, 1908-ban. C) Nem



SZAKÁLL SÁNDOR, ÁsVÁNY- És kőzettan ALAPJAI SZAKÁLL SÁNDOR, ÁsVÁNY- És kőzettan ALAPJAI 7 KRISTÁLYTAN VII. A KRIsTÁLYOK szimmetriája 1. BEVEZETÉs Az elemi cella és ebből eredően a térrácsnak a szimmetriáját a kristályok esetében az atomok, ionok



A TÖMEGSPEKTROMETRIA ALAPJAI A TÖMEGSPEKTROMETRIA ALAPJAI web.inc.bme.hu/csonka/csg/oktat/tomegsp.doc alapján tömeg-töltés arány szerinti szétválasztás a legérzékenyebb módszerek közé tartozik (Nagyon kis anyagmennyiség kimutatására


Szakközépiskola 9-10. évfolyam Kémia. 9-10. évfolyam

Szakközépiskola 9-10. évfolyam Kémia. 9-10. évfolyam 9-10. évfolyam A szakközépiskolában a kémia tantárgy keretében folyó személyiségfejlesztés a természettudományos nevelés egyik színtereként a hétköznapi életben hasznosulni képes tudás épülését szolgálja.


Kémiai kötés Lewis elmélet

Kémiai kötés Lewis elmélet Kémiai kötés 10-1 Lewis elmélet 10-2 Kovalens kötés: bevezetés 10-3 Poláros kovalens kötés 10-4 Lewis szerkezetek 10-5 A molekulák alakja 10-6 Kötésrend, kötéstávolság 10-7 Kötésenergiák Általános Kémia,


A polipeptidlánc szabályozott lebontása: mit mondanak a fehérjekristályok? Harmat Veronika ELTE Kémiai Intézet, Szerkezeti Kémia és Biológia Laboratórium MTA-ELTE Fehérjemodellező Kutatócsoport A magyar


Adatgyőjtés, mérési alapok, a környezetgazdálkodás fontosabb mőszerei

Adatgyőjtés, mérési alapok, a környezetgazdálkodás fontosabb mőszerei GazdálkodásimodulGazdaságtudományismeretekI.Közgazdaságtan KÖRNYEZETGAZDÁLKODÁSIMÉRNÖKIMScTERMÉSZETVÉDELMIMÉRNÖKIMSc Tudományos kutatásmódszertani, elemzési és közlési ismeretek modul Adatgyőjtés, mérési


Kristályos szilárd anyagok

Kristályos szilárd anyagok Általános és szervetlen kémia 4. hét Elızı héten elsajátítottuk, hogy a kovalens kötés hogyan jön létre, milyen elméletekkel lehet leírni milyen a molekulák alakja melyek a másodlagos kötések Mai témakörök


Újabb eredmények a grafén kutatásában

Újabb eredmények a grafén kutatásában Újabb eredmények a grafén kutatásában Magda Gábor Zsolt Atomoktól a csillagokig 2014. március 13. Új anyag, új kor A kőkortól kezdve egy új anyag felfedezésekor új lehetőségek nyíltak meg, amik akár teljesen


Atommodellek de Broglie hullámhossz Davisson-Germer-kísérlet

Atommodellek de Broglie hullámhossz Davisson-Germer-kísérlet Atommodellek de Broglie hullámhossz Davisson-Germer-kísérlet Utolsó módosítás: 2016. május 4. 1 Előzmények Az atomok színképe (1) A fehér fény komponensekre bontható: http://en.wikipedia.org/wiki/spectrum


A borok tisztulása (kolloid tulajdonságok)

A borok tisztulása (kolloid tulajdonságok) A borok tisztulása (kolloid tulajdonságok) Tisztasági problémák a borban Áttetszőség fogyasztói elvárás, különösen a fehérborok esetében Zavarosságok: 1. bor felületén (pl. hártya); 2. borban szétszórtan


Röntgenanalitikai módszerek I. Összeállította Dr. Madarász János Frissítve 2016 tavaszán

Röntgenanalitikai módszerek I. Összeállította Dr. Madarász János Frissítve 2016 tavaszán Röntgenanalitikai módszerek I Összeállította Dr. Madarász János Frissítve 2016 tavaszán (Röntgen)analitikai módszerek Kémiai analízis kérdései a mérendő mintáról: Egynemű-e? Az-e, aminek deklarálták? Ha



AZ ÉLET KÉMIÁJA... ÉLŐ ANYAG SZERVEZETI ALAPEGYSÉGE AZ ÉLET KÉMIÁJA... ÉLŐ ANYAG SZERVEZETI ALAPEGYSÉGE A biológia az élet tanulmányozásával foglalkozik, az élő szervezetekre viszont vonatkoznak a fizika és kémia törvényei MI ÉPÍTI FEL AZ ÉLŐ ANYAGOT? HOGYAN


Szentjánosbogár, trópusi halak, sarki fény Mi a közös a természet fénytüneményeiben?

Szentjánosbogár, trópusi halak, sarki fény Mi a közös a természet fénytüneményeiben? Szentjánosbogár, trópusi halak, sarki fény Mi a közös a természet fénytüneményeiben? Szalay Péter egyetemi tanár ELTE, Kémiai Intézet Elméleti Kémiai Laboratórium Van közös bennük? Egy kis történelem


Kémiai kötések. Kémiai kötések. A bemutatót összeállította: Fogarasi József, Petrik Lajos SZKI, 2011

Kémiai kötések. Kémiai kötések. A bemutatót összeállította: Fogarasi József, Petrik Lajos SZKI, 2011 Kémiai kötések A bemutatót összeállította: Fogarasi József, Petrik Lajos SZKI, 2011 1 Cl + Na Az ionos kötés 1. Cl + - + Na Klór: 1s 2 2s 2 2p 6 3s 2 3p 5 Kloridion: 1s2 2s2 2p6 3s2 3p6 Nátrium: 1s 2 2s


Vegyületek - vegyületmolekulák

Vegyületek - vegyületmolekulák Vegyületek - vegyületmolekulák 3.Az anyagok csoportosítása összetételük szerint Egyszerű összetett Azonos atomokból állnak különböző atomokból állnak Elemek vegyületek keverékek Fémek Félfémek Nemfémek


Fehérjeszerkezet, és tekeredés. Futó Kinga

Fehérjeszerkezet, és tekeredés. Futó Kinga Fehérjeszerkezet, és tekeredés Futó Kinga Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983 H 211861 N


T I T - M T T. Hevesy György Kémiaverseny. A megyei forduló feladatlapja. 7. osztály. A versenyző jeligéje:... Megye:...

T I T - M T T. Hevesy György Kémiaverseny. A megyei forduló feladatlapja. 7. osztály. A versenyző jeligéje:... Megye:... T I T - M T T Hevesy György Kémiaverseny A megyei forduló feladatlapja 7. osztály A versenyző jeligéje:... Megye:... Elért pontszám: 1. feladat:... pont 2. feladat:... pont 3. feladat:... pont 4. feladat:...


Atomok és molekulák elektronszerkezete

Atomok és molekulák elektronszerkezete Atomok és molekulák elektronszerkezete Szabad atomok és molekulák Schrödinger egyenlete Tekintsünk egy kvantummechanikai rendszert amely N n magból és N e elektronból áll. Koordinátáikat jelölje rendre



ATOMMODELLEK, SZÍNKÉP, KVANTUMSZÁMOK. Kalocsai Angéla, Kozma Enikő ATOMMODELLEK, SZÍNKÉP, KVANTUMSZÁMOK Kalocsai Angéla, Kozma Enikő RUTHERFORD-FÉLE ATOMMODELL HIBÁI Elektromágneses sugárzáselmélettel ellentmondásban van Mivel: a keringő elektronok gyorsulnak Energiamegmaradás


Az elektromágneses hullámok

Az elektromágneses hullámok 203. október Az elektromágneses hullámok PTE ÁOK Biofizikai Intézet Kutatók fizikusok, kémikusok, asztronómusok Sir Isaac Newton Sir William Herschel Johann Wilhelm Ritter Joseph von Fraunhofer Robert


O k t a t á si Hivatal

O k t a t á si Hivatal O k t a t á si Hivatal A versenyző kódszáma: 2015/2016. tanévi Országos Középiskolai Tanulmányi Verseny második forduló KÉMIA I. kategória FELADATLAP Munkaidő: 300 perc Elérhető pontszám: 100 pont ÚTMUTATÓ


Kémia kerettanterve a Német Nemzetiségi Gimnázium és Kollégium 9 10. évfolyama számára

Kémia kerettanterve a Német Nemzetiségi Gimnázium és Kollégium 9 10. évfolyama számára Kémia kerettanterve a Német Nemzetiségi Gimnázium és Kollégium 9 10. évfolyama számára (az EMMI kerettanterv 51/2012. (XII. 21.) EMMI rendelet 3. sz. melléklet (B) változata alapján) A kémia tanításának


KÉMIA. Kiss Árpád Országos Közoktatási Szolgáltató Intézmény Vizsgafejlesztő Központ 2003

KÉMIA. Kiss Árpád Országos Közoktatási Szolgáltató Intézmény Vizsgafejlesztő Központ 2003 KÉMIA Kiss Árpád Országos Közoktatási Szolgáltató Intézmény Vizsgafejlesztő Központ 2003 ű érettségire felkészítő tananyag tanterve /11-12. ill. 12-13. évfolyam/ Elérendő célok: a természettudományos gondolkodás


EGÉSZTESTSZÁMLÁLÁS. Mérésleírás Nukleáris környezetvédelem gyakorlat környezetmérnök hallgatók számára

EGÉSZTESTSZÁMLÁLÁS. Mérésleírás Nukleáris környezetvédelem gyakorlat környezetmérnök hallgatók számára EGÉSZTESTSZÁMLÁLÁS Mérésleírás Nukleáris környezetvédelem gyakorlat környezetmérnök hallgatók számára Zagyvai Péter - Osváth Szabolcs Bódizs Dénes BME NTI, 2008 1. Bevezetés Az izotópok stabilak vagy radioaktívak


Röntgendiffrakciós szerkezetvizsgálat. A szerkezetmegoldás menete Lehetőségek és korlátok Alkalmazások

Röntgendiffrakciós szerkezetvizsgálat. A szerkezetmegoldás menete Lehetőségek és korlátok Alkalmazások Röntgendiffrakciós szerkezetvizsgálat A szerkezetmegoldás menete Lehetőségek és korlátok Alkalmazások A krisztallográfia alapjai Diffrakció: a sugárzás rugalmas kölcsönhatása az anyaggal Röntgendiffrakció


Pórusos polimer gélek szintézise és vizsgálata és mi a közük a sörgyártáshoz

Pórusos polimer gélek szintézise és vizsgálata és mi a közük a sörgyártáshoz Pórusos polimer gélek szintézise és vizsgálata és mi a közük a sörgyártáshoz Póta Kristóf Eger, Dobó István Gimnázium Témavezető: Fodor Csaba és Szabó Sándor "AKI KÍVÁNCSI KÉMIKUS" NYÁRI KUTATÓTÁBOR MTA


FOK Fogorvosi anyagtan fizikai alapjai tárgy kolokviumi kérdései 2012/13-es tanév I. félév

FOK Fogorvosi anyagtan fizikai alapjai tárgy kolokviumi kérdései 2012/13-es tanév I. félév FOK Fogorvosi anyagtan fizikai alapjai tárgy kolokviumi kérdései 2012/13-es tanév I. félév A kollokviumon egy-egy tételt kell húzni az 1-10. és a 11-20. kérdések közül. 1. Atomi kölcsönhatások, kötéstípusok.


A kovalens kötés elmélete. Kovalens kötésű molekulák geometriája. Molekula geometria. Vegyértékelektronpár taszítási elmélet (VSEPR)

A kovalens kötés elmélete. Kovalens kötésű molekulák geometriája. Molekula geometria. Vegyértékelektronpár taszítási elmélet (VSEPR) 4. előadás A kovalens kötés elmélete Vegyértékelektronpár taszítási elmélet (VSEPR) az atomok kötő és nemkötő elektronpárjai úgy helyezkednek el a térben, hogy egymástól minél távolabb legyenek A központi


SZAK: KÉMIA Általános és szervetlen kémia 1. A periódusos rendszer 14. csoportja. a) Írják le a csoport nemfémes elemeinek az elektronkonfigurációit

SZAK: KÉMIA Általános és szervetlen kémia 1. A periódusos rendszer 14. csoportja. a) Írják le a csoport nemfémes elemeinek az elektronkonfigurációit SZAK: KÉMIA Általános és szervetlen kémia 1. A periódusos rendszer 14. csoportja. a) Írják le a csoport nemfémes elemeinek az elektronkonfigurációit b) Tárgyalják összehasonlító módon a csoport első elemének


Röntgendiffrakciós szerkezetvizsgálat

Röntgendiffrakciós szerkezetvizsgálat Röntgendiffrakciós szerkezetvizsgálat TÁMOP-4.1.2.A/1-11/1-2011-0025 Dr. Bényei Attila, Ph.D. egyetemi docens Debreceni Egyetem TEK Fizikai Kémiai Tanszék Debreceni Egyetem OEC Gyógyszerészi Kémiai Tanszék


Szalay Péter (ELTE, Kémia Intézet) Szentjánosbogár, trópusi halak, sarki fény Mi a közös a természet fénytüneményeiben?

Szalay Péter (ELTE, Kémia Intézet) Szentjánosbogár, trópusi halak, sarki fény Mi a közös a természet fénytüneményeiben? Szalay Péter (ELTE, Kémia Intézet) Szentjánosbogár, trópusi halak, sarki fény Mi a közös a természet fénytüneményeiben? Boronkay György Műszaki Középiskola és Gimnázium Budapest, 2011. október 27. www.meetthescientist.hu


T I T - M T T. Hevesy György Kémiaverseny. A megyei forduló feladatlapja. 8. osztály. A versenyz jeligéje:... Megye:...

T I T - M T T. Hevesy György Kémiaverseny. A megyei forduló feladatlapja. 8. osztály. A versenyz jeligéje:... Megye:... T I T - M T T Hevesy György Kémiaverseny A megyei forduló feladatlapja 8. osztály A versenyz jeligéje:... Megye:... Elért pontszám: 1. feladat:... pont 2. feladat:... pont 3. feladat:... pont 4. feladat:...


2. ábra. 1. ábra. Alumínium-oxid

2. ábra. 1. ábra. Alumínium-oxid Alumínium-oxid Alumínium-oxid, más nevén alumina, a leghatékonyabb, széles körben használt és kiváló min ség anyag a m szaki kerámiák között. A természetben csak nagyon kötött formában létezik más anyagokkal,


Az ionizáló sugárzások fajtái, forrásai

Az ionizáló sugárzások fajtái, forrásai Az ionizáló sugárzások fajtái, forrásai magsugárzás Magsugárzások Röntgensugárzás Függelék. Intenzitás 2. Spektrum 3. Atom Repetitio est mater studiorum. Röntgen Ionizációnak nevezzük azt a folyamatot,


3 He ionokat pedig elektron-sokszorozóval számlálja. A héliummérést ismert mennyiségű

3 He ionokat pedig elektron-sokszorozóval számlálja. A héliummérést ismert mennyiségű Nagytisztaságú 4 He-es izotóphígítás alkalmazása vízminták tríciumkoncentrációjának meghatározására a 3 He leányelem tömegspektrométeres mérésén alapuló módszerhez Az édesvízkészletek felmérésében, a rétegvizek


Gyorsítók. Veszprémi Viktor ATOMKI, Debrecen. Supported by NKTH and OTKA (H07-C 74281) 2009. augusztus 17 Hungarian Teacher Program, CERN 1

Gyorsítók. Veszprémi Viktor ATOMKI, Debrecen. Supported by NKTH and OTKA (H07-C 74281) 2009. augusztus 17 Hungarian Teacher Program, CERN 1 Gyorsítók Veszprémi Viktor ATOMKI, Debrecen Supported by NKTH and OTKA (H07-C 74281) 2009. augusztus 17 Hungarian Teacher Program, CERN 1 Az anyag felépítése Részecskefizika kvark, lepton Erős, gyenge,


Izotóp geológia: Elemek izotópjainak használata geológiai folyamatok értelmezéséhez.

Izotóp geológia: Elemek izotópjainak használata geológiai folyamatok értelmezéséhez. Radioaktív izotópok Izotópok Egy elem különböző tömegű (tömegszámú - A) formái; Egy elem izotópjainak a magjai azonos számú protont (rendszám - Z) és különböző számú neutront (N) tartalmaznak; Egy elem


I. Szerves savak és bázisok reszolválása

I. Szerves savak és bázisok reszolválása A pályázat négy éve alatt a munkatervben csak kisebb módosításokra volt szükség, amelyeket a kutatás során folyamatosan nyert tapasztalatok indokoltak. Az alábbiakban a szerződés szerinti bontásban foglaljuk



A BIOLÓGIAI JELENSÉGEK FIZIKAI HÁTTERE Zimányi László A BIOLÓGIAI JELENSÉGEK FIZIKAI HÁTTERE Zimányi László Összefoglalás A négy alapvető fizikai kölcsönhatás közül az elektromágneses kölcsönhatásnak van fontos szerepe a biológiában. Atomi és molekuláris


3/3.5. Műanyag-feldolgozás munkavédelmi kérdései

3/3.5. Műanyag-feldolgozás munkavédelmi kérdései 3/3.5. A műanyag termékek alkalmazása, felhasználása az elmúlt évtizedekben rohamosan fejlődött. Kedvező tulajdonságaik alapján az élet szinte minden területén alkalmazhatók, az iparban pl. maró anyagok


Heterociklusos vegyületek

Heterociklusos vegyületek Szerves kémia A gyűrű felépítésében más atom (szénatomon kívül!), ún. HETEROATOM is részt vesz. A gyűrűt alkotó heteroatomként leggyakrabban a nitrogén, oxigén, kén szerepel, (de ismerünk arzént, szilíciumot,


Az elektron hullámtermészete. Készítette Kiss László

Az elektron hullámtermészete. Készítette Kiss László Az elektron hullámtermészete Készítette Kiss László Az elektron részecske jellemzői Az elektront Joseph John Thomson fedezte fel 1897-ben. 1906-ban Nobel díj! Az elektronoknak, az elektromos és mágneses


Egzotikus elektromágneses jelenségek alacsony hőmérsékleten Mihály György BME Fizikai Intézet Hall effektus Edwin Hall és az összenyomhatatlan elektromosság Kvantum Hall effektus Mágneses áram anomális


SALGÓTARJÁNI MADÁCH IMRE GIMNÁZIUM 3100 Salgótarján, Arany János út 12. Pedagógiai program. Kémia tantárgy kerettanterve

SALGÓTARJÁNI MADÁCH IMRE GIMNÁZIUM 3100 Salgótarján, Arany János út 12. Pedagógiai program. Kémia tantárgy kerettanterve SALGÓTARJÁNI MADÁCH IMRE GIMNÁZIUM 3100 Salgótarján, Arany János út 12. Pedagógiai program Kémia tantárgy kerettanterve KÉMIA HELYI TANTERV A kémia tantárgy teljes óraterve 9. osztály 10. osztály Heti


Az anyagi rendszerek csoportosítása

Az anyagi rendszerek csoportosítása Általános és szervetlen kémia 1. hét A kémia az anyagok tulajdonságainak leírásával, átalakulásaival, elıállításának lehetıségeivel és felhasználásával foglalkozik. Az általános kémia vizsgálja az anyagi


Atomok. szilárd. elsődleges kölcsönhatás. kovalens ionos fémes. gázok, folyadékok, szilárd anyagok. ionos fémek vegyületek ötvözetek

Atomok. szilárd. elsődleges kölcsönhatás. kovalens ionos fémes. gázok, folyadékok, szilárd anyagok. ionos fémek vegyületek ötvözetek Atomok elsődleges kölcsönhatás kovalens ionos fémes véges számú atom térhálós szerkezet 3D ionos fémek vegyületek ötvözetek molekulák atomrácsos vegyületek szilárd gázok, folyadékok, szilárd anyagok Gázok


Cikloalkánok és származékaik konformációja

Cikloalkánok és származékaik konformációja 1 ikloalkánok és származékaik konformációja telített gyűrűs szénhidrogének legegyszerűbb képviselője a ciklopropán. Gyűrűje szabályos háromszög alakú, ennek megfelelően szénatomjai egy síkban helyezkednek


Abszorpciós fotometria

Abszorpciós fotometria abszorpció Abszorpciós fotometria Spektroszkópia - Színképvizsgálat Spektro-: görög; jelente kép/szín -szkópia: görög; néz/látás/vizsgálat Ujfalusi Zoltán PTE ÁOK Biofizikai Intézet 2012. február Vizsgálatok


BIOLÓGIA 7-8. évfolyam. A tantárgy heti óraszáma A tantárgy éves óraszáma 7. évfolyam 2 óra 72 óra 8. évfolyam 1,5 óra 54 óra. 7.

BIOLÓGIA 7-8. évfolyam. A tantárgy heti óraszáma A tantárgy éves óraszáma 7. évfolyam 2 óra 72 óra 8. évfolyam 1,5 óra 54 óra. 7. BIOLÓGIA 7-8. évfolyam Heti és éves óraterv: A tantárgy heti óraszáma A tantárgy éves óraszáma 7. évfolyam 2 óra 72 óra 8. évfolyam 1,5 óra 54 óra 7. évfolyam A tematikai egységek áttekintő táblázata Tematikai


Bevezetés az anyagtudományba III. előadás

Bevezetés az anyagtudományba III. előadás Bevezetés az anyagtudományba III. előadás 2010. február 18. Kristályos és s nem-krist kristályos anyagok A kristályos anyag atomjainak elrendeződése sok atomnyi távolságig, a tér mindhárom irányában periodikusan


Modern Fizika Labor. Fizika BSc. Értékelés: A mérés dátuma: A mérés száma és címe: 13. mérés: Molekulamodellezés PC-n. 2008. április 29.

Modern Fizika Labor. Fizika BSc. Értékelés: A mérés dátuma: A mérés száma és címe: 13. mérés: Molekulamodellezés PC-n. 2008. április 29. Modern Fizika Labor Fizika BSc A mérés dátuma: A mérés száma és címe: 13. mérés: Molekulamodellezés PC-n Értékelés: A beadás dátuma: 2008. május 6. A mérést végezte: 1/5 A mérés célja A mérés célja az


KÉMIA. Kémia a gimnáziumok 9 10. évfolyama számára

KÉMIA. Kémia a gimnáziumok 9 10. évfolyama számára KÉMIA Kémia a gimnáziumok 9 10. évfolyama számára A kémia tanításának célja és feladatai Az iskolai tanulmányok célja a gyakorlatban hasznosítható ismeretek megszerzése, valamint az általános képességek


FIZIKA. Sugárzunk az elégedettségtől! (Atomfizika) Dr. Seres István

FIZIKA. Sugárzunk az elégedettségtől! (Atomfizika) Dr. Seres István Sugárzunk az elégedettségtől! () Dr. Seres István atommagfizika Atommodellek 440 IE Democritus, Leucippus, Epicurus 1803 1897 John Dalton J.J. Thomson 1911 Ernest Rutherford 19 Niels Bohr 3 Atommodellek


Ragyogó molekulák: dióhéjban a fluoreszcenciáról és biológiai alkalmazásairól

Ragyogó molekulák: dióhéjban a fluoreszcenciáról és biológiai alkalmazásairól Ragyogó molekulák: dióhéjban a fluoreszcenciáról és biológiai alkalmazásairól Kele Péter egyetemi adjunktus Lumineszcencia jelenségek Biolumineszcencia (biológiai folyamat, pl. luciferin-luciferáz) Kemilumineszcencia


A szilárd testek alakja és térfogata észrevehetően csak nagy erő hatására változik meg. A testekben a részecskék egymáshoz közel vannak, kristályos

A szilárd testek alakja és térfogata észrevehetően csak nagy erő hatására változik meg. A testekben a részecskék egymáshoz közel vannak, kristályos Az anyagok lehetséges állapotai, a fizikai körülményektől (nyomás, hőmérséklet) függően. Az anyagokat általában a normál körülmények között jellemző állapotuk alapján soroljuk be szilád, folyékony vagy


A periódusos rendszer, periodikus tulajdonságok

A periódusos rendszer, periodikus tulajdonságok A periódusos rendszer, periodikus tulajdonságok Szalai István ELTE Kémiai Intézet 1/45 Az előadás vázlata ˆ Ismétlés ˆ Történeti áttekintés ˆ Mengyelejev periódusos rendszere ˆ Atomsugár, ionsugár ˆ Ionizációs


Reál osztály. Kémia a gimnáziumok 9 11. évfolyama számára. B változat

Reál osztály. Kémia a gimnáziumok 9 11. évfolyama számára. B változat Reál osztály Kémia a gimnáziumok 9 11. évfolyama számára B változat A kémia tanításának célja és feladatai Az iskolai tanulmányok célja a gyakorlatban hasznosítható ismeretek megszerzése, valamint az általános


Az élő anyag szerkezeti egységei: víz, nukleinsavak, fehérjék. elrendeződés, rend, rendszer, periodikus ismétlődés

Az élő anyag szerkezeti egységei: víz, nukleinsavak, fehérjék. elrendeződés, rend, rendszer, periodikus ismétlődés Az élő anyag szerkezeti egységei: víz, nukleinsavak, fehérjék Agócs Gergely 2013. december 3. kedd 10:00 11:40 1. Mit értünk élő anyag alatt? Az élő szervezetet felépítő anyagok. Az anyag azonban nem csupán


Károlyi Mihály Két Tanítási Nyelvű Közgazdasági Szakközépiskola Kémia Helyi Tanterv. A Károlyi Mihály Két Tanítási Nyelvű Közgazdasági Szakközépiskola

Károlyi Mihály Két Tanítási Nyelvű Közgazdasági Szakközépiskola Kémia Helyi Tanterv. A Károlyi Mihály Két Tanítási Nyelvű Közgazdasági Szakközépiskola A Károlyi Mihály Két Tanítási Nyelvű Közgazdasági Szakközépiskola KÉMIA HELYI TANTERVE a 9. évfolyam számára két tanítási nyelvű osztály közgazdaság ágazaton Készítette: Kaposi Anna, kémia szaktanár Készült:


1. SI mértékegységrendszer

1. SI mértékegységrendszer I. ALAPFOGALMAK 1. SI mértékegységrendszer Alapegységek 1 Hosszúság (l): méter (m) 2 Tömeg (m): kilogramm (kg) 3 Idő (t): másodperc (s) 4 Áramerősség (I): amper (A) 5 Hőmérséklet (T): kelvin (K) 6 Anyagmennyiség


Modern Fizika Labor Fizika BSC

Modern Fizika Labor Fizika BSC Modern Fizika Labor Fizika BSC A mérés dátuma: 2009. május 4. A mérés száma és címe: 9. Röntgen-fluoreszencia analízis Értékelés: A beadás dátuma: 2009. május 13. A mérést végezte: Márton Krisztina Zsigmond


Ph 11 1. 2. Mozgás mágneses térben

Ph 11 1. 2. Mozgás mágneses térben Bajor fizika érettségi feladatok (Tervezet G8 2011-től) Munkaidő: 180 perc (A vizsgázónak két, a szakbizottság által kiválasztott feladatsort kell kidolgoznia. A két feladatsor nem származhat azonos témakörből.)


A projekt rövidítve: NANOSTER A projekt idıtartama: 2009. október 2012. december

A projekt rövidítve: NANOSTER A projekt idıtartama: 2009. október 2012. december A projekt címe: Egészségre ártalmatlan sterilizáló rendszer kifejlesztése A projekt rövidítve: NANOSTER A projekt idıtartama: 2009. október 2012. december A konzorcium vezetıje: A konzorcium tagjai: A


Sztereokémia, királis molekulák: (királis univerzum, tükörképi világ?) memo: a földi élet királis elemek sokasága!

Sztereokémia, királis molekulák: (királis univerzum, tükörképi világ?) memo: a földi élet királis elemek sokasága! Sztereokémia, királis molekulák: (királis univerzum, tükörképi világ?) memo: a földi élet királis elemek sokasága! (pl. a földön az L-aminosavak vannak túlnyomó többségben. - Az enantiomer szelekció, módját


dinamikai tulajdonságai

dinamikai tulajdonságai Szilárdtest rácsok statikus és dinamikai tulajdonságai Szilárdtestek osztályozása kötéstípusok szerint Kötések eredete: elektronszerkezet k t ionok (atomtörzsek) tö Coulomb- elektronok kölcsönhatás lokalizáltak


Kémia. Tantárgyi programjai és követelményei A/2. változat

Kémia. Tantárgyi programjai és követelményei A/2. változat 5. sz. melléklet Kémia Tantárgyi programjai és követelményei A/2. változat Az 51/2012. (XII. 21.) számú EMMI rendelethez a 6/2014. (I.29.) EMMI rendelet 3. mellékleteként kiadott és a 34/2014 (IV. 29)


Fejlesztendő területek, kompetenciák:

Fejlesztendő területek, kompetenciák: KÉMIA A tanterv célja annak elérése, hogy középiskolai tanulmányainak befejezésekor minden tanuló birtokában legyen a kémiai alapműveltségnek, ami a természettudományos alapműveltség része. Ezért szükséges,


Modern fizika vegyes tesztek

Modern fizika vegyes tesztek Modern fizika vegyes tesztek 1. Egy fotonnak és egy elektronnak ugyanakkora a hullámhossza. Melyik a helyes állítás? a) A foton lendülete (impulzusa) kisebb, mint az elektroné. b) A fotonnak és az elektronnak





ELTE Fizikai Intézet. FEI Quanta 3D FEG kétsugaras pásztázó elektronmikroszkóp

ELTE Fizikai Intézet. FEI Quanta 3D FEG kétsugaras pásztázó elektronmikroszkóp ELTE Fizikai Intézet FEI Quanta 3D FEG kétsugaras pásztázó elektronmikroszkóp mintatartó mikroszkóp nyitott ajtóval Fő egységek 1. Elektron forrás 10-7 Pa 2. Mágneses lencsék 10-5 Pa 3. Pásztázó mágnesek


Kémiai biológia avagy mit nyújt(hat) a kémia az élettudományoknak

Kémiai biológia avagy mit nyújt(hat) a kémia az élettudományoknak A Magyar Tudomány Ünnepe 2007 Kémiai biológia avagy mit nyújt(hat) a kémia az élettudományoknak Tudományos ülésszak A Debreceni Egyetem Természettudományi Karának Kémiai Intézete és A Debreceni Akadémiai


ALKÍMIA MA Az anyagról mai szemmel, a régiek megszállottságával. www.chem.elte.hu/pr

ALKÍMIA MA Az anyagról mai szemmel, a régiek megszállottságával. www.chem.elte.hu/pr ALKÍMIA MA Az anyagról mai szemmel, a régiek megszállottságával www.chem.elte.hu/pr Kvíz az előző előadáshoz Programajánlatok február 5. 16:00 ELTE Kémiai Intézet 065-ös terem Észbontogató (www.chem.elte.hu/pr)


Szilárd anyagok. Műszaki kémia, Anyagtan I. 7. előadás. Dolgosné dr. Kovács Anita egy.doc. PTE MIK Környezetmérnöki Tanszék

Szilárd anyagok. Műszaki kémia, Anyagtan I. 7. előadás. Dolgosné dr. Kovács Anita egy.doc. PTE MIK Környezetmérnöki Tanszék Szilárd anyagok Műszaki kémia, Anyagtan I. 7. előadás Dolgosné dr. Kovács Anita egy.doc. PTE MIK Környezetmérnöki Tanszék Szilárd anyagok felosztása Szilárd anyagok Kristályos szerkezetűek Üvegszerű anyagok



A RÖNTGENSUGÁRZÁS HATÁSA HÉTKÖZNAPJAINKRA A RÖNTGENSUGÁRZÁS HATÁSA HÉTKÖZNAPJAINKRA Faigel Gyula MTA Szilárdtestfizikai és Optikai Kutató Intézet 1. ábra. Példa atomok kristályrácsba történô rendezôdésére. Az atomok a kockák csúcsaiban helyezkednek


Koherens lézerspektroszkópia adalékolt optikai egykristályokban

Koherens lézerspektroszkópia adalékolt optikai egykristályokban Koherens lézerspektroszkópia adalékolt optikai egykristályokban Kis Zsolt MTA Wigner Fizikai Kutatóközpont H-1121 Budapest, Konkoly-Thege Miklós út 29-33 2015. június 8. Hogyan nyerjünk információt egyes


Modern fizika laboratórium

Modern fizika laboratórium Modern fizika laboratórium Röntgen-fluoreszcencia analízis Készítette: Básti József és Hagymási Imre 1. Bevezetés A röntgen-fluoreszcencia analízis (RFA) egy roncsolásmentes anyagvizsgálati módszer. Rövid
