ETSI ES V1.2.1 ( )
|
|
- Péter Gál
- 6 évvel ezelőtt
- Látták:
Átírás
1 Standard Open Service Access (OSA); Parlay X Web Services; Part 2: Third Party Call (Parlay X 2)
2 2 Reference RES/TISPAN OSA Keywords API, OSA, service 650 Route des Lucioles F Sophia Antipolis Cedex - FRANCE Tel.: Fax: Siret N NAF 742 C Association à but non lucratif enregistrée à la Sous-Préfecture de Grasse (06) N 7803/88 Important notice Individual copies of the present document can be downloaded from: The present document may be made available in more than one electronic version or in print. In any case of existing or perceived difference in contents between such versions, the reference version is the Portable Document Format (PDF). In case of dispute, the reference shall be the printing on printers of the PDF version kept on a specific network drive within Secretariat. Users of the present document should be aware that the document may be subject to revision or change of status. Information on the current status of this and other documents is available at If you find errors in the present document, please send your comment to one of the following services: Copyright Notification No part may be reproduced except as authorized by written permission. The copyright and the foregoing restriction extend to reproduction in all media. European Telecommunications Standards Institute The Parlay Group All rights reserved. DECT TM, PLUGTESTS TM and UMTS TM are Trade Marks of registered for the benefit of its Members. TIPHON TM and the TIPHON logo are Trade Marks currently being registered by for the benefit of its Members. 3GPP TM is a Trade Mark of registered for the benefit of its Members and of the 3GPP Organizational Partners.
3 3 Contents Intellectual Property Rights...4 Foreword Scope References Definitions and abbreviations Definitions Abbreviations Detailed service description Namespaces Sequence diagrams "Click to Dial" call setup XML Schema data type definition CallStatus enumeration CallTerminationCause enumeration CallInformation Structure Web Service interface definition Interface: ThirdPartyCall Operation: makecall Input message: makecallrequest Output message : makecallresponse Referenced faults Operation: getcallinformation Input message: getcallinformationrequest Output message : getcallinformationresponse Referenced faults Operation: endcall Input message: endcallrequest Output message: endcallresponse Referenced faults Operation: cancelcall Input message: cancelcallrequest Output message: cancelcallresponse Referenced faults Fault definitions ServiceException SVC0260: Call already connected SVC0261: Call already terminated Service policies...11 Annex A (normative): WSDL for Third Party Call...12 Annex B (informative): Bibliography...13 History...14
4 4 Intellectual Property Rights IPRs essential or potentially essential to the present document may have been declared to. The information pertaining to these essential IPRs, if any, is publicly available for members and non-members, and can be found in SR : "Intellectual Property Rights (IPRs); Essential, or potentially Essential, IPRs notified to in respect of standards", which is available from the Secretariat. Latest updates are available on the Web server ( Pursuant to the IPR Policy, no investigation, including IPR searches, has been carried out by. No guarantee can be given as to the existence of other IPRs not referenced in SR (or the updates on the Web server) which are, or may be, or may become, essential to the present document. Foreword This Standard (ES) has been produced by Technical Committee Telecommunications and Internet converged Services and Protocols for Advanced Networking (TISPAN). The present document is part 2 of a multi-part deliverable covering Open Service Access (OSA); Parlay X Web Services, as identified below: Part 1: Part 2: Part 3: Part 4: Part 5: Part 6: Part 7: Part 8: Part 9: Part 10: Part 11: Part 12: Part 13: Part 14: "Common"; "Third Party Call"; "Call Notification"; "Short Messaging"; "Multimedia Messaging"; "Payment"; "Account Management"; "Terminal Status"; "Terminal Location"; "Call Handling"; "Audio Call"; "Multimedia Conference"; "Address List Management"; "Presence". The present document has been defined jointly between, The Parlay Group ( and the 3GPP. The present document forms part of the Parlay X 2.1 set of specifications. The present document is equivalent to 3GPP TS V6.3.0 (Release 6).
5 5 1 Scope The present document is part 2 of the Stage 3 Parlay X 2 Web Services specification for Open Service Access (OSA). The OSA specifications define an architecture that enables application developers to make use of network functionality through an open standardized interface, i.e. the OSA APIs. The present document specifies the Third Party Call Web Service. The following are defined here: Name spaces. Sequence diagrams. Data definitions. Interface specification plus detailed method descriptions. Fault definitions. Service Policies. WSDL Description of the interfaces. 2 References The following documents contain provisions which, through reference in this text, constitute provisions of the present document. References are either specific (identified by date of publication and/or edition number or version number) or non-specific. For a specific reference, subsequent revisions do not apply. For a non-specific reference, the latest version applies. Referenced documents which are not found to be publicly available in the expected location might be found at NOTE: While any hyperlinks included in this clause were valid at the time of publication cannot guarantee their long term validity. [1] W3C Recommendation (2 May 2001): "XML Schema Part 2: Datatypes". NOTE: Available at: [2] ES : "Open Service Access (OSA); Parlay X Web Services; Part 1: Common (Parlay X 2)". 3 Definitions and abbreviations 3.1 Definitions For the purposes of the present document, the terms and definitions given in ES [2] apply. 3.2 Abbreviations For the purposes of the present document, the abbreviations given in ES [2] apply.
6 6 4 Detailed service description Currently, in order to perform a third party call in telecommunication networks we have to write applications using specific protocols to access Call Control functions provided by network elements (specifically operations to initiate a call from applications). This approach requires a high degree of network expertise. We can also use the OSA gateway approach, invoking standard interfaces to gain access to call control capabilities, but these interfaces are usually perceived to be quite complex by application IT developers. Developers must have advanced telecommunication skills to use Call Control OSA interfaces. In this clause we describe a Parlay X 2 Web Service, Third Party Call, for creating and managing a call initiated by an application (third party call). The overall scope of this Web Service is to provide functions to application developers to create a call in a simple way. Using the Third Party Call Web Service, application developers can invoke call handling functions without detailed telecommunication knowledge. Figure 1 shows a scenario using the Third Party Call Web Service to handle third party call functions. The application invokes a Web Service to retrieve stock quotes and a Parlay X 2 Interface to initiate a third party call between a broker and his client. In the scenario, whenever a particular stock quote reaches a threshold value (1) and (2), the client application invokes a third party call between one or more brokers and their corresponding customers to decide actions to be taken. After invocation (3) by the application, the Third Party Call Web Service invokes a Parlay API method (4) using the Parlay/OSA SCS-CC (Call control) interface. This SCS handles the invocation and sends a message (5) to an MSC to set-up a call between user A and user B. In an alternative scenario, the Parlay API interaction involving steps (4) and (5) could be replaced with a direct interaction between the Third Party Call Web Service and the Mobile network. Stock Stock Quotes Quotes Web Web Service Service Third Party Call Web 3PC-X Service component Parlay X I/F 4 SCS-CC SCS-CC 1 Parlay API 5 Parlay Gateway 3 User profile 2.. getstockquote().. Retrieve user Profile ( usera, userb). makeacall (usera, userb,,) Mobile network MSC MSC UserB (customer) UserA (broker) Figure 1: Third party call scenario 5 Namespaces The ThirdPartyCall interface uses the namespace: The data types are defined in the namespace:
7 7 The "xsd" namespace is used in the present document to refer to the XML Schema data types defined in XML Schema [1]. The use of the name "xsd" is not semantically significant. 6 Sequence diagrams 6.1 "Click to Dial" call setup A common convergence application is Click to Dial, where a self service portal provides a web page that can initiate a call between two phones. This sequence shows a basic call setup, and ending the call through the portal. : End User : Self Serve Portal : Third Party Call Web Service Access portal Use Click to Dial page Make call Call identifier Report call in progress Some discussion Click on end call End call Figure 2
8 8 7 XML Schema data type definition 7.1 CallStatus enumeration List of call status values. Enumeration value CallInitial CallConnected CallTerminated Description The call is being established The call is active The call was terminated 7.2 CallTerminationCause enumeration List of call termination cause values. Enumeration value CallingPartyNoAnswer CalledPartyNoAnswer CallingPartyBusy CalledPartyBusy CallingPartyNotReachable CalledPartyNotReachable CallHangUp CallAborted Description Calling Party did not answer Called Party did not answer Calling Party was busy Called Party was busy Calling Party was not reachable Called Party was not reachable The call was terminated by either party hanging up The call was aborted (any other termination cause) 7.3 CallInformation Structure Call information for this call. Element name Element type Optional Description callstatus CallStatus No It indicates the current status of the call (see possible values below) starttime xsd:datetime Yes When applicable (callstatus <> CallInitial), it indicates the time of the beginning of the call duration xsd:int Yes When applicable (callstatus = CallTerminated), it indicates the duration of the call expressed in seconds terminationcause CallTerminationCause Yes When applicable (callstatus = CallTerminated), it indicates the cause of the termination of the call 8 Web Service interface definition 8.1 Interface: ThirdPartyCall This interface provides the ability to setup, end and determine the status of a call Operation: makecall The invocation of makecall requests to set-up a voice call between two addresses, callingparty and calledparty, provided that the invoking application is allowed to connect them. Optionally the application can also indicate the charging information (charging).
9 9 By invoking this operation the application may monitor the status of the requested call. The returned parameter, callidentifier, can be used to identify the call. In order to receive the information on call status the application has to explicitly invoke getcallinformation Input message: makecallrequest callingparty xsd:anyuri No It contains the address of the first user involved in the call calledparty xsd:anyuri No It contains the address of the second user involved in the call charging common:charginginformation Yes Charge to apply to the call Output message : makecallresponse result xsd:string No It identifies a specific call request Referenced faults ServiceException from ES [2]: SVC Service error. SVC Invalid input value. PolicyException from ES [2]: POL Policy error. POL Charging not supported Operation: getcallinformation The invocation of getcallinformation retrieves the current status, callinformation, of the call identified by CallIdentifier. This method can be invoked multiple times by the application even if the call has already ended. However, after the call has ended, status information will be available only for a limited period of time that is specified in the service policy "StatusRetentionTime" Input message: getcallinformationrequest callidentifier xsd:string No It identifies a specific call request Output message : getcallinformationresponse result CallInformation No It identifies the status of the call Referenced faults ServiceException from ES [2]: SVC Service error. SVC Invalid input value.
10 10 PolicyException from ES [2]: POL Policy error Operation: endcall The invocation of endcall terminates the call identified by callidentifier. If the call is still in the initial state this method has the same effect as the cancelcall operation Input message: endcallrequest callidentifier xsd:string No It identifies a specific call request Output message: endcallresponse None Referenced faults ServiceException from ES [2]: SVC Service error. SVC Invalid input value. SVC Call already terminated. PolicyException from ES [2]: POL Policy error Operation: cancelcall The invocation of cancelcall cancels the previously requested call identified by callidentifier. Note that this method differs from the endcall operation since it only attempts to prevent the call from starting but it does not have any effect if the call has already started Input message: cancelcallrequest callidentifier xsd:string No It identifies a specific call request Output message: cancelcallresponse None
11 Referenced faults ServiceException from ES [2]: SVC Service error. SVC Invalid input value. SVC Call already connected. PolicyException from ES [2]: POL Policy error. 9 Fault definitions The following faults are defined for this service. 9.1 ServiceException SVC0260: Call already connected Part name messageid text variables Description SVC0260 Call has already been connected, it cannot be cancelled None SVC0261: Call already terminated Part name messageid text variables SVC0261 Call has already been terminated None Description 10 Service policies These service policies are defined for the Third Party Call service. Name Type Description ChargingAllowed xsd:boolean Is charging allowed for makecall operation StatusRetentionTime xsd:int Length of time, in seconds, to retain status after the termination of the call
12 12 Annex A (normative): WSDL for Third Party Call The document/literal WSDL representation of this interface specification is compliant to ES [2] and is contained in text files (contained in archive es_ v010201p0.zip) which accompany the present document.
13 13 Annex B (informative): Bibliography TR : "Digital cellular telecommunications system (Phase 2+); Universal Mobile Telecommunications System (UMTS); Vocabulary for 3GPP Specifications (3GPP TR )".
14 14 History Document history V1.1.1 March 2005 Publication V1.2.1 October 2006 Membership Approval Procedure MV : to V1.2.1 December 2006 Publication
Final draft ETSI ES V1.1.1 ( )
Standard Open Service Access (OSA); Parlay X Web Services; Part 11: Audio Call 2 Reference DES/TISPAN-01007-11-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis Cedex - FRANCE
ETSI ES V1.3.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 11: Audio Call (Parlay X 2)
Standard Open Service Access (OSA); Parlay X Web Services; Part 11: Audio Call (Parlay X 2) 2 Reference RES/TISPAN-01056-11-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
ETSI ES V1.2.1 ( )
Standard Open Service Access (OSA); Parlay X Web Services; Part 10: Call Handling (Parlay X 2) 2 Reference RES/TISPAN-01033-10-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
ETSI ES V1.1.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 8: Terminal Status (Parlay X 3)
Standard Open Service Access (OSA); Parlay X Web Services; Part 8: Terminal Status (Parlay X 3) 2 Reference DES/TISPAN-01034-8-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
ETSI ES V1.1.1 ( )
Standard Open Service Access (OSA); Parlay X Web Services; Part 5: Multimedia Messaging 2 Reference DES/TISPAN-01007-05-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis Cedex
ETSI ES V1.3.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 7: Account Management (Parlay X 2)
Standard Open Service Access (OSA); Parlay X Web Services; Part 7: Account Management (Parlay X 2) 2 Reference RES/TISPAN-01056-07-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
ETSI ES V1.3.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 13: Address List Management (Parlay X 2)
Standard Open Service Access (OSA); Parlay X Web Services; Part 13: Address List Management (Parlay X 2) 2 Reference RES/TISPAN-01056-13-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia
ETSI ES V1.1.1 ( )
Standard Open Service Access (OSA); Parlay X Web Services; Part 13: Address List Management 2 Reference DES/TISPAN-01007-13-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
ETSI ES V1.2.1 ( )
Standard Open Service Access (OSA); Parlay X Web Services; Part 5: Multimedia Messaging (Parlay X 2) 2 Reference RES/TISPAN-01033-05-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia
ETSI ES V1.1.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 16: Geocoding (Parlay X 3)
Standard Open Service Access (OSA); Parlay X Web Services; Part 16: Geocoding (Parlay X 3) 2 Reference DES/TISPAN-01034-16-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
ETSI ES V1.1.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 3: Call Notification (Parlay X 3)
Standard Open Service Access (OSA); Parlay X Web Services; Part 3: Call Notification (Parlay X 3) 2 Reference DES/TISPAN-01034-3-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
ETSI ES V1.1.1 ( )
Standard Open Service Access (OSA); Parlay X Web Services; Part 6: Payment 2 Reference DES/TISPAN-01007-06-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis Cedex - FRANCE
ETSI ES V1.3.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 5: Multimedia Messaging (Parlay X 2)
Standard Open Service Access (OSA); Parlay X Web Services; Part 5: Multimedia Messaging (Parlay X 2) 2 Reference RES/TISPAN-01056-05-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia
ETSI ES V1.2.1 ( )
Standard Open Service Access (OSA); Parlay X Web Services; Part 6: Payment (Parlay X 2) 2 Reference RES/TISPAN-01033-06-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis Cedex
ETSI ES V1.1.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 4: Short Messaging (Parlay X 3)
Standard Open Service Access (OSA); Parlay X Web Services; Part 4: Short Messaging (Parlay X 3) 2 Reference DES/TISPAN-01034-4-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
ETSI ES V1.1.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 15: Message Broadcast (Parlay X 3)
Standard Open Service Access (OSA); Parlay X Web Services; Part 15: Message Broadcast (Parlay X 3) 2 Reference DES/TISPAN-01034-15-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
EN United in diversity EN A8-0206/419. Amendment
22.3.2019 A8-0206/419 419 Article 2 paragraph 4 point a point i (i) the identity of the road transport operator; (i) the identity of the road transport operator by means of its intra-community tax identification
Using the CW-Net in a user defined IP network
Using the CW-Net in a user defined IP network Data transmission and device control through IP platform CW-Net Basically, CableWorld's CW-Net operates in the 10.123.13.xxx IP address range. User Defined
ETSI ES V1.3.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 1: Common (Parlay X 2)
Standard Open Service Access (OSA); Parlay X Web Services; Part 1: Common (Parlay X 2) 2 Reference RES/TISPAN-01056-01-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis Cedex
USER MANUAL Guest user
USER MANUAL Guest user 1 Welcome in Kutatótér (Researchroom) Top menu 1. Click on it and the left side menu will pop up 2. With the slider you can make left side menu visible 3. Font side: enlarging font
BKI13ATEX0030/1 EK-Típus Vizsgálati Tanúsítvány/ EC-Type Examination Certificate 1. kiegészítés / Amendment 1 MSZ EN 60079-31:2014
(1) EK-TípusVizsgálati Tanúsítvány (2) A potenciálisan robbanásveszélyes környezetben történő alkalmazásra szánt berendezések, védelmi rendszerek 94/9/EK Direktíva / Equipment or Protective Systems Intended
Számlakezelés az ELO DocXtraktor modullal
ELOECMSzakmai Kongresszus2013 Számlakezelés az ELO DocXtraktor modullal Kovács Eszter Kovacs.eszter@pentatrade.hu Projekt bemutatása A Cég Cégcsoport Éves árbevétel 140 mrd FT > 5 500 dolgozó ( 1 000 fı
ETSI ES V1.1.1 ( )
Standard Open Service Access (OSA); Parlay X Web Services; Part 1: Common 2 Reference DES/TISPAN-01007-01-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis Cedex - FRANCE Tel.:
Széchenyi István Egyetem www.sze.hu/~herno
Oldal: 1/6 A feladat során megismerkedünk a C# és a LabVIEW összekapcsolásának egy lehetőségével, pontosabban nagyon egyszerű C#- ban írt kódból fordítunk DLL-t, amit meghívunk LabVIEW-ból. Az eljárás
Lexington Public Schools 146 Maple Street Lexington, Massachusetts 02420
146 Maple Street Lexington, Massachusetts 02420 Surplus Printing Equipment For Sale Key Dates/Times: Item Date Time Location Release of Bid 10/23/2014 11:00 a.m. http://lps.lexingtonma.org (under Quick
Proxer 7 Manager szoftver felhasználói leírás
Proxer 7 Manager szoftver felhasználói leírás A program az induláskor elkezdi keresni az eszközöket. Ha van olyan eszköz, amely virtuális billentyűzetként van beállítva, akkor azokat is kijelzi. Azokkal
Utasítások. Üzembe helyezés
HASZNÁLATI ÚTMUTATÓ Üzembe helyezés Utasítások Windows XP / Vista / Windows 7 / Windows 8 rendszerben történő telepítéshez 1 Töltse le az AORUS makróalkalmazás telepítőjét az AORUS hivatalos webhelyéről.
PIACI HIRDETMÉNY / MARKET NOTICE
PIACI HIRDETMÉNY / MARKET NOTICE HUPX DAM Másnapi Aukció / HUPX DAM Day-Ahead Auction Iktatási szám / Notice #: Dátum / Of: 18/11/2014 HUPX-MN-DAM-2014-0023 Tárgy / Subject: Változások a HUPX másnapi piac
Cashback 2015 Deposit Promotion teljes szabályzat
Cashback 2015 Deposit Promotion teljes szabályzat 1. Definitions 1. Definíciók: a) Account Client s trading account or any other accounts and/or registers maintained for Számla Az ügyfél kereskedési számlája
ELOECMSzakmai Kongresszus2013
ELOECMSzakmai Kongresszus2013 Keynote Horváth Szilvia Ügyvezető s.horvath@elo.com Cégünk rövid bemutatása 1871 Louis Leitz megalapítja első vállalatát 1995 Az első elektronikus Leitz dokumentumkezelő (ELOoffice)
ELO Digital Office ERP integráció
ELO Digital Office ERP integráció Lázár Péter ECM Business Unit Manager peter.lazar@itelligence.hu Enterprise Content Management www.elo.com Miért kell ERP integráció? Hozzáféréseket szabályozni és auditálni
ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP
ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP CHILD S DATA / GYERMEK ADATAI PLEASE FILL IN THIS INFORMATION WITH DATA BASED ON OFFICIAL DOCUMENTS / KÉRJÜK, TÖLTSE KI A HIVATALOS DOKUMENTUMOKBAN SZEREPLŐ ADATOK
Új funkciók az RBP-ben 2015. október 1-től New functions in RBP from 1 October 2015. Tatár Balázs
Új funkciók az RBP-ben 2015. október 1-től New functions in RBP from 1 October 2015 Tatár Balázs Üzletfejlesztés vezető / Business Development Manager Rendszerhasználói Tájékoztató Nap, 2015. szeptember
Könnyen bevezethető ITIL alapú megoldások a Novell ZENworks segítségével. Hargitai Zsolt Sales Support Manager Novell Hungary
Könnyen bevezethető ITIL alapú megoldások a Novell ZENworks segítségével Hargitai Zsolt Sales Support Manager Novell Hungary Napirend ITIL rövid áttekintés ITIL komponensek megvalósítása ZENworks segítségével
Cloud computing. Cloud computing. Dr. Bakonyi Péter.
Cloud computing Cloud computing Dr. Bakonyi Péter. 1/24/2011 1/24/2011 Cloud computing 2 Cloud definició A cloud vagy felhő egy platform vagy infrastruktúra Az alkalmazások és szolgáltatások végrehajtására
INFORMATION ON COMPLAINT HANDLING
PANASZKEZELÉSI TÁJÉKOZTATÓ Az ACN Communications Hungary Korlátolt Felelősségű Társaság (székhely: 1132 Budapest, Váci út 30, VI emelet; ACN ) az alábbiakban tájékoztatja előfizetőit az ACN által nyújtott
Correlation & Linear Regression in SPSS
Petra Petrovics Correlation & Linear Regression in SPSS 4 th seminar Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Correlation
Nemzetközi vállalat - a vállalati szoftvermegoldások egyik vezető szállítója
Nemzetközi vállalat - a vállalati szoftvermegoldások egyik vezető szállítója A Novell világszerte vezető szerepet tölt be a Linux-alapú és nyílt forráskódú vállalati operációs rendszerek, valamit a vegyes
VoIP (Voice over IP)
VoIP (Voice over IP) Analog Telephone Adapter (ATA) Public Switched Telephone Network (PSTN) Private Branch exchang (PBX) Interactive Voice Response (IVR) Helyi hálózatok tervezése és üzemeltetése 1 Történelem
PIACI HIRDETMÉNY / MARKET NOTICE
PIACI HIRDETMÉNY / MARKET NOTICE HUPX Fizikai Futures (PhF) / HUPX Physical Futures (PhF) Iktatási szám / Notice #: HUPX-MN-PhF-2015-0003 Dátum / Of: 20/04/2015 Tárgy / Subject: Hatályos díjszabás és kedvezmények
Cloud computing Dr. Bakonyi Péter.
Cloud computing Dr. Bakonyi Péter. 1/24/2011 Cloud computing 1/24/2011 Cloud computing 2 Cloud definició A cloud vagy felhő egy platform vagy infrastruktúra Az alkalmazások és szolgáltatások végrehajtására
(NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV
Kommunikációs rendszerek programozása (NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV (5. mérés) SIP telefonközpont készítése Trixbox-szal 1 Mérés helye: Széchenyi István Egyetem, L-1/7 laboratórium, 9026 Győr, Egyetem
ACO burkolható fedlapok. ACO műszaki katalógus ACO Burkolható fedlapok UNIFACE PAVING SOLID
ACO burkolható fedlapok ACO burkolható fedlapok ACO műszaki katalógus ACO Burkolható fedlapok UNIFACE PAVING SOLID ACO gully Tartalom Általános információk 3 page ACO Uniface ACO UNIFACE burkolható fedlap
STUDENT LOGBOOK. 1 week general practice course for the 6 th year medical students SEMMELWEIS EGYETEM. Name of the student:
STUDENT LOGBOOK 1 week general practice course for the 6 th year medical students Name of the student: Dates of the practice course: Name of the tutor: Address of the family practice: Tel: Please read
Megfelelés az új iratkezelési rendeletnek az ELOik modullal
Megfelelés az új iratkezelési rendeletnek az ELOik modullal Dezsényi Csaba csaba.dezsenyi@ovitas.hu Mindenki nyugodjon meg! Az meg fog felelni az új jogszabályoknak! 2 Mit jelent? Felülvizsgálat Szerelés
Eladni könnyedén? Oracle Sales Cloud. Horváth Tünde Principal Sales Consultant 2014. március 23.
Eladni könnyedén? Oracle Sales Cloud Horváth Tünde Principal Sales Consultant 2014. március 23. Oracle Confidential Internal/Restricted/Highly Restricted Safe Harbor Statement The following is intended
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2008. május 26. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2008. május 26. 8:00 Az írásbeli vizsga időtartama: 180 perc Pótlapok száma Tisztázati Piszkozati OKTATÁSI
Directors and Officers Liability Insurance Questionnaire Adatlap vezetõ tisztségviselõk és felügyelõbizottsági tagok felelõsségbiztosításához
Directors and Officers Liability Insurance Questionnaire Adatlap vezetõ tisztségviselõk és felügyelõbizottsági tagok felelõsségbiztosításához 1. Name, legal form and address of company Társaság neve, címe,
Generációváltás az Alcatel-Lucent OmniPCX Connect termékvonalon. Mészáros tamás Műszaki fejlesztési vezető
Generációváltás az Alcatel-Lucent OmniPCX Connect termékvonalon Mészáros tamás Műszaki fejlesztési vezető OXO - megfelelőség OXO - megfelelőség OXO Connect 2.1 - újdonságok Az Armada 64 új üzemmódja
Megbízási szerződés (KP) Agency Agreement (TP) mely létrejött egyrészről a. concluded by and between
Megbízási szerződés (KP) Agency Agreement (TP) mely létrejött egyrészről a Cégnév: Székhely: Cégjegyzékszám:. Adószám: mint megbízó (továbbiakban: Megbízó) másrészről pedig a concluded by and between Company
PIACI HIRDETMÉNY / MARKET NOTICE
PIACI HIRDETMÉNY / MARKET NOTICE HUPX DAM Másnapi Aukció / HUPX DAM Day-Ahead Auction Iktatási szám / Notice #: HUPX-MN-DAM-2018-0001 Dátum / Of: 26/01/2018 Tárgy / Subject: Hatályos díjszabás és kedvezmények
10. Gyakorlat: Alkalmazások publikálása Remote Desktop Szervízen keresztül
10. Gyakorlat: Alkalmazások publikálása Remote Desktop Szervízen keresztül 10.1. Jogosultságok és csoportok létrehozása 10.2. Az RDS szerver szerepkör telepítése a DC01-es szerverre 10.3. Az RDS01-es szerver
Mapping Sequencing Reads to a Reference Genome
Mapping Sequencing Reads to a Reference Genome High Throughput Sequencing RN Example applications: Sequencing a genome (DN) Sequencing a transcriptome and gene expression studies (RN) ChIP (chromatin immunoprecipitation)
On The Number Of Slim Semimodular Lattices
On The Number Of Slim Semimodular Lattices Gábor Czédli, Tamás Dékány, László Ozsvárt, Nóra Szakács, Balázs Udvari Bolyai Institute, University of Szeged Conference on Universal Algebra and Lattice Theory
PIACI HIRDETMÉNY / MARKET NOTICE
PIACI HIRDETMÉNY / MARKET NOTICE HUPX DAM Másnapi Aukció / HUPX DAM Day-Ahead Auction Iktatási szám / Notice #: HUPX-MN-DAM-2018-0010 Dátum / Of: 12/10/2018 Tárgy / Subject: Hatályos díjszabás és kedvezmények
DANS és Narcis. Burmeister Erzsébet. HUNOR találkozó, Budapest 2013. március 13.
DANS és Narcis Burmeister Erzsébet HUNOR találkozó, Budapest 2013. március 13. DANS DANS (Data Archiving and Network Services) http://www.dans.knaw.nl Kutatási adatok archiválása a saját fejlesztésű EASY
Vállalatirányítási rendszerek
Vállalatirányítási rendszerek Varga Zsigmond Üzletfejlesztési igazgató Budapest, 2015. március 03. Nyilvános Motiváció? 2013 SAP AG. All rights reserved. 2 Adatrögzítés része a fejlődésnek 3 Mestermunkától
A HUEDU OpenLab iskolai alkalmazáscsomag Kovács Lajos
A HUEDU OpenLab iskolai alkalmazáscsomag Kovács Lajos Rendszermérnök kovacs.lajos@npsh.hu A HUEDU program háttere 2 2009: 3 éves megállapodás az NFM és a Novell között --» 2012: keretszerződés meghosszabbítása
This document has been provided by the International Center for Not-for-Profit Law (ICNL).
This document has been provided by the International Center for Not-for-Profit Law (ICNL). ICNL is the leading source for information on the legal environment for civil society and public participation.
Nagyvállalati Linux üzemeltetés Horváth Gábor Kálmán
Nagyvállalati Linux üzemeltetés Horváth Gábor Kálmán vezető tanácsadó gabor.horvath@npsh.hu Szerverek életciklusa Szerver életciklus Telepít Beállít Tesztel Frissít Kivezet 3 Élesít Üzemel Problémák? Tömeges
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Factor Analysis
Factor Analysis Factor analysis is a multiple statistical method, which analyzes the correlation relation between data, and it is for data reduction, dimension reduction and to explore the structure. Aim
Csatlakozás a BME eduroam hálózatához Setting up the BUTE eduroam network
Csatlakozás a BME eduroam hálózatához Setting up the BUTE eduroam network Table of Contents Windows 7... 2 Windows 8... 6 Windows Phone... 11 Android... 12 iphone... 14 Linux (Debian)... 20 Sebők Márton
USA Befektetési Útmutató
USA Befektetési Útmutató COPYRIGHT OPISAS. ALL RIGHTS RESERVED. DISCLAIMER. All prices on this list are subject to change without notice. Whilst we make every effort to provide you the most accurate, up-to-date
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Correlation & Linear. Petra Petrovics.
Correlation & Linear Regression in SPSS Petra Petrovics PhD Student Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise
EN United in diversity EN A8-0206/473. Amendment
21.3.2019 A8-0206/473 473 Recital 12 d (new) (12d) Since there is no sufficient link of a driver with a territory of a Member State of transit, transit operations should not be considered as posting situations.
T Á J É K O Z T A T Ó. A 1108INT számú nyomtatvány a http://www.nav.gov.hu webcímen a Letöltések Nyomtatványkitöltő programok fülön érhető el.
T Á J É K O Z T A T Ó A 1108INT számú nyomtatvány a http://www.nav.gov.hu webcímen a Letöltések Nyomtatványkitöltő programok fülön érhető el. A Nyomtatványkitöltő programok fület választva a megjelenő
Teszt topológia E1/1 E1/0 SW1 E1/0 E1/0 SW3 SW2. Kuris Ferenc - [HUN] Cisco Blog -
VTP Teszt topológia E1/1 E1/0 SW1 E1/0 E1/0 SW2 SW3 2 Alap konfiguráció SW1-2-3 conf t interface e1/0 switchport trunk encapsulation dot1q switchport mode trunk vtp domain CCIE vtp mode transparent vtp
SUSE Success Stories Varga Zsolt
SUSE Success Stories Varga Zsolt operatív igazgató / Novell PSH Varga.zsolt@npsh.hu 2 Nagy forgalmú webes portál infrastruktúra kialakítása (közszféra) Megoldandó feladatok, nehézségek Igen nagy számú
Correlation & Linear Regression in SPSS
Correlation & Linear Regression in SPSS Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise 1 - Correlation File / Open
KELER KSZF Zrt. bankgarancia-befogadási kondíciói. Hatályos: 2014. július 8.
KELER KSZF Zrt. bankgarancia-befogadási kondíciói Hatályos: 2014. július 8. A KELER KSZF a nem-pénzügyi klíringtagjaitól, és az energiapiaci alklíringtagjaitól a KELER KSZF Általános Üzletszabályzata szerinti
Az egészségügyi munkaerő toborzása és megtartása Európában
Az egészségügyi munkaerő toborzása és megtartása Európában Vezetői összefoglaló Európai Egészségügyi Menedzsment Társaság. április Fogyasztó-, Egészség-, Élelmiszerügyi és Mezőgazdasági Végrehajtó Ügynökség
1. Gyakorlat: Telepítés: Windows Server 2008 R2 Enterprise, Core, Windows 7
1. Gyakorlat: Telepítés: Windows Server 2008 R2 Enterprise, Core, Windows 7 1.1. Új virtuális gép és Windows Server 2008 R2 Enterprise alap lemez létrehozása 1.2. A differenciális lemezek és a két új virtuális
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 200. május 4. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 200. május 4. 8:00 Az írásbeli vizsga időtartama: 80 perc Pótlapok száma Tisztázati Piszkozati OKTATÁSI
KOGGM614 JÁRMŰIPARI KUTATÁS ÉS FEJLESZTÉS FOLYAMATA
KOGGM614 JÁRMŰIPARI KUTATÁS ÉS FEJLESZTÉS FOLYAMATA System Design Wahl István 2019.03.26. BME FACULTY OF TRANSPORTATION ENGINEERING AND VEHICLE ENGINEERING Tartalomjegyzék Rövidítések A rendszer definiálása
Vállalati kockázatkezelés jelentősége
www.pwc.com/hu Vállalati kockázatkezelés jelentősége Fedor Péter 2013. szeptember 19. Miről lesz szó 1. Mi is az az ERM? 2. Miért fontos? 3. Gyakorlati sajátosságok PwC Magyarország Mi is az az ERM? PwC
White Paper. Grounding Patch Panels
White Paper Grounding Patch Panels Tartalom 1. Bevezető... 1 2. A földelés jelentőssége... 3 3. AC elosztó rendszer... 3 4. Földelési rendszerek... 3 4.1. Fa... 3 4.2. Háló... 5 5. Patch panel földelési
SIP. Jelzés a telefóniában. Session Initiation Protocol
SIP Jelzés a telefóniában Session Initiation Protocol 1 Telefon hívás létrehozása 2 Jelzés és hálózat terhelés 3 Jelzés sík és jelzés típusok 4 TDM - CAS Channel Associated Signaling 5 CCS - Signaling
INTELLIGENT ENERGY EUROPE PROGRAMME BUILD UP SKILLS TRAINBUD. Quality label system
INTELLIGENT ENERGY EUROPE PROGRAMME BUILD UP SKILLS TRAINBUD WP4: Deliverable 4.5 Development of voluntary qualification system Quality label system 1 INTELLIGENT ENERGY EUROPE PROGRAMME BUILD UP SKILLS
Utolsó frissítés / Last update: február Szerkesztő / Editor: Csatlós Árpádné
Utolsó frissítés / Last update: 2016. február Szerkesztő / Editor: Csatlós Árpádné TARTALOM / Contents BEVEZETŐ / Introduction... 2 FELNŐTT TAGBÉLYEGEK / Adult membership stamps... 3 IFJÚSÁGI TAGBÉLYEGEK
ASUS GX800 lézeres játékegér
ASUS GX800 lézeres játékegér 1 6 Felhasználói kézikönyv HUG5761 Elsö kiadás (V1) Május 2010 Copyright 2010 ASUSTeK Computer Inc. All Rights Reserved. Az ASUSTeK COMPUTER INC. ( ASUS ) előzetes írásos engedélye
Cut-Off Time for Payment Orders, Incoming Payments And Fulfilment Orders
Cut-Off Time for Payment Orders, Incoming Payments And Fulfilment Orders Effective from 1 st of January 2016 1 Cut-off times for the receipt of payment orders for same-day processing: On every business
székhely: 1133 Budapest, Tutaj u. 6/A Registered office: 1133 Budapest, Tutaj u. 6/A
Átvállalási megállapodás a gyártó visszavételi és begyűjtési kötelezettségeinek átvállalásáról Agreement on Transfer of Responsibility in respect of the manufacturer s obligations to take back and collect
Szakmai továbbképzési nap akadémiai oktatóknak. 2012. december 14. HISZK, Hódmezővásárhely / Webex
Szakmai továbbképzési nap akadémiai oktatóknak 2012. december 14. HISZK, Hódmezővásárhely / Webex 14.00-15.00 15.00-15.30 15.30-15.40 Mai program 1. Amit feltétlenül ismernünk kell: az irányítótábla közelebbről.
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel Timea Farkas Click here if your download doesn"t start
Computer Architecture
Computer Architecture Locality-aware programming 2016. április 27. Budapest Gábor Horváth associate professor BUTE Department of Telecommunications ghorvath@hit.bme.hu Számítógép Architektúrák Horváth
Presenter SNP6000. Register your product and get support at HU Felhasználói kézikönyv
Register your product and get support at www.philips.com/welcome Presenter SNP6000 HU Felhasználói kézikönyv 1 a b c d e 2 3 4 Federal Communication Commission Interference Statement This equipment has
4. Gyakorlat: Csoportházirend beállítások
4. Gyakorlat: Csoportházirend beállítások 4.1. A Default Domain Policy jelszóra vonatkozó beállításai 4.2. Parancsikon, mappa és hálózati meghajtó megjelenítése csoport házirend segítségével 4.3. Alkalmazások
Website review acci.hu
Website review acci.hu Generated on September 30 2016 21:54 PM The score is 37/100 SEO Content Title Acci.hu - Ingyenes apróhirdető Length : 30 Perfect, your title contains between 10 and 70 characters.
Web Services. (webszolgáltatások): egy osztott alkalmazásfejlesztési plattform
(webszolgáltatások): egy osztott alkalmazásfejlesztési plattform Ficsor Lajos Általános Informatikai Tanszék Miskolci Egyetem A Web Service Web Service definíciója Számos definíció létezik. IBM [4] A Web
TELJESÍTMÉNY NYILATKOZAT 0832-CPD-1651
E-mail: info@fulleon.co.uk Web: www.cooperfulleon.co m TELJESÍTMÉNY NYILATKOZAT 0832-CPD-1651 Termék azonosító kód: ROLP/SV és ROLP/SV/WP Típus, adagszám vagy gyári szám, illetve bármilyen más elem, amely
Néhány folyóiratkereső rendszer felsorolása és példa segítségével vázlatos bemutatása Sasvári Péter
Néhány folyóiratkereső rendszer felsorolása és példa segítségével vázlatos bemutatása Sasvári Péter DOI: http://doi.org/10.13140/rg.2.2.28994.22721 A tudományos közlemények írása minden szakma művelésének
Create & validate a signature
IOTA TUTORIAL 7 Create & validate a signature v.0.0 KNBJDBIRYCUGVWMSKPVA9KOOGKKIRCBYHLMUTLGGAV9LIIPZSBGIENVBQ9NBQWXOXQSJRIRBHYJ9LCTJLISGGBRFRTTWD ABBYUVKPYFDJWTFLICYQQWQVDPCAKNVMSQERSYDPSSXPCZLVKWYKYZMREAEYZOSPWEJLHHFPYGSNSUYRZXANDNQTTLLZA
IP/09/473. Brüsszel, 2009. március 25
IP/09/473 Brüsszel, 2009. március 25 A mobiltelefon-használat nő, míg a fogyasztói árak csökkennek: a Bizottság jelentése szerint az európai távközlési ágazat ellenáll a gazdasági lassulásnak 2008-ban
www.pwc.com Aktuális adózási és szabályozási kérdések a turizmusban 2012-es adóváltozások Személyi jövedelemadó
www.pwc.com Aktuális adózási és szabályozási kérdések a turizmusban 2012-es adóváltozások Személyi jövedelemadó SZJA változások Tartalom Személyi jövedelemadó Összevonás alá eső juttatások Béren kívüli
2015. október 1. Új időszámítás a rövid távú kapacitás termék értékesítésben. 1 October 2015 New era is to start in short term capacity allocation
2015. október 1. Új időszámítás a rövid távú kapacitás termék értékesítésben 1 October 2015 New era is to start in short term capacity allocation Kajtán Erika Kapacitásértékesítés vezető/head of Capacity
Payment Center. Rövid útmutató. Verzió 1.0.1
Payment Center Rövid útmutató Verzió 1.0.1 This document has been created by the Wirecard AG. Its contents may be changed without prior notice. External web links are provided for information only. Wirecard
SAJTÓKÖZLEMÉNY Budapest 2011. július 13.
SAJTÓKÖZLEMÉNY Budapest 2011. július 13. A MinDig TV a legdinamikusabban bıvülı televíziós szolgáltatás Magyarországon 2011 elsı öt hónapjában - A MinDig TV Extra a vezeték nélküli digitális televíziós
NSR Settlements. This session will discuss:
NSR Settlements NSR Settlements This session will discuss: purpose and meaning of settlement agreements and the types of settlement agreements relationship between Consent Decrees and Title V applicable
EEA, Eionet and Country visits. Bernt Röndell - SES
EEA, Eionet and Country visits Bernt Röndell - SES Európai Környezetvédelmi Ügynökség Küldetésünk Annak elősegítése, hogy az EU és a tagállamok a szükséges információk alapján hozhassák meg a környezet
Osztott alkalmazások fejlesztési technológiái Áttekintés
Osztott alkalmazások fejlesztési technológiái Áttekintés Ficsor Lajos Általános Informatikai Tanszék Miskolci Egyetem Történelem - a kezdetek 2 Mainframe-ek és terminálok Minden a központi gépen fut A