ETSI ES V1.1.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 8: Terminal Status (Parlay X 3)
|
|
- Zsombor Mezei
- 6 évvel ezelőtt
- Látták:
Átírás
1 Standard Open Service Access (OSA); Parlay X Web Services; Part 8: Terminal Status (Parlay X 3)
2 2 Reference DES/TISPAN OSA Keywords API, OSA, service 650 Route des Lucioles F Sophia Antipolis Cedex - FRANCE Tel.: Fax: Siret N NAF 742 C Association à but non lucratif enregistrée à la Sous-Préfecture de Grasse (06) N 7803/88 Important notice Individual copies of the present document can be downloaded from: The present document may be made available in more than one electronic version or in print. In any case of existing or perceived difference in contents between such versions, the reference version is the Portable Document Format (PDF). In case of dispute, the reference shall be the printing on printers of the PDF version kept on a specific network drive within Secretariat. Users of the present document should be aware that the document may be subject to revision or change of status. Information on the current status of this and other documents is available at If you find errors in the present document, please send your comment to one of the following services: Copyright Notification No part may be reproduced except as authorized by written permission. The copyright and the foregoing restriction extend to reproduction in all media. European Telecommunications Standards Institute The Parlay Group All rights reserved. DECT TM, PLUGTESTS TM, UMTS TM, TIPHON TM, the TIPHON logo and the logo are Trade Marks of registered for the benefit of its Members. 3GPP TM is a Trade Mark of registered for the benefit of its Members and of the 3GPP Organizational Partners.
3 3 Contents Intellectual Property Rights...5 Foreword Scope References Normative references Definitions and abbreviations Definitions Abbreviations Detailed service description Namespaces Sequence diagrams Terminal status query Terminal status group query Terminal status notification Terminal Status Notification with Check Immediate XML Schema data type definition Status enumeration RetrievalStatus enumeration StatusData structure StatusInformation structure Web Service interface definition Interface: TerminalStatus Operation: getstatus Input message: getstatusrequest Output message: getstatusresponse Referenced faults Operation: getstatusforgroup Input message: getstatusforgrouprequest Output message: getstatusforgroupresponse Referenced faults Interface: TerminalStatusNotificationManager Operation: startnotification Input message: startnotificationrequest Output message: startnotificationresponse Referenced faults Operation: endnotification Input message: endnotificationrequest Output message: endnotificationresponse Referenced faults Interface: TerminalNotification Operation: statusnotification Input message: statusnotificationrequest Output message: statusnotificationresponse Referenced faults Operation: statuserror Input message: statuserrorrequest Output message: statuserrorresponse Referenced faults Operation: statusend Input message: statusendrequest Output message: statusendresponse...18
4 Referenced faults Fault definitions PolicyException POL0200: Busy criteria not supported Service policies...19 Annex A (normative): WSDL for Terminal Status...20 Annex B (informative): Bibliography...21 History...22
5 5 Intellectual Property Rights IPRs essential or potentially essential to the present document may have been declared to. The information pertaining to these essential IPRs, if any, is publicly available for members and non-members, and can be found in SR : "Intellectual Property Rights (IPRs); Essential, or potentially Essential, IPRs notified to in respect of standards", which is available from the Secretariat. Latest updates are available on the Web server ( Pursuant to the IPR Policy, no investigation, including IPR searches, has been carried out by. No guarantee can be given as to the existence of other IPRs not referenced in SR (or the updates on the Web server) which are, or may be, or may become, essential to the present document. Foreword This Standard (ES) has been produced by Technical Committee Telecommunications and Internet converged Services and Protocols for Advanced Networking (TISPAN). The present document is part 8 of a multi-part deliverable covering Open Service Access (OSA); Parlay X Web Services, as identified below: Part 1: Part 2: Part 3: Part 4: Part 5: Part 6: Part 7: Part 8: Part 9: Part 10: Part 11: Part 12: Part 13: Part 14: Part 15: Part 16: Part 17: Part 18: Part 19: Part 20: "Common"; "Third Party Call"; "Call Notification"; "Short Messaging"; "Multimedia Messaging"; "Payment"; "Account Management"; "Terminal Status"; "Terminal Location"; "Call Handling"; "Audio Call"; "Multimedia Conference"; "Address List Management"; "Presence"; "Message Broadcast"; "Geocoding"; "Application-driven Quality of Service (QoS)"; "Device Capabilities and Configuration"; "Multimedia Streaming Control"; "Multimedia Multicast Session Management".
6 6 The present document has been defined jointly between, The Parlay Group ( and the 3GPP. The present document forms part of the Parlay X 3.0 set of specifications. The present document is equivalent to 3GPP TS V7.0.2 (Release 7).
7 7 1 Scope The present document is part 8 of the Stage 3 Parlay X 3 Web Services specification for Open Service Access (OSA). The OSA specifications define an architecture that enables application developers to make use of network functionality through an open standardized interface, i.e. the OSA APIs. The present document specifies the Terminal Status Web Service. The following are defined here: Name spaces. Sequence diagrams. Data definitions. Interface specification plus detailed method descriptions. Fault definitions. Service Policies. WSDL Description of the interfaces. 2 References References are either specific (identified by date of publication and/or edition number or version number) or non-specific. For a specific reference, subsequent revisions do not apply. Non-specific reference may be made only to a complete document or a part thereof and only in the following cases: - if it is accepted that it will be possible to use all future changes of the referenced document for the purposes of the referring document; - for informative references. Referenced documents which are not found to be publicly available in the expected location might be found at For online referenced documents, information sufficient to identify and locate the source shall be provided. Preferably, the primary source of the referenced document should be cited, in order to ensure traceability. Furthermore, the reference should, as far as possible, remain valid for the expected life of the document. The reference shall include the method of access to the referenced document and the full network address, with the same punctuation and use of upper case and lower case letters. NOTE: While any hyperlinks included in this clause were valid at the time of publication cannot guarantee their long term validity. 2.1 Normative references The following referenced documents are indispensable for the application of the present document. For dated references, only the edition cited applies. For non-specific references, the latest edition of the referenced document (including any amendments) applies. [1] W3C Recommendation (2 May 2001): "XML Schema Part 2: Datatypes". NOTE: Available at
8 8 [2] ES : " Open Service Access (OSA); Parlay X Web Services; Part 1: Common (Parlay X 3)". 3 Definitions and abbreviations 3.1 Definitions For the purposes of the present document, the terms and definitions given in ES [2] apply. 3.2 Abbreviations For the purposes of the present document, the abbreviations given in ES [2] apply. 4 Detailed service description Terminal Status provides access to the status of a terminal through: Request for the status of a terminal. Request for the status of a group of terminals. Notification of a change in the status of a terminal. The status of a terminal can be expressed as reachable, unreachable or busy - however not all terminals distinguish a busy status, so applications should be able to adapt to what information is available (using the service properties to determine available information). When a request for a group of terminals is made, the response may contain a full or partial set of results. This allows the service to provide results based on a number of criteria including number of terminals for which the request is made and amount of time required to retrieve the information. This allows the requester to initiate additional requests for those terminals for which information was not provided. 5 Namespaces The TerminalStatus interface uses the namespace: The TerminalStatusNotificationManager interface uses the namespace: The TerminalStatusNotification interface uses the namespace: The data types are defined in the namespace: The "xsd" namespace is used in the present document to refer to the XML Schema data types defined in XML Schema [1]. The use of the name "xsd" is not semantically significant.
9 9 6 Sequence diagrams 6.1 Terminal status query Pattern: Request / Response. When an application is interested in determining the status of a terminal device, it may provide a terminal device address, and receive the status for the device requested. : Application : Terminal Status getstatus Retrieve terminal status Status Figure 1
10 Terminal status group query Pattern: Request / Response. When an application is interested in determining the status of a set of terminal devices, it may provide an array of terminal device addresses, including network managed group addresses, and receive the status for the set of devices requested. : Application : Terminal Status getstatusforgroup Process groups Retrieve terminal status Status list Figure 2
11 Terminal status notification Pattern: Application Correlated Multiple Notification. An application can be notified of a change in the status of terminal devices. When the status of a terminal device changes, a notification message will be sent to the application. : Application : Terminal Status : Notification Notification Application : Notification Web Service Create correlation id startnotification At some later time, an event occurs to trigger the notification statusnotification At some later time, the notification may be cancelled endnotification Figure 3
12 Terminal Status Notification with Check Immediate In some applications, the terminal status notification will be used to watch for a specific status change. An example is a "call when available" service, where the terminal status is checked and determined to be not reachable or busy, and a notification is set up to notify the application when the terminal becomes reachable. Between the time that the original status determination and the time the notification is set up, the terminal status could change to reachable, thus the notification on change to reachable would not be sent. Using the check immediate flag, after the notification is established, the value of the terminal status will be determined, and if the criteria is matched then a notification will be sent immediately. The following sequence diagram shows this scenario. : Application : Terminal Status : Terminal Status Notification : Notification Application : Notification Web Service getstatus Status Create correlation id startnotification with Check Immediate = true Set up notification Check terminal status statusnotification Apply count to notification statusend void Figure 4
13 13 This sequence shows: The Enterprise Application checks the status of a terminal, and receives its status (in this scenario receiving Unreachable or Busy). The Enterprise Application generates a correlator, and starts a notification with criteria defined to notify the Enterprise Web Service when the terminal state becomes Reachable and the check immediate flag set to true. Sets up the notification to monitor terminal status changes. Check the current status of the terminal, and determine if the status matches the criteria. In this case, the criteria matches, and a notification is delivered to the Enterprise Web Service. The count of notifications is incremented and compared to the notification count limit. In this case, a single notification was requested, and the end notification message is sent. The startnotification operation completes. This scenario includes the full set of interactions in one sequence, which also shows that the notifications can be received concurrent with the creation of the notification. 7 XML Schema data type definition 7.1 Status enumeration List of possible status values. Enumeration value Reachable Unreachable Busy Terminal is reachable Terminal is not reachable Terminal is busy Description 7.2 RetrievalStatus enumeration Enumeration of the status items that are related to an individual retrieval in a set. Enumeration value Retrieved NotRetrieved Error Description Status retrieved, with result in currentstatus element Status not retrieved, currentstatus is not provided (does not indicate an error, no attempt may have been made) Error retrieving status
14 StatusData structure Data structure containing device identifier and its status. As this can be related to a query of a group of terminal devices, the reportstatus element is used to indicate whether the information for the device was retrieved or not, or if an error occurred. Element name Element type Optional Description address xsd:anyuri No Address of the Terminal Device to which the status information applies reportstatus RetrievalStatus No Status of retrieval for this address currentstatus Status Yes Status of terminal. It is only provided if reportstatus=retrieved. errorinformation common:serviceerror Yes If reportstatus is Error, this is the reason for the error. Error due to privacy verification will be expressed as POL0002 in the ServiceError 7.4 StatusInformation structure A simplified terminal status data structure used in the TerminalNotification interface. Name Type Optional Description address xsd:anyuri No Address of the terminal device to which the status information applies. currentstatus Status No Status of terminal. 8 Web Service interface definition 8.1 Interface: TerminalStatus Request the status for a terminal or set of terminals Operation: getstatus This operation is intended to retrieve the status for a single terminal. The URI provided is for a single terminal, not a group URI. If a group URI is provided, a PolicyException will be returned to the application Input message: getstatusrequest address xsd:anyuri No Terminal to request status for Output message: getstatusresponse result Status No Status for the terminal for which status was requested Referenced faults ServiceException from ES [2]: SVC0001: Service error. SVC0002: Invalid input value. SVC0004: No valid address(es) if the address does not exist.
15 15 PolicyException from ES [2]: POL0001: Policy error. POL0002: Privacy error. POL0006: Groups not allowed Operation: getstatusforgroup This operation initiates a retrieval activity, where one or more terminals, or groups of terminals, may have their status determined. The Web Service may return a result set that does not include complete information, allowing the Web Service implementation to choose to deliver a partial set of results to accommodate other conditions, such as avoiding timeouts. In this case, the addresses for which no attempt was made to provide data will be marked NotRetrieved in the result for each address this applies to Input message: getstatusforgrouprequest addresses xsd:anyuri No List of URIs to get status for, including group URIs [1..unbounded] Output message: getstatusforgroupresponse result StatusData No Set of results for the request [1..unbounded] Referenced faults ServiceException from ES [2]: SVC0001: Service error. SVC0002: Invalid input value. SVC0004: No valid addresses. SVC0006: Invalid group. PolicyException from ES [2]: POL0001: Policy error. POL0003: Too many addresses. POL0006: Groups not allowed. POL0007: Nested groups not allowed. 8.2 Interface: TerminalStatusNotificationManager Set up notifications for terminal status changes.
16 Operation: startnotification Notifications of status changes are made available to applications. The number and duration of notifications may be requested as part of the setup of the notification or may be governed by service policies, or a combination of the two. If checkimmediate is set to true, then the notification will be set up, and then the current value of the terminal status will be checked. If the terminal status meets the criteria provided, a notification will be sent to the application. This notification will count against the count requested. This addresses the case where the status of the device changes during the time the notification is being set up, which may be appropriate in some applications. The correlator provided in the reference must be unique for this Web Service at the time the notification is initiated, otherwise a ServiceException (SVC0005) will be returned to the application. If the frequency requested is more often than allowed by the service policy, then the value in the service policy will be used. If the duration requested exceeds the time allowed in the service policy, then the value in the service policy will be used. If the notification period (duration) ends before all of the notifications (count) have been delivered, then the notification terminates. In all cases, when the notifications have run their course (by duration or count), an end of notifications message will be provided to the application. Service policies may govern what count values can be requested, including maximum number of notifications allowed and whether unlimited notifications can be requested (i.e. either by not specifying the optional count message part or by specifying it with a value of zero). If the count value requested is not in policy, a PolicyException (POL0004 or POL0005 as appropriate) will be returned Input message: startnotificationrequest reference common:simplereference No Notification endpoint definition addresses xsd:anyuri [0..unbounded] No Addresses of terminals to monitor criteria Status [0..unbounded] No List of status values to generate notifications for (these apply to all addresses specified) checkimmediate xsd:boolean No Check status immediately after establishing notification frequency common:timemetric No Maximum frequency of notifications (can also be considered minimum time between notifications) duration common:timemetric Yes Length of time notifications occur for. Do not specify to use default notification time defined by service policy count xsd:integer Yes Maximum number of notifications. For no maximum, either do not specify this part or specify a value of zero Output message: startnotificationresponse None Referenced faults ServiceException from ES [2]: SVC0001: Service error. SVC0002: Invalid input value. SVC0004: No valid addresses. SVC0005: Duplicate correlator. SVC0006: Invalid group.
17 17 PolicyException from ES [2]: POL0001: Policy error. POL0003: Too many addresses. POL0004: Unlimited notifications not supported. POL0005: Too many notifications requested. POL0006: Groups not allowed. POL0007: Nested groups not allowed. POL0009: Invalid frequency requested. POL0200: Busy criteria not supported Operation: endnotification The application may end a notification using this operation. Until this operation completes, notifications may continue to be received by the application. An end of notification (statusend) operation will not be invoked on the application for a notification ended using the endnotification operation Input message: endnotificationrequest correlator xsd:string No Correlator of request to end Output message: endnotificationresponse None Referenced faults ServiceException from ES [2]: SVC0001: Service error. SVC0002: Invalid input value. PolicyException from ES [2]: POL0001: Policy error. 8.3 Interface: TerminalNotification Notification interface to which notifications are delivered Operation: statusnotification When the status of a monitored device changes, a notification is delivered to the application with the new status information for each of the devices. If a group identifier was used, the terminal device URI is provided, not the group URI.
18 Input message: statusnotificationrequest correlator xsd:string No Correlator provided in request to set up this notification terminalstatus StatusInformation [1..unbounded] No Set of elements, each containing a terminal address and its new status Output message: statusnotificationresponse None Referenced faults None Operation: statuserror This operation is invoked on the application to indicate that the notification is being cancelled by the Web Service Input message: statuserrorrequest correlator xsd:string No Correlator provided in request to set up this notification. address xsd:anyuri Yes Address of terminal if the error applies to an individual terminal, or not specified if it applies to the whole notification. reason common:serviceerror No Reason notification is being discontinued Output message: statuserrorresponse None Referenced faults None Operation: statusend The notifications have completed for this correlator. This operation will be invoked on the application when the duration or count for notifications have been completed. This operation will not be invoked in the case of an error ending the notifications or deliberate ending of the notifications (using the endnotification operation) Input message: statusendrequest correlator xsd:string No Correlator provided in request to set up this notification Output message: statusendresponse None
19 Referenced faults None. 9 Fault definitions 9.1 PolicyException POL0200: Busy criteria not supported Name messageid text variables POL0200 Busy criteria is not supported None Description 10 Service policies Service policies for this service. Name Type Description BusyAvailable xsd:boolean Can busy be returned as a status or be a trigger MaximumNotificationAddresses xsd:int Maximum number of addresses for which a notification can be set up MaximumNotificationFrequency common:timemetric Maximum rate of notification delivery (also can be considered minimum time between notifications) MaximumNotification Duration common:timemetric Maximum amount of time a notification may be set up for MaximumCount xsd:int Maximum number of notifications that may be requested UnlimitedCountAllowed xsd:boolean Allowed to specify unlimited notification count (i.e. either by not specifying the optional count part in the startnotificationrequest message or by specifying a value of zero) GroupSupport xsd:boolean Groups may be included with addresses NestedGroupSupport xsd:boolean Are nested groups supported in group definitions
20 20 Annex A (normative): WSDL for Terminal Status The document/literal WSDL representation of this interface specification is compliant to ES [2] and is contained in text files (contained in archive es_ v010101p0.zip) which accompany the present document.
21 21 Annex B (informative): Bibliography TR : "Universal Mobile Telecommunications System (UMTS); Vocabulary for 3GPP Specifications (3GPP TR )".
22 22 History Document history V1.1.1 February 2008 Membership Approval Procedure MV : to V1.1.1 May 2008 Publication
Final draft ETSI ES V1.1.1 ( )
Standard Open Service Access (OSA); Parlay X Web Services; Part 11: Audio Call 2 Reference DES/TISPAN-01007-11-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis Cedex - FRANCE
ETSI ES V1.3.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 11: Audio Call (Parlay X 2)
Standard Open Service Access (OSA); Parlay X Web Services; Part 11: Audio Call (Parlay X 2) 2 Reference RES/TISPAN-01056-11-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
ETSI ES V1.2.1 ( )
Standard Open Service Access (OSA); Parlay X Web Services; Part 10: Call Handling (Parlay X 2) 2 Reference RES/TISPAN-01033-10-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
ETSI ES V1.2.1 ( )
Standard Open Service Access (OSA); Parlay X Web Services; Part 2: Third Party Call (Parlay X 2) 2 Reference RES/TISPAN-01033-02-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
ETSI ES V1.3.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 13: Address List Management (Parlay X 2)
Standard Open Service Access (OSA); Parlay X Web Services; Part 13: Address List Management (Parlay X 2) 2 Reference RES/TISPAN-01056-13-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia
ETSI ES V1.1.1 ( )
Standard Open Service Access (OSA); Parlay X Web Services; Part 13: Address List Management 2 Reference DES/TISPAN-01007-13-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
ETSI ES V1.3.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 7: Account Management (Parlay X 2)
Standard Open Service Access (OSA); Parlay X Web Services; Part 7: Account Management (Parlay X 2) 2 Reference RES/TISPAN-01056-07-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
ETSI ES V1.1.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 16: Geocoding (Parlay X 3)
Standard Open Service Access (OSA); Parlay X Web Services; Part 16: Geocoding (Parlay X 3) 2 Reference DES/TISPAN-01034-16-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
ETSI ES V1.1.1 ( )
Standard Open Service Access (OSA); Parlay X Web Services; Part 5: Multimedia Messaging 2 Reference DES/TISPAN-01007-05-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis Cedex
ETSI ES V1.2.1 ( )
Standard Open Service Access (OSA); Parlay X Web Services; Part 5: Multimedia Messaging (Parlay X 2) 2 Reference RES/TISPAN-01033-05-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia
ETSI ES V1.1.1 ( )
Standard Open Service Access (OSA); Parlay X Web Services; Part 6: Payment 2 Reference DES/TISPAN-01007-06-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis Cedex - FRANCE
ETSI ES V1.3.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 5: Multimedia Messaging (Parlay X 2)
Standard Open Service Access (OSA); Parlay X Web Services; Part 5: Multimedia Messaging (Parlay X 2) 2 Reference RES/TISPAN-01056-05-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia
ETSI ES V1.1.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 3: Call Notification (Parlay X 3)
Standard Open Service Access (OSA); Parlay X Web Services; Part 3: Call Notification (Parlay X 3) 2 Reference DES/TISPAN-01034-3-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
ETSI ES V1.2.1 ( )
Standard Open Service Access (OSA); Parlay X Web Services; Part 6: Payment (Parlay X 2) 2 Reference RES/TISPAN-01033-06-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis Cedex
ETSI ES V1.1.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 15: Message Broadcast (Parlay X 3)
Standard Open Service Access (OSA); Parlay X Web Services; Part 15: Message Broadcast (Parlay X 3) 2 Reference DES/TISPAN-01034-15-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
ETSI ES V1.1.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 4: Short Messaging (Parlay X 3)
Standard Open Service Access (OSA); Parlay X Web Services; Part 4: Short Messaging (Parlay X 3) 2 Reference DES/TISPAN-01034-4-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
ETSI ES V1.3.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 1: Common (Parlay X 2)
Standard Open Service Access (OSA); Parlay X Web Services; Part 1: Common (Parlay X 2) 2 Reference RES/TISPAN-01056-01-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis Cedex
EN United in diversity EN A8-0206/419. Amendment
22.3.2019 A8-0206/419 419 Article 2 paragraph 4 point a point i (i) the identity of the road transport operator; (i) the identity of the road transport operator by means of its intra-community tax identification
Széchenyi István Egyetem www.sze.hu/~herno
Oldal: 1/6 A feladat során megismerkedünk a C# és a LabVIEW összekapcsolásának egy lehetőségével, pontosabban nagyon egyszerű C#- ban írt kódból fordítunk DLL-t, amit meghívunk LabVIEW-ból. Az eljárás
ETSI ES V1.1.1 ( )
Standard Open Service Access (OSA); Parlay X Web Services; Part 1: Common 2 Reference DES/TISPAN-01007-01-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis Cedex - FRANCE Tel.:
PIACI HIRDETMÉNY / MARKET NOTICE
PIACI HIRDETMÉNY / MARKET NOTICE HUPX DAM Másnapi Aukció / HUPX DAM Day-Ahead Auction Iktatási szám / Notice #: Dátum / Of: 18/11/2014 HUPX-MN-DAM-2014-0023 Tárgy / Subject: Változások a HUPX másnapi piac
BKI13ATEX0030/1 EK-Típus Vizsgálati Tanúsítvány/ EC-Type Examination Certificate 1. kiegészítés / Amendment 1 MSZ EN 60079-31:2014
(1) EK-TípusVizsgálati Tanúsítvány (2) A potenciálisan robbanásveszélyes környezetben történő alkalmazásra szánt berendezések, védelmi rendszerek 94/9/EK Direktíva / Equipment or Protective Systems Intended
USER MANUAL Guest user
USER MANUAL Guest user 1 Welcome in Kutatótér (Researchroom) Top menu 1. Click on it and the left side menu will pop up 2. With the slider you can make left side menu visible 3. Font side: enlarging font
Cloud computing. Cloud computing. Dr. Bakonyi Péter.
Cloud computing Cloud computing Dr. Bakonyi Péter. 1/24/2011 1/24/2011 Cloud computing 2 Cloud definició A cloud vagy felhő egy platform vagy infrastruktúra Az alkalmazások és szolgáltatások végrehajtására
Using the CW-Net in a user defined IP network
Using the CW-Net in a user defined IP network Data transmission and device control through IP platform CW-Net Basically, CableWorld's CW-Net operates in the 10.123.13.xxx IP address range. User Defined
Lexington Public Schools 146 Maple Street Lexington, Massachusetts 02420
146 Maple Street Lexington, Massachusetts 02420 Surplus Printing Equipment For Sale Key Dates/Times: Item Date Time Location Release of Bid 10/23/2014 11:00 a.m. http://lps.lexingtonma.org (under Quick
Cloud computing Dr. Bakonyi Péter.
Cloud computing Dr. Bakonyi Péter. 1/24/2011 Cloud computing 1/24/2011 Cloud computing 2 Cloud definició A cloud vagy felhő egy platform vagy infrastruktúra Az alkalmazások és szolgáltatások végrehajtására
Utasítások. Üzembe helyezés
HASZNÁLATI ÚTMUTATÓ Üzembe helyezés Utasítások Windows XP / Vista / Windows 7 / Windows 8 rendszerben történő telepítéshez 1 Töltse le az AORUS makróalkalmazás telepítőjét az AORUS hivatalos webhelyéről.
Számlakezelés az ELO DocXtraktor modullal
ELOECMSzakmai Kongresszus2013 Számlakezelés az ELO DocXtraktor modullal Kovács Eszter Kovacs.eszter@pentatrade.hu Projekt bemutatása A Cég Cégcsoport Éves árbevétel 140 mrd FT > 5 500 dolgozó ( 1 000 fı
(NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV
Kommunikációs rendszerek programozása (NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV (5. mérés) SIP telefonközpont készítése Trixbox-szal 1 Mérés helye: Széchenyi István Egyetem, L-1/7 laboratórium, 9026 Győr, Egyetem
PIACI HIRDETMÉNY / MARKET NOTICE
PIACI HIRDETMÉNY / MARKET NOTICE HUPX DAM Másnapi Aukció / HUPX DAM Day-Ahead Auction Iktatási szám / Notice #: HUPX-MN-DAM-2018-0001 Dátum / Of: 26/01/2018 Tárgy / Subject: Hatályos díjszabás és kedvezmények
ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP
ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP CHILD S DATA / GYERMEK ADATAI PLEASE FILL IN THIS INFORMATION WITH DATA BASED ON OFFICIAL DOCUMENTS / KÉRJÜK, TÖLTSE KI A HIVATALOS DOKUMENTUMOKBAN SZEREPLŐ ADATOK
On The Number Of Slim Semimodular Lattices
On The Number Of Slim Semimodular Lattices Gábor Czédli, Tamás Dékány, László Ozsvárt, Nóra Szakács, Balázs Udvari Bolyai Institute, University of Szeged Conference on Universal Algebra and Lattice Theory
10. Gyakorlat: Alkalmazások publikálása Remote Desktop Szervízen keresztül
10. Gyakorlat: Alkalmazások publikálása Remote Desktop Szervízen keresztül 10.1. Jogosultságok és csoportok létrehozása 10.2. Az RDS szerver szerepkör telepítése a DC01-es szerverre 10.3. Az RDS01-es szerver
PIACI HIRDETMÉNY / MARKET NOTICE
PIACI HIRDETMÉNY / MARKET NOTICE HUPX DAM Másnapi Aukció / HUPX DAM Day-Ahead Auction Iktatási szám / Notice #: HUPX-MN-DAM-2018-0010 Dátum / Of: 12/10/2018 Tárgy / Subject: Hatályos díjszabás és kedvezmények
Proxer 7 Manager szoftver felhasználói leírás
Proxer 7 Manager szoftver felhasználói leírás A program az induláskor elkezdi keresni az eszközöket. Ha van olyan eszköz, amely virtuális billentyűzetként van beállítva, akkor azokat is kijelzi. Azokkal
Cashback 2015 Deposit Promotion teljes szabályzat
Cashback 2015 Deposit Promotion teljes szabályzat 1. Definitions 1. Definíciók: a) Account Client s trading account or any other accounts and/or registers maintained for Számla Az ügyfél kereskedési számlája
Correlation & Linear Regression in SPSS
Petra Petrovics Correlation & Linear Regression in SPSS 4 th seminar Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Correlation
ELO Digital Office ERP integráció
ELO Digital Office ERP integráció Lázár Péter ECM Business Unit Manager peter.lazar@itelligence.hu Enterprise Content Management www.elo.com Miért kell ERP integráció? Hozzáféréseket szabályozni és auditálni
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Factor Analysis
Factor Analysis Factor analysis is a multiple statistical method, which analyzes the correlation relation between data, and it is for data reduction, dimension reduction and to explore the structure. Aim
STUDENT LOGBOOK. 1 week general practice course for the 6 th year medical students SEMMELWEIS EGYETEM. Name of the student:
STUDENT LOGBOOK 1 week general practice course for the 6 th year medical students Name of the student: Dates of the practice course: Name of the tutor: Address of the family practice: Tel: Please read
Könnyen bevezethető ITIL alapú megoldások a Novell ZENworks segítségével. Hargitai Zsolt Sales Support Manager Novell Hungary
Könnyen bevezethető ITIL alapú megoldások a Novell ZENworks segítségével Hargitai Zsolt Sales Support Manager Novell Hungary Napirend ITIL rövid áttekintés ITIL komponensek megvalósítása ZENworks segítségével
Új funkciók az RBP-ben 2015. október 1-től New functions in RBP from 1 October 2015. Tatár Balázs
Új funkciók az RBP-ben 2015. október 1-től New functions in RBP from 1 October 2015 Tatár Balázs Üzletfejlesztés vezető / Business Development Manager Rendszerhasználói Tájékoztató Nap, 2015. szeptember
PIACI HIRDETMÉNY / MARKET NOTICE
PIACI HIRDETMÉNY / MARKET NOTICE HUPX Fizikai Futures (PhF) / HUPX Physical Futures (PhF) Iktatási szám / Notice #: HUPX-MN-PhF-2015-0003 Dátum / Of: 20/04/2015 Tárgy / Subject: Hatályos díjszabás és kedvezmények
EN United in diversity EN A8-0206/473. Amendment
21.3.2019 A8-0206/473 473 Recital 12 d (new) (12d) Since there is no sufficient link of a driver with a territory of a Member State of transit, transit operations should not be considered as posting situations.
ELOECMSzakmai Kongresszus2013
ELOECMSzakmai Kongresszus2013 Keynote Horváth Szilvia Ügyvezető s.horvath@elo.com Cégünk rövid bemutatása 1871 Louis Leitz megalapítja első vállalatát 1995 Az első elektronikus Leitz dokumentumkezelő (ELOoffice)
Teszt topológia E1/1 E1/0 SW1 E1/0 E1/0 SW3 SW2. Kuris Ferenc - [HUN] Cisco Blog -
VTP Teszt topológia E1/1 E1/0 SW1 E1/0 E1/0 SW2 SW3 2 Alap konfiguráció SW1-2-3 conf t interface e1/0 switchport trunk encapsulation dot1q switchport mode trunk vtp domain CCIE vtp mode transparent vtp
Nemzetközi vállalat - a vállalati szoftvermegoldások egyik vezető szállítója
Nemzetközi vállalat - a vállalati szoftvermegoldások egyik vezető szállítója A Novell világszerte vezető szerepet tölt be a Linux-alapú és nyílt forráskódú vállalati operációs rendszerek, valamit a vegyes
Nemzeti Adó- és Vámhivatal Központi Hivatala 1095 Budapest IX., Mester u Budapest Pf. 109 H-Magyarország
MOVEMENT CERTIFICATE EUR. 1 1. Exporter (Name, full address, country) No C 6779801 See notes overleaf before completing this form. 2. Certificate used in preferential trade between 3. Consignee (Name,
Személyes adatváltoztatási formanyomtatvány- Magyarország / Personal Data Change Form - Hungary
Személyes adatváltoztatási formanyomtatvány- Magyarország / Personal Data Change Form - Hungary KITÖLTÉSI ÚTMUTATÓ: A formanyomtatványon a munkavállaló a személyes adatainak módosítását kezdeményezheti.
DANS és Narcis. Burmeister Erzsébet. HUNOR találkozó, Budapest 2013. március 13.
DANS és Narcis Burmeister Erzsébet HUNOR találkozó, Budapest 2013. március 13. DANS DANS (Data Archiving and Network Services) http://www.dans.knaw.nl Kutatási adatok archiválása a saját fejlesztésű EASY
Ezt a levelet kaptad (alatta a tennivalók magyarul) March 30, 2012 VIA EMAIL. Dear Beneficiary:
Amennyiben részvényt vásároltál nagyobb tételben (5000 USD felett) a DubLi alapítványától, ezt a levelet kaptad emailben, melyre LEGKÉSŐBB 2012 április 30.ig kell elküldjed a választ, hogy megkapd a részvényeket.
Mapping Sequencing Reads to a Reference Genome
Mapping Sequencing Reads to a Reference Genome High Throughput Sequencing RN Example applications: Sequencing a genome (DN) Sequencing a transcriptome and gene expression studies (RN) ChIP (chromatin immunoprecipitation)
INFORMATION ON COMPLAINT HANDLING
PANASZKEZELÉSI TÁJÉKOZTATÓ Az ACN Communications Hungary Korlátolt Felelősségű Társaság (székhely: 1132 Budapest, Váci út 30, VI emelet; ACN ) az alábbiakban tájékoztatja előfizetőit az ACN által nyújtott
Csatlakozás a BME eduroam hálózatához Setting up the BUTE eduroam network
Csatlakozás a BME eduroam hálózatához Setting up the BUTE eduroam network Table of Contents Windows 7... 2 Windows 8... 6 Windows Phone... 11 Android... 12 iphone... 14 Linux (Debian)... 20 Sebők Márton
Paysera VISA cards are secured with "3-D technology" which ensures safer payments with payment cards online.
Paysera VISA card Safe payments online Paysera VISA cards are secured with "3-D technology" which ensures safer payments with payment cards online. When purchasing at e-shops labelled with "Paysera VISA",
Eladni könnyedén? Oracle Sales Cloud. Horváth Tünde Principal Sales Consultant 2014. március 23.
Eladni könnyedén? Oracle Sales Cloud Horváth Tünde Principal Sales Consultant 2014. március 23. Oracle Confidential Internal/Restricted/Highly Restricted Safe Harbor Statement The following is intended
KOGGM614 JÁRMŰIPARI KUTATÁS ÉS FEJLESZTÉS FOLYAMATA
KOGGM614 JÁRMŰIPARI KUTATÁS ÉS FEJLESZTÉS FOLYAMATA System Design Wahl István 2019.03.26. BME FACULTY OF TRANSPORTATION ENGINEERING AND VEHICLE ENGINEERING Tartalomjegyzék Rövidítések A rendszer definiálása
Szakmai továbbképzési nap akadémiai oktatóknak. 2012. december 14. HISZK, Hódmezővásárhely / Webex
Szakmai továbbképzési nap akadémiai oktatóknak 2012. december 14. HISZK, Hódmezővásárhely / Webex 14.00-15.00 15.00-15.30 15.30-15.40 Mai program 1. Amit feltétlenül ismernünk kell: az irányítótábla közelebbről.
VoIP (Voice over IP)
VoIP (Voice over IP) Analog Telephone Adapter (ATA) Public Switched Telephone Network (PSTN) Private Branch exchang (PBX) Interactive Voice Response (IVR) Helyi hálózatok tervezése és üzemeltetése 1 Történelem
Web Services. (webszolgáltatások): egy osztott alkalmazásfejlesztési plattform
(webszolgáltatások): egy osztott alkalmazásfejlesztési plattform Ficsor Lajos Általános Informatikai Tanszék Miskolci Egyetem A Web Service Web Service definíciója Számos definíció létezik. IBM [4] A Web
Vállalatirányítási rendszerek
Vállalatirányítási rendszerek Varga Zsigmond Üzletfejlesztési igazgató Budapest, 2015. március 03. Nyilvános Motiváció? 2013 SAP AG. All rights reserved. 2 Adatrögzítés része a fejlődésnek 3 Mestermunkától
Tavaszi Sporttábor / Spring Sports Camp. 2016. május 27 29. (péntek vasárnap) 27 29 May 2016 (Friday Sunday)
Tavaszi Sporttábor / Spring Sports Camp 2016. május 27 29. (péntek vasárnap) 27 29 May 2016 (Friday Sunday) SZÁLLÁS / ACCOMODDATION on a Hotel Gellért*** szálloda 2 ágyas szobáiban, vagy 2x2 ágyas hostel
ACO burkolható fedlapok. ACO műszaki katalógus ACO Burkolható fedlapok UNIFACE PAVING SOLID
ACO burkolható fedlapok ACO burkolható fedlapok ACO műszaki katalógus ACO Burkolható fedlapok UNIFACE PAVING SOLID ACO gully Tartalom Általános információk 3 page ACO Uniface ACO UNIFACE burkolható fedlap
AZ ÖNKORMÁNYZATI MINISZTÉRIUM
XIX. ÉVFOLYAM 22. SZÁM 2008. NOVEMBER 17. ÁRA: 1365 Ft AZ ÖNKORMÁNYZATI MINISZTÉRIUM HIVATALOS LAPJA TARTALOM JOGSZABÁLYOK 2008. évi LX. törvény az olimpiai jelkép oltalmáról szóló, Nairobiban, 1981. szeptember
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel Timea Farkas Click here if your download doesn"t start
Megfelelés az új iratkezelési rendeletnek az ELOik modullal
Megfelelés az új iratkezelési rendeletnek az ELOik modullal Dezsényi Csaba csaba.dezsenyi@ovitas.hu Mindenki nyugodjon meg! Az meg fog felelni az új jogszabályoknak! 2 Mit jelent? Felülvizsgálat Szerelés
Megbízási szerződés (KP) Agency Agreement (TP) mely létrejött egyrészről a. concluded by and between
Megbízási szerződés (KP) Agency Agreement (TP) mely létrejött egyrészről a Cégnév: Székhely: Cégjegyzékszám:. Adószám: mint megbízó (továbbiakban: Megbízó) másrészről pedig a concluded by and between Company
EN United in diversity EN A8-0206/482. Amendment
21.3.2019 A8-0206/482 482 Recital 13 g (new) (13g) In recognition of the need for specific treatment for the transport sector, in which movement is the very essence of the work undertaken by drivers, the
Tájékoztató a 2012. évi határon átnyúló pénzügyi fogyasztói jogviták rendezésével összefüggő és egyéb nemzetközi tevékenységről
Tájékoztató a 2012. évi határon átnyúló pénzügyi fogyasztói jogviták rendezésével összefüggő és egyéb nemzetközi tevékenységről Pénzügyi Békéltető Testület A Pénzügyi Szervezetek Állami Felügyelete mellett
4. Gyakorlat: Csoportházirend beállítások
4. Gyakorlat: Csoportházirend beállítások 4.1. A Default Domain Policy jelszóra vonatkozó beállításai 4.2. Parancsikon, mappa és hálózati meghajtó megjelenítése csoport házirend segítségével 4.3. Alkalmazások
Személyes adatváltoztatási formanyomtatvány - Magyarország / Personal Data Change Form - Hungary
Személyes adatváltoztatási formanyomtatvány - Magyarország / Personal Data Change Form - Hungary Kitöltési útmutató: A formanyomtatványon a munkavállaló a személyes adatainak módosítását kezdeményezheti.
INTELLIGENT ENERGY EUROPE PROGRAMME BUILD UP SKILLS TRAINBUD. Quality label system
INTELLIGENT ENERGY EUROPE PROGRAMME BUILD UP SKILLS TRAINBUD WP4: Deliverable 4.5 Development of voluntary qualification system Quality label system 1 INTELLIGENT ENERGY EUROPE PROGRAMME BUILD UP SKILLS
DETAILED GUIDELINE Content Page
1 DETAILED GUIDELINE Content Page Purchase for official purposes by Foreign Armed Forces and International Military Headquarters: VAT exemption 2 Purchase for official purposes by Foreign Armed Forces
Contact us Toll free (800) fax (800)
Table of Contents Thank you for purchasing our product, your business is greatly appreciated. If you have any questions, comments, or concerns with the product you received please contact the factory.
Rotary District 1911 DISTRICT TÁMOGATÁS IGÉNYLŐ LAP District Grants Application Form
1 A Future Vision pilot célja a Future Vision Plan (Jövőkép terv) egyszerűsített támogatási modelljének tesztelése, és a Rotaristák részvételének növelése a segélyezési folyamatokban. A teszt során a districteknek
2. Tavasz Kupa. Uszonyos és Búvárúszó Verseny Kiírása
2. Tavasz Kupa Uszonyos és Búvárúszó Verseny Kiírása 1,/ A verseny célja: Az uszonyos-, és búvárúszás népszerűsítése, versenyzők részére versenyzési lehetőség biztosítása. 2,/ A verseny rendezője: HÓD
Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz
Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz Kvantumkapuk, áramkörök 2016. március 3. A kvantummechanika posztulátumai (1-2) 1. Állapotleírás Zárt fizikai rendszer aktuális állapota
1. Gyakorlat: Telepítés: Windows Server 2008 R2 Enterprise, Core, Windows 7
1. Gyakorlat: Telepítés: Windows Server 2008 R2 Enterprise, Core, Windows 7 1.1. Új virtuális gép és Windows Server 2008 R2 Enterprise alap lemez létrehozása 1.2. A differenciális lemezek és a két új virtuális
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Correlation & Linear. Petra Petrovics.
Correlation & Linear Regression in SPSS Petra Petrovics PhD Student Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise
Intézményi IKI Gazdasági Nyelvi Vizsga
Intézményi IKI Gazdasági Nyelvi Vizsga Név:... Születési hely:... Születési dátum (év/hó/nap):... Nyelv: Angol Fok: Alapfok 1. Feladat: Olvasáskészséget mérő feladat 20 pont Olvassa el a szöveget és válaszoljon
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2008. május 26. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2008. május 26. 8:00 Az írásbeli vizsga időtartama: 180 perc Pótlapok száma Tisztázati Piszkozati OKTATÁSI
USA Befektetési Útmutató
USA Befektetési Útmutató COPYRIGHT OPISAS. ALL RIGHTS RESERVED. DISCLAIMER. All prices on this list are subject to change without notice. Whilst we make every effort to provide you the most accurate, up-to-date
SQL/PSM kurzorok rész
SQL/PSM kurzorok --- 2.rész Tankönyv: Ullman-Widom: Adatbázisrendszerek Alapvetés Második, átdolgozott kiadás, Panem, 2009 9.3. Az SQL és a befogadó nyelv közötti felület (sormutatók) 9.4. SQL/PSM Sémában
Adatbázis-kezelés ODBC driverrel
ADATBÁZIS-KEZELÉS ODBC DRIVERREL... 1 ODBC: OPEN DATABASE CONNECTIVITY (NYÍLT ADATBÁZIS KAPCSOLÁS)... 1 AZ ODBC FELÉPÍTÉSE... 2 ADATBÁZIS REGISZTRÁCIÓ... 2 PROJEKT LÉTREHOZÁSA... 3 A GENERÁLT PROJEKT FELÉPÍTÉSE...
ASUS GX800 lézeres játékegér
ASUS GX800 lézeres játékegér 1 6 Felhasználói kézikönyv HUG5761 Elsö kiadás (V1) Május 2010 Copyright 2010 ASUSTeK Computer Inc. All Rights Reserved. Az ASUSTeK COMPUTER INC. ( ASUS ) előzetes írásos engedélye
Affinium LED string lp w6300 P10
Affinium LED string lp w6300 P10 Termékcsalád leírás Komplett, egyszerűen felszerelhető, flexibilis vezetékre szerelt LED modulok Philips LED Power meghajtóval Ideális reklámvilágítás; nagyméretű betükhöz
Correlation & Linear Regression in SPSS
Correlation & Linear Regression in SPSS Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise 1 - Correlation File / Open
Szoftver-technológia II. Tervezési minták. Irodalom. Szoftver-technológia II.
Tervezési minták Irodalom Steven R. Schach: Object Oriented & Classical Software Engineering, McGRAW-HILL, 6th edition, 2005, chapter 8. E. Gamma, R. Helm, R. Johnson, J. Vlissides:Design patterns: Elements
Create & validate a signature
IOTA TUTORIAL 7 Create & validate a signature v.0.0 KNBJDBIRYCUGVWMSKPVA9KOOGKKIRCBYHLMUTLGGAV9LIIPZSBGIENVBQ9NBQWXOXQSJRIRBHYJ9LCTJLISGGBRFRTTWD ABBYUVKPYFDJWTFLICYQQWQVDPCAKNVMSQERSYDPSSXPCZLVKWYKYZMREAEYZOSPWEJLHHFPYGSNSUYRZXANDNQTTLLZA
Cut-Off Time for Payment Orders, Incoming Payments And Fulfilment Orders
Cut-Off Time for Payment Orders, Incoming Payments And Fulfilment Orders Effective from 1 st of January 2016 1 Cut-off times for the receipt of payment orders for same-day processing: On every business
Directors and Officers Liability Insurance Questionnaire Adatlap vezetõ tisztségviselõk és felügyelõbizottsági tagok felelõsségbiztosításához
Directors and Officers Liability Insurance Questionnaire Adatlap vezetõ tisztségviselõk és felügyelõbizottsági tagok felelõsségbiztosításához 1. Name, legal form and address of company Társaság neve, címe,
Az Open Data jogi háttere. Dr. Telek Eszter
Az Open Data jogi háttere Dr. Telek Eszter Egy kis ismétlés Open Data/Open Access/Open Knowledge gyökerei Open Source Software FLOSS (Free Libre Open Source Software) Szoftver esetében egyszerű alapok:
Utolsó frissítés / Last update: február Szerkesztő / Editor: Csatlós Árpádné
Utolsó frissítés / Last update: 2016. február Szerkesztő / Editor: Csatlós Árpádné TARTALOM / Contents BEVEZETŐ / Introduction... 2 FELNŐTT TAGBÉLYEGEK / Adult membership stamps... 3 IFJÚSÁGI TAGBÉLYEGEK
2015. október 1. Új időszámítás a rövid távú kapacitás termék értékesítésben. 1 October 2015 New era is to start in short term capacity allocation
2015. október 1. Új időszámítás a rövid távú kapacitás termék értékesítésben 1 October 2015 New era is to start in short term capacity allocation Kajtán Erika Kapacitásértékesítés vezető/head of Capacity
DECLARATION OF PERFORMANCE No. GST REV 1.03 According to Construction Products Regulation EU No. 305/2011
DECLARATION OF PERFORMANCE No. According to Construction Products Regulation EU No. 305/2011 This declaration is available in the following languages: English Declaration of Performance Page 2-3 Hungarian
Phenotype. Genotype. It is like any other experiment! What is a bioinformatics experiment? Remember the Goal. Infectious Disease Paradigm
It is like any other experiment! What is a bioinformatics experiment? You need to know your data/input sources You need to understand your methods and their assumptions You need a plan to get from point
bab.la Cümle Kalıpları: İş Sipariş İngilizce-Macarca
bab.la Cümle Kalıpları: İş Sipariş İngilizce-Macarca Sipariş : Verme We are considering the purchase of Gondolkozunk a... vásárlásán. Resmi, çekingen We are pleased to place an order with your company
bab.la Cümle Kalıpları: İş Sipariş Macarca-İngilizce
bab.la Cümle Kalıpları: İş Sipariş Macarca-İngilizce Sipariş : Verme Gondolkozunk a... vásárlásán. We are considering the purchase of Resmi, çekingen Örömmel tudatjuk, hogy szeretnénk Önöktől rendelni...
székhely: 1133 Budapest, Tutaj u. 6/A Registered office: 1133 Budapest, Tutaj u. 6/A
Átvállalási megállapodás a gyártó visszavételi és begyűjtési kötelezettségeinek átvállalásáról Agreement on Transfer of Responsibility in respect of the manufacturer s obligations to take back and collect