On The Number Of Slim Semimodular Lattices
|
|
- Lóránd Vass
- 5 évvel ezelőtt
- Látták:
Átírás
1 On The Number Of Slim Semimodular Lattices Gábor Czédli, Tamás Dékány, László Ozsvárt, Nóra Szakács, Balázs Udvari Bolyai Institute, University of Szeged Conference on Universal Algebra and Lattice Theory Dedicated to the 80-th birthday of Béla Csákány Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
2 Slim semimodular lattices Let Ji L denote the set of non-zero join-irreducible elements of the nite lattice L. Denition L is slim, if Ji L contains no 3-element antichain. L is a slim semimodular lattice (SSL), if it is slim and semimodular. Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
3 Slim semimodular lattices Let Ji L denote the set of non-zero join-irreducible elements of the nite lattice L. Denition L is slim, if Ji L contains no 3-element antichain. L is a slim semimodular lattice (SSL), if it is slim and semimodular. Motivation: Czédli and Schmidt proved that the duals of SSLs are exactly the composition series lattices of groups. Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
4 Slim semimodular lattices Let Ji L denote the set of non-zero join-irreducible elements of the nite lattice L. Denition L is slim, if Ji L contains no 3-element antichain. L is a slim semimodular lattice (SSL), if it is slim and semimodular. Motivation: Czédli and Schmidt proved that the duals of SSLs are exactly the composition series lattices of groups. Our goal: to count the SSLs of a given size (the size of L is the number of its elements). N ssl (n): the number of SSLs with the size of n. Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
5 Slim semimodular lattices Let Ji L denote the set of non-zero join-irreducible elements of the nite lattice L. Denition L is slim, if Ji L contains no 3-element antichain. L is a slim semimodular lattice (SSL), if it is slim and semimodular. Motivation: Czédli and Schmidt proved that the duals of SSLs are exactly the composition series lattices of groups. Our goal: to count the SSLs of a given size (the size of L is the number of its elements). N ssl (n): the number of SSLs with the size of n. Previous results: A recursive formula for every lattice of a given size (Heitzig, Reinhold). A recursive formula for the number of SSLs of a given length (Czédli, Ozsvárt, Udvari). Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
6 Example SSLs possess planar diagrams. Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
7 Overview of SSLs First, we will characterize the planar diagrams belonging to SSLs. Let D 1, D 2 two planar diagrams. Two planar diagrams, D 1 and D 2 are similar, if there is a lattice isomorphism ϕ for which if x y and x z in D 1 then y is to the left of z i ϕ(y) is to the left of ϕ(z). Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
8 Example These two diagrams are not similar, but they belong to the same lattice. Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
9 Permutations and diagrams 1. Consider a grid G = {0, 1,..., h} {0, 1,... h}. Let cell(i, j) = {(i, j), (i 1, j), (i, j 1), (i 1, j 1)}. Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
10 Permutations and diagrams 1. Consider a grid G = {0, 1,..., h} {0, 1,... h}. Let cell(i, j) = {(i, j), (i 1, j), (i, j 1), (i 1, j 1)}. Denote by con (cell(i, j)) the smallest join-congruence that collapses the top boundary of cell(i, j). Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
11 Permutations and diagrams 1. Consider a grid G = {0, 1,..., h} {0, 1,... h}. Let cell(i, j) = {(i, j), (i 1, j), (i, j 1), (i 1, j 1)}. Denote by con (cell(i, j)) the smallest join-congruence that collapses the top boundary of cell(i, j). Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
12 Permutations and diagrams 2. Let π S h. Consider β π = h i=1 con (cell(i, π(i))). Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
13 Permutations and diagrams 2. Let π S h. Consider β π = h i=1 con (cell(i, π(i))). Lemma G/β π is a slim semimodular diagram. Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
14 Permutations and diagrams 2. Let π S h. Consider β π = h i=1 con (cell(i, π(i))). Lemma G/β π is a slim semimodular diagram. Lemma The mapping π G/β π is a bijection between the elements of S h and the slim semimodular diagrams of length h. Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
15 Permutations and diagrams 2. Let π S h. Consider β π = h i=1 con (cell(i, π(i))). Lemma G/β π is a slim semimodular diagram. Lemma The mapping π G/β π is a bijection between the elements of S h and the slim semimodular diagrams of length h. In other words, we can count permutations instead of SSLs. We only need to know two more things: Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
16 Permutations and diagrams 2. Let π S h. Consider β π = h i=1 con (cell(i, π(i))). Lemma G/β π is a slim semimodular diagram. Lemma The mapping π G/β π is a bijection between the elements of S h and the slim semimodular diagrams of length h. In other words, we can count permutations instead of SSLs. We only need to know two more things: 1. What is the size of the SSL belonging to a permutation? Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
17 Permutations and diagrams 2. Let π S h. Consider β π = h i=1 con (cell(i, π(i))). Lemma G/β π is a slim semimodular diagram. Lemma The mapping π G/β π is a bijection between the elements of S h and the slim semimodular diagrams of length h. In other words, we can count permutations instead of SSLs. We only need to know two more things: 1. What is the size of the SSL belonging to a permutation? 2. We must know whether two permutations belong to the same SSL or not. Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
18 Permutations and diagrams 3. - another example Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
19 Permutations determine the size Let inv(π) denote the number of inversions in π S h, that is, the number of (i, j) ( h 2) for which i < j and π(i) > π(j). Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
20 Permutations determine the size Let inv(π) denote the number of inversions in π S h, that is, the number of (i, j) ( h 2) for which i < j and π(i) > π(j). Proposition Let K be the lattice belonging to the h h grid G and π S h. Then K/β π = h inv(π). Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
21 Permutations belonging to the same lattice 1. Let π S h. The interval S = [i,..., j] is a segment of π if π(s) = S, π({1,..., i 1}) = {1,..., i 1}, π({j + 1,..., h}) = {j + 1,..., h}, and there is no [i,..., j ] S with the same property. Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
22 Permutations belonging to the same lattice 1. Let π S h. The interval S = [i,..., j] is a segment of π if π(s) = S, π({1,..., i 1}) = {1,..., i 1}, π({j + 1,..., h}) = {j + 1,..., h}, and there is no [i,..., j ] S with the same property. Denition For π 1, π 2 S h, π 1 π 2 if their segments are the same and for each segment S: π 2 S = π 1 S or π 2 S = (π 1 S ) 1. For example: ( ) ( ) Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
23 Permutations belonging to the same lattice 2. Lemma Let π, σ S h. The SSLs G/β π and G/β σ are isomorphic i π σ. Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
24 Counting 1. P(h, k) := {π S h : inv(π) = k}, p(h, k) := P(h, k). Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
25 Counting 1. P(h, k) := {π S h : inv(π) = k}, p(h, k) := P(h, k). We can determine p(h, k) using its generating function: Theorem (Rodriguez) ( 2) h p(h, j)x j = h 1 x j j=0 j=1 1 x. Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
26 Counting 2. Let I (h, k) = {π S h : inv(π) = k, π 2 = id}, i(h, k) := I (h, k). Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
27 Counting 2. Let I (h, k) = {π S h : inv(π) = k, π 2 = id}, i(h, k) := I (h, k). Proposition i(h, k) = i(h 1, k) + h i(h 2, k 2s + 3). s=2 Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
28 Counting 3. Denition π S h is irreducible, if it consists of one segment. Let Î (h, k) = {π S h : inv(π) = k, π 2 = id, π is irreducible}, î(h, k) := Î (h, k). Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
29 Counting 3. Denition π S h is irreducible, if it consists of one segment. Let Î (h, k) = {π S h : inv(π) = k, π 2 = id, π is irreducible}, î(h, k) := Î (h, k). Proposition î(h, k) = i(h, k) h 1 k î(s, t)i(h s, k t). s=1 t=0 Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
30 Counting 4. Let ˆP(h, k) = {π S h : inv(π) = k, π is irreducible}, ˆp(h, k) := ˆP(h, k). Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
31 Counting 4. Let ˆP(h, k) = {π S h : inv(π) = k, π is irreducible}, ˆp(h, k) := ˆP(h, k). Proposition ˆp(h, k) = p(h, k) h 1 k ˆp(s, t)p(h s, k t). s=1 t=0 Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
32 Counting 5. Denote by [π] the -class of π. Let P (h, k) = {[π] : inv(π) = k, π S h }, p (h, k) := P (h, k). Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
33 Counting 5. Denote by [π] the -class of π. Let P (h, k) = {[π] : inv(π) = k, π S h }, p (h, k) := P (h, k). Proposition p (h, k) = 1 2 h s=1 k t=0 (ˆp(s, t) + î(s, t))p (h s, k t). Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
34 Counting 5. Denote by [π] the -class of π. Let P (h, k) = {[π] : inv(π) = k, π S h }, p (h, k) := P (h, k). Proposition p (h, k) = 1 2 h s=1 k t=0 (ˆp(s, t) + î(s, t))p (h s, k t). Finally, Theorem N ssl (n) = n 1 h=0 p (h, n h 1). Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
35 Results with computer algebra 1. N ssl (1) = N ssl (2) = N ssl (3) = 1, N ssl (4) = 2, N ssl (5) = 3, N ssl (6) = 5, N ssl (7) = 9. Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
36 Results with computer algebra 2. N ssl (50) = 14, 546, 017, 036, (This was computed on a typical PC in a few hours). The recursion by Heitzig and Reinhold for the number of all lattices of size n takes far more time to compute the exact number is known only up to n = 18. Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
37 Results with computer algebra 2. N ssl (50) = 14, 546, 017, 036, (This was computed on a typical PC in a few hours). The recursion by Heitzig and Reinhold for the number of all lattices of size n takes far more time to compute the exact number is known only up to n = 18. Also, we proved that the number of slim, semimodular, planar lattice diagrams of size n is asymptotically a constant times 2 n. Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
38 Results with computer algebra 2. N ssl (50) = 14, 546, 017, 036, (This was computed on a typical PC in a few hours). The recursion by Heitzig and Reinhold for the number of all lattices of size n takes far more time to compute the exact number is known only up to n = 18. Also, we proved that the number of slim, semimodular, planar lattice diagrams of size n is asymptotically a constant times 2 n. Recently we used permutations in a similar way to improve our previous recursion for SSLs of length h. Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
39 Thank you for your attention! Our paper's preprint can be viewed at czedli Czédli,Dékány,Ozsvárt,Szakács,Udvari Slim Semimodular Lattices Szeged, / 19
Mapping Sequencing Reads to a Reference Genome
Mapping Sequencing Reads to a Reference Genome High Throughput Sequencing RN Example applications: Sequencing a genome (DN) Sequencing a transcriptome and gene expression studies (RN) ChIP (chromatin immunoprecipitation)
Construction of a cube given with its centre and a sideline
Transformation of a plane of projection Construction of a cube given with its centre and a sideline Exercise. Given the center O and a sideline e of a cube, where e is a vertical line. Construct the projections
Correlation & Linear Regression in SPSS
Petra Petrovics Correlation & Linear Regression in SPSS 4 th seminar Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Correlation
TestLine - Angol teszt Minta feladatsor
Minta felaatsor venég Téma: Általános szintfelmérő Aláírás:... Dátum: 2016.05.29 08:18:49 Kérések száma: 25 kérés Kitöltési iő: 1:17:27 Nehézség: Összetett Pont egység: +6-2 Értékelés: Alaértelmezett értékelés
Genome 373: Hidden Markov Models I. Doug Fowler
Genome 373: Hidden Markov Models I Doug Fowler Review From Gene Prediction I transcriptional start site G open reading frame transcriptional termination site promoter 5 untranslated region 3 untranslated
Create & validate a signature
IOTA TUTORIAL 7 Create & validate a signature v.0.0 KNBJDBIRYCUGVWMSKPVA9KOOGKKIRCBYHLMUTLGGAV9LIIPZSBGIENVBQ9NBQWXOXQSJRIRBHYJ9LCTJLISGGBRFRTTWD ABBYUVKPYFDJWTFLICYQQWQVDPCAKNVMSQERSYDPSSXPCZLVKWYKYZMREAEYZOSPWEJLHHFPYGSNSUYRZXANDNQTTLLZA
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Hypothesis Testing. Petra Petrovics.
Hypothesis Testing Petra Petrovics PhD Student Inference from the Sample to the Population Estimation Hypothesis Testing Estimation: how can we determine the value of an unknown parameter of a population
Statistical Inference
Petra Petrovics Statistical Inference 1 st lecture Descriptive Statistics Inferential - it is concerned only with collecting and describing data Population - it is used when tentative conclusions about
Erdős-Ko-Rado theorems on the weak Bruhat lattice
Erdős-Ko-Rado theorems on the weak Bruhat lattice arxiv:1904.01436v1 [math.co] 2 Apr 2019 Susanna Fishel, Glenn Hurlbert, Vikram Kamat, Karen Meagher April 3, 2019 Abstract Let L = (X, ) be a lattice.
3. MINTAFELADATSOR KÖZÉPSZINT. Az írásbeli vizsga időtartama: 30 perc. III. Hallott szöveg értése
Oktatáskutató és Fejlesztő Intézet TÁMOP-3.1.1-11/1-2012-0001 XXI. századi közoktatás (fejlesztés, koordináció) II. szakasz ANGOL NYELV 3. MINTAFELADATSOR KÖZÉPSZINT Az írásbeli vizsga időtartama: 30 perc
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Nonparametric Tests
Nonparametric Tests Petra Petrovics Hypothesis Testing Parametric Tests Mean of a population Population proportion Population Standard Deviation Nonparametric Tests Test for Independence Analysis of Variance
Phenotype. Genotype. It is like any other experiment! What is a bioinformatics experiment? Remember the Goal. Infectious Disease Paradigm
It is like any other experiment! What is a bioinformatics experiment? You need to know your data/input sources You need to understand your methods and their assumptions You need a plan to get from point
Véges szavak általánosított részszó-bonyolultsága
Véges szavak általánosított részszó-bonyolultsága KÁSA Zoltán Sapientia Erdélyi Magyar Tudományegyetem Kolozsvár Marosvásárhely Csíkszereda Matematika-Informatika Tanszék, Marosvásárhely Budapest, 2010.
Word and Polygon List for Obtuse Triangular Billiards II
Word and Polygon List for Obtuse Triangular Billiards II Richard Evan Schwartz August 19, 2008 Abstract This is the list of words and polygons we use for our paper. 1 Notation To compress our notation
A logaritmikus legkisebb négyzetek módszerének karakterizációi
A logaritmikus legkisebb négyzetek módszerének karakterizációi Csató László laszlo.csato@uni-corvinus.hu MTA Számítástechnikai és Automatizálási Kutatóintézet (MTA SZTAKI) Operációkutatás és Döntési Rendszerek
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Correlation & Linear. Petra Petrovics.
Correlation & Linear Regression in SPSS Petra Petrovics PhD Student Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Nonparametric Tests. Petra Petrovics.
Nonparametric Tests Petra Petrovics PhD Student Hypothesis Testing Parametric Tests Mean o a population Population proportion Population Standard Deviation Nonparametric Tests Test or Independence Analysis
Tudományos Ismeretterjesztő Társulat
Sample letter number 5. International Culture Festival PO Box 34467 Harrogate HG 45 67F Sonnenbergstraße 11a CH-6005 Luzern Re: Festival May 19, 2009 Dear Ms Atkinson, We are two students from Switzerland
Using the CW-Net in a user defined IP network
Using the CW-Net in a user defined IP network Data transmission and device control through IP platform CW-Net Basically, CableWorld's CW-Net operates in the 10.123.13.xxx IP address range. User Defined
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY A feladatsor három részbol áll 1. A vizsgáztató társalgást kezdeményez a vizsgázóval. 2. A vizsgázó egy szituációs feladatban vesz részt a
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében. Dicse Jenő üzletfejlesztési igazgató
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében Dicse Jenő üzletfejlesztési igazgató How to apply modern e-learning to improve the training of firefighters Jenő Dicse Director of
Dependency preservation
Adatbázis-kezelés. (4 előadás: Relácó felbontásai (dekomponálás)) 1 Getting lossless decomposition is necessary. But of course, we also want to keep dependencies, since losing a dependency means, that
Statistical Dependence
Statistical Dependence Petra Petrovics Statistical Dependence Deinition: Statistical dependence exists when the value o some variable is dependent upon or aected by the value o some other variable. Independent
Széchenyi István Egyetem www.sze.hu/~herno
Oldal: 1/6 A feladat során megismerkedünk a C# és a LabVIEW összekapcsolásának egy lehetőségével, pontosabban nagyon egyszerű C#- ban írt kódból fordítunk DLL-t, amit meghívunk LabVIEW-ból. Az eljárás
(NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV
Kommunikációs rendszerek programozása (NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV (5. mérés) SIP telefonközpont készítése Trixbox-szal 1 Mérés helye: Széchenyi István Egyetem, L-1/7 laboratórium, 9026 Győr, Egyetem
Tavaszi Sporttábor / Spring Sports Camp. 2016. május 27 29. (péntek vasárnap) 27 29 May 2016 (Friday Sunday)
Tavaszi Sporttábor / Spring Sports Camp 2016. május 27 29. (péntek vasárnap) 27 29 May 2016 (Friday Sunday) SZÁLLÁS / ACCOMODDATION on a Hotel Gellért*** szálloda 2 ágyas szobáiban, vagy 2x2 ágyas hostel
Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz
Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz Kvantumkapuk, áramkörök 2016. március 3. A kvantummechanika posztulátumai (1-2) 1. Állapotleírás Zárt fizikai rendszer aktuális állapota
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel Timea Farkas Click here if your download doesn"t start
Correlation & Linear Regression in SPSS
Correlation & Linear Regression in SPSS Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise 1 - Correlation File / Open
Proxer 7 Manager szoftver felhasználói leírás
Proxer 7 Manager szoftver felhasználói leírás A program az induláskor elkezdi keresni az eszközöket. Ha van olyan eszköz, amely virtuális billentyűzetként van beállítva, akkor azokat is kijelzi. Azokkal
Relative Clauses Alárendelő mellékmondat
Relative Clauses Alárendelő mellékmondat We use relative clauses to give additional information about something without starting another sentence. By combining sentences with a relative clause, your text
USER MANUAL Guest user
USER MANUAL Guest user 1 Welcome in Kutatótér (Researchroom) Top menu 1. Click on it and the left side menu will pop up 2. With the slider you can make left side menu visible 3. Font side: enlarging font
First experiences with Gd fuel assemblies in. Tamás Parkó, Botond Beliczai AER Symposium 2009.09.21 25.
First experiences with Gd fuel assemblies in the Paks NPP Tams Parkó, Botond Beliczai AER Symposium 2009.09.21 25. Introduction From 2006 we increased the heat power of our units by 8% For reaching this
JEROMOS A BARATOM PDF
JEROMOS A BARATOM PDF ==> Download: JEROMOS A BARATOM PDF JEROMOS A BARATOM PDF - Are you searching for Jeromos A Baratom Books? Now, you will be happy that at this time Jeromos A Baratom PDF is available
Nemzetközi Kenguru Matematikatábor
Nemzetközi Kenguru Matematikatábor 2011. augusztus 19-27., Werbellinsee, Németország BESZÁMOLÓ Bevezető Idén hetedik alkalommal került megrendezére a Nemzetközi Kenguru Matematikatábor (7. Internationale
Tudományos Ismeretterjesztő Társulat
Sample letter number 3. Russell Ltd. 57b Great Hawthorne Industrial Estate Hull East Yorkshire HU 19 5BV 14 Bebek u. Budapest H-1105 10 December, 2009 Ref.: complaint Dear Sir/Madam, After seeing your
NYOMÁSOS ÖNTÉS KÖZBEN ÉBREDŐ NYOMÁSVISZONYOK MÉRÉTECHNOLÓGIAI TERVEZÉSE DEVELOPMENT OF CAVITY PRESSURE MEASUREMENT FOR HIGH PRESURE DIE CASTING
Anyagmérnöki Tudományok, 39/1 (2016) pp. 82 86. NYOMÁSOS ÖNTÉS KÖZBEN ÉBREDŐ NYOMÁSVISZONYOK MÉRÉTECHNOLÓGIAI TERVEZÉSE DEVELOPMENT OF CAVITY PRESSURE MEASUREMENT FOR HIGH PRESURE DIE CASTING LEDNICZKY
There is/are/were/was/will be
There is/are/were/was/will be Forms - Képzése: [There + to be] [There + létige ragozott alakja] USE - HASZNÁLAT If you simply want to say that something exists or somebody is doing something then you start
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY A feladatsor három részből áll 1. A vizsgáztató társalgást kezdeményez a vizsgázóval. 2. A vizsgázó egy szituációs feladatban vesz részt a
Unit 10: In Context 55. In Context. What's the Exam Task? Mediation Task B 2: Translation of an informal letter from Hungarian to English.
Unit 10: In Context 55 UNIT 10 Mediation Task B 2 Hungarian into English In Context OVERVIEW 1. Hungarian and English in Context 2. Step By Step Exam Techniques Real World Link Students who have studied
T Á J É K O Z T A T Ó. A 1108INT számú nyomtatvány a http://www.nav.gov.hu webcímen a Letöltések Nyomtatványkitöltő programok fülön érhető el.
T Á J É K O Z T A T Ó A 1108INT számú nyomtatvány a http://www.nav.gov.hu webcímen a Letöltések Nyomtatványkitöltő programok fülön érhető el. A Nyomtatványkitöltő programok fület választva a megjelenő
MATEMATIKA ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2014. október 14. MATEMATIKA ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2014. október 14. 8:00 I. Időtartam: 45 perc Pótlapok száma Tisztázati Piszkozati EMBERI ERŐFORRÁSOK MINISZTÉRIUMA
Többszörösen élesen tranzitív halmazok véges csoportokban
Többszörösen élesen tranzitív halmazok véges csoportokban habilitációs tudományos előadás Nagy Gábor Péter Szegedi Tudományegyetem Bolyai Intézet, Geometria Tanszék 2013. március 12. 1 / 19 Áttekintés
ANGOL NYELVI SZINTFELMÉRŐ 2012 A CSOPORT. to into after of about on for in at from
ANGOL NYELVI SZINTFELMÉRŐ 2012 A CSOPORT A feladatok megoldására 45 perc áll rendelkezésedre, melyből körülbelül 10-15 percet érdemes a levélírási feladatra szánnod. Sok sikert! 1. Válaszd ki a helyes
Budapest By Vince Kiado, Klösz György
Budapest 1900 2000 By Vince Kiado, Klösz György Download Ebook : budapest 1900 2000 in PDF Format. also available for mobile reader If you are looking for a book Budapest 1900-2000 by Vince Kiado;Klosz
ANGOL NYELVI SZINTFELMÉRŐ 2013 A CSOPORT. on of for from in by with up to at
ANGOL NYELVI SZINTFELMÉRŐ 2013 A CSOPORT A feladatok megoldására 45 perc áll rendelkezésedre, melyből körülbelül 10-15 percet érdemes a levélírási feladatra szánnod. Sok sikert! 1. Válaszd ki a helyes
Alternating Permutations
Alternating Permutations Richard P. Stanley M.I.T. Definitions A sequence a 1, a 2,..., a k of distinct integers is alternating if a 1 > a 2 < a 3 > a 4 a 3
Lopocsi Istvánné MINTA DOLGOZATOK FELTÉTELES MONDATOK. (1 st, 2 nd, 3 rd CONDITIONAL) + ANSWER KEY PRESENT PERFECT + ANSWER KEY
Lopocsi Istvánné MINTA DOLGOZATOK FELTÉTELES MONDATOK (1 st, 2 nd, 3 rd CONDITIONAL) + ANSWER KEY PRESENT PERFECT + ANSWER KEY FELTÉTELES MONDATOK 1 st, 2 nd, 3 rd CONDITIONAL I. A) Egészítsd ki a mondatokat!
MATEMATIKA ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2018. május 8. MATEMATIKA ANGOL NYELVEN EMELT SZINTŰ ÍRÁSBELI VIZSGA 2018. május 8. 8:00 Időtartam: 300 perc Pótlapok száma Tisztázati Piszkozati EMBERI ERŐFORRÁSOK MINISZTÉRIUMA Matematika
STUDENT LOGBOOK. 1 week general practice course for the 6 th year medical students SEMMELWEIS EGYETEM. Name of the student:
STUDENT LOGBOOK 1 week general practice course for the 6 th year medical students Name of the student: Dates of the practice course: Name of the tutor: Address of the family practice: Tel: Please read
MATEMATIKA ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2014. május 6. MATEMATIKA ANGOL NYELVEN EMELT SZINTŰ ÍRÁSBELI VIZSGA 2014. május 6. 8:00 Az írásbeli vizsga időtartama: 240 perc Pótlapok száma Tisztázati Piszkozati EMBERI ERŐFORRÁSOK
KELET-ÁZSIAI DUPLANÁDAS HANGSZEREK ÉS A HICHIRIKI HASZNÁLATA A 20. SZÁZADI ÉS A KORTÁRS ZENÉBEN
Liszt Ferenc Zeneművészeti Egyetem 28. számú művészet- és művelődéstörténeti tudományok besorolású doktori iskola KELET-ÁZSIAI DUPLANÁDAS HANGSZEREK ÉS A HICHIRIKI HASZNÁLATA A 20. SZÁZADI ÉS A KORTÁRS
Probabilistic Analysis and Randomized Algorithms. Alexandre David B2-206
Probabilistic Analysis and Randomized Algorithms Alexandre David B2-206 Today Counting. Basic probability. Appendix C Introduction to randomized algorithms. Chapter 5 27-10-2006 AA1 2 Counting Rule of
Szundikáló macska Sleeping kitty
Model: Peter Budai 999. Diagrams: Peter Budai 999.. Oda-visszahajtás átlósan. Fold and unfold diagonally. 2. Behajtunk középre. Fold to the center. 3. Oda-visszahajtások derékszögben. Fold and unfold at
Ister-Granum EGTC. Istvan FERENCSIK Project manager. The Local Action Plans to improve project partners crossborder
Expertising Governance for Transfrontier Conurbations Ister-Granum EGTC Istvan FERENCSIK Project manager The Local Action Plans to improve project partners crossborder governance «EGTC» URBACT Final conference
Gottsegen National Institute of Cardiology. Prof. A. JÁNOSI
Myocardial Infarction Registry Pilot Study Hungarian Myocardial Infarction Register Gottsegen National Institute of Cardiology Prof. A. JÁNOSI A https://ir.kardio.hu A Web based study with quality assurance
AZ ACM NEMZETKÖZI PROGRAMOZÓI VERSENYE
AZ ACM NEMZETKÖZI PROGRAMOZÓI VERSENYE Kuki Attila, kuki@math.klte.hu Kossuth Lajos Tudományegyetem, Információ Technológia Tanszék Abstract This paper is dedicated to the Scholastic Programming Contest
MATEMATIKA ANGOL NYELVEN MATHEMATICS
ÉRETTSÉGI VIZSGA 2005. május 10. MATEMATIKA ANGOL NYELVEN MATHEMATICS EMELT SZINTŰ ÍRÁSBELI VIZSGA HIGHER LEVEL WRITTEN EXAMINATION Az írásbeli vizsga időtartama: 240 perc Time allowed for the examination:
ANGOL MAGYAR PARBESZEDEK ES PDF
ANGOL MAGYAR PARBESZEDEK ES PDF ==> Download: ANGOL MAGYAR PARBESZEDEK ES PDF ANGOL MAGYAR PARBESZEDEK ES PDF - Are you searching for Angol Magyar Parbeszedek Es Books? Now, you will be happy that at this
Üzleti élet Nyitás. Nagyon hivatalos, a címzettnek meghatározott rangja van, aminek szerepelnie kell
- Nyitás angol magyar Dear Mr. President, Tisztelt Elnök Úr! Nagyon hivatalos, a címzettnek meghatározott rangja van, aminek szerepelnie kell Dear Sir, Hivatalos, férfi címzett, ismeretlen név Dear Madam,
Please stay here. Peter asked me to stay there. He asked me if I could do it then. Can you do it now?
Eredeti mondat Please stay here. Kérlek, maradj itt. Can you do it now? Meg tudod csinálni most? Will you help me tomorrow? Segítesz nekem holnap? I ll stay at home today. Ma itthon maradok. I woke up
Utasítások. Üzembe helyezés
HASZNÁLATI ÚTMUTATÓ Üzembe helyezés Utasítások Windows XP / Vista / Windows 7 / Windows 8 rendszerben történő telepítéshez 1 Töltse le az AORUS makróalkalmazás telepítőjét az AORUS hivatalos webhelyéről.
Üzleti élet Nyitás. Nagyon hivatalos, a címzettnek meghatározott rangja van, aminek szerepelnie kell
- Nyitás magyar angol Tisztelt Elnök Úr! Dear Mr. President, Nagyon hivatalos, a címzettnek meghatározott rangja van, aminek szerepelnie kell Tisztelt Uram! Hivatalos, férfi címzett, ismeretlen név Tisztelt
Learn how to get started with Dropbox: Take your stuff anywhere. Send large files. Keep your files safe. Work on files together. Welcome to Dropbox!
Learn how to get started with Dropbox: 1 2 3 4 Keep your files safe Take your stuff anywhere Send large files Work on files together Welcome to Dropbox! 1 Keep your files safe Dropbox lets you save docs,
Contact us Toll free (800) fax (800)
Table of Contents Thank you for purchasing our product, your business is greatly appreciated. If you have any questions, comments, or concerns with the product you received please contact the factory.
Előszó.2. Starter exercises. 3. Exercises for kids.. 9. Our comic...17
2011. december Tartalom Előszó.2 Starter exercises. 3 Exercises for kids.. 9 Our comic....17 1 Előszó Kedves angolul tanulók! A 2010/2011- es tanévben elkezdett újságunkat szeretnénk továbbra is szerkeszteni
Regional Expert Meeting Livestock based Geographical Indication chains as an entry point to maintain agro-biodiversity
How Code of Practice can address the question of biodiversity (indigenous breeds, peculiarities of feeding, rearing traditional or marginalized systems)? Rendek Olga, Kerekegyháza 2009 október 20. 1 2
discosnp demo - Peterlongo Pierre 1 DISCOSNP++: Live demo
discosnp demo - Peterlongo Pierre 1 DISCOSNP++: Live demo Download and install discosnp demo - Peterlongo Pierre 3 Download web page: github.com/gatb/discosnp Chose latest release (2.2.10 today) discosnp
PONTOS IDŐ MEGADÁSA. Néha szükséges lehet megjelölni, hogy délelőtti vagy délutáni / esti időpontról van-e szó. Ezt kétféle képpen tehetjük meg:
PONTOS IDŐ MEGADÁSA EGÉSZ ÓRÁK MEGADÁSA ( óra van. ) Az óra száma után tesszük az o clock kifejezést. pl. It s 7 o clock. (7 óra van.) A britek az órák számát csak 12-ig mérik. Náluk nincs pl. 22 óra!
ACTA ACADEMIAE PAEDAGOGICAE AGRIENSIS
Separatum ACTA ACADEMIAE PAEDAGOGICAE AGRIESIS OVA SERIES TOM. XXII. SECTIO MATEMATICAE TÓMÁCS TIBOR Egy rekurzív sorozat tagjainak átlagáról EGER, 994 Egy rekurzív sorozat tagjainak átlagáról TÓMÁCS TIBOR
EXKLUZÍV AJÁNDÉKANYAGOD A Phrasal Verb hadsereg! 2. rész
A Phrasal Verb hadsereg! 2. rész FONTOS! Ha ennek az ajándékanyag sorozatnak nem láttad az 1. részét, akkor mindenképpen azzal kezdd! Fekete Gábor www.goangol.hu A sorozat 1. részét itt éred el: www.goangol.hu/ajandekok/phrasalverbs
A rosszindulatú daganatos halálozás változása 1975 és 2001 között Magyarországon
A rosszindulatú daganatos halálozás változása és között Eredeti közlemény Gaudi István 1,2, Kásler Miklós 2 1 MTA Számítástechnikai és Automatizálási Kutató Intézete, Budapest 2 Országos Onkológiai Intézet,
Választási modellek 3
Választási modellek 3 Prileszky István Doktori Iskola 2018 http://www.sze.hu/~prile Forrás: A Self Instructing Course in Mode Choice Modeling: Multinomial and Nested Logit Models Prepared For U.S. Department
Supporting Information
Supporting Information Cell-free GFP simulations Cell-free simulations of degfp production were consistent with experimental measurements (Fig. S1). Dual emmission GFP was produced under a P70a promoter
Expansion of Red Deer and afforestation in Hungary
Expansion of Red Deer and afforestation in Hungary László Szemethy, Róbert Lehoczki, Krisztián Katona, Norbert Bleier, Sándor Csányi www.vmi.szie.hu Background and importance large herbivores are overpopulated
Combinatorics, Paul Erd}os is Eighty (Volume 2) Keszthely (Hungary), 1993, pp. 1{46. Dedicated to the marvelous random walk
BOLYAI SOCIETY MATHEMATICAL STUDIES, 2 Combinatorics, Paul Erd}os is Eighty (Volume 2) Keszthely (Hungary), 1993, pp. 1{46. Random Walks on Graphs: A Survey L. LOV ASZ Dedicated to the marvelous random
Modeling the ecological collapse of Easter Island
szakdolgozat Modeling the ecological collapse of Easter Island Takács Bálint Máté Alkalmazott Matematikus MSc hallgató Témavezet k: Faragó István egyetemi tanár ELTE Alkalmazott Analízis és Számításmatematikai
Minden amerikanisztika szakos vegye fel az az alábbi elıadásokat (a
Frissítve: aug 29. Tanszéki honlap: http://elteal.ieas-szeged.hu/ Tájékoztató elsıéves BA angol/amerikanisztika és angol/amerikanisztika minor szakos diákoknak az ıszi félévrıl Elıadások: Minden angol
Hogyan használja az OROS online pótalkatrész jegyzéket?
Hogyan használja az OROS online pótalkatrész jegyzéket? Program indítása/program starts up Válassza ki a weblap nyelvét/choose the language of the webpage Látogasson el az oros.hu weboldalra, majd klikkeljen
MAGYARORSZAG UJJAEPITESE ES PDF
MAGYARORSZAG UJJAEPITESE ES PDF ==> Download: MAGYARORSZAG UJJAEPITESE ES PDF MAGYARORSZAG UJJAEPITESE ES PDF - Are you searching for Magyarorszag Ujjaepitese Es Books? Now, you will be happy that at this
Intézményi IKI Gazdasági Nyelvi Vizsga
Intézményi IKI Gazdasági Nyelvi Vizsga Név:... Születési hely:... Születési dátum (év/hó/nap):... Nyelv: Angol Fok: Alapfok 1. Feladat: Olvasáskészséget mérő feladat 20 pont Olvassa el a szöveget és válaszoljon
PETER PAZMANY CATHOLIC UNIVERSITY Consortium members SEMMELWEIS UNIVERSITY, DIALOG CAMPUS PUBLISHER
SEMMELWEIS UNIVERSITY PETER PAMANY CATLIC UNIVERSITY Development of Complex Curricula for Molecular Bionics and Infobionics Programs within a consortial* framework** Consortium leader PETER PAMANY CATLIC
PIACI HIRDETMÉNY / MARKET NOTICE
PIACI HIRDETMÉNY / MARKET NOTICE HUPX DAM Másnapi Aukció / HUPX DAM Day-Ahead Auction Iktatási szám / Notice #: Dátum / Of: 18/11/2014 HUPX-MN-DAM-2014-0023 Tárgy / Subject: Változások a HUPX másnapi piac
MATEMATIKA ANGOL NYELVEN
ÉRETTSÉGI VIZSGA MATEMATIKA ANGOL NYELVEN EMELT SZINTŰ ÍRÁSBELI VIZSGA 8:00 Az írásbeli vizsga időtartama: 240 perc Pótlapok száma Tisztázati Piszkozati OKTATÁSI ÉS KULTURÁLIS MINISZTÉRIUM Matematika angol
Daloló Fülelő Halász Judit Szabó T. Anna: Tatoktatok Javasolt nyelvi szint: A2 B1 / Resommended European Language Level: A2 B1
Daloló Fülelő Halász Judit Szabó T. Anna: Tatoktatok Javasolt nyelvi szint: A2 B1 / Resommended European Language Level: A2 B1 1. Első hallgatás / First listening Hallgassa meg Halász Judit dalát a Youtube-on!
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 200. május 4. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 200. május 4. 8:00 Az írásbeli vizsga időtartama: 80 perc Pótlapok száma Tisztázati Piszkozati OKTATÁSI
Adatbázisok 1. Rekurzió a Datalogban és SQL-99
Adatbázisok 1 Rekurzió a Datalogban és SQL-99 Expressive Power of Datalog Without recursion, Datalog can express all and only the queries of core relational algebra. The same as SQL select-from-where,
Vasúti kocsik vázszerkezetének a felhasználhatósága kisebb nyílások áthidalására helyi érdek8 közúti utakon
Vasúti kocsik vázszerkezetének a felhasználhatósága kisebb nyílások áthidalására helyi érdek8 közúti utakon Dr. Köll Gábor, Dr. Petru oga, "tefan Gu$iu, C&t&lin oga Kolozsvári szaki Egyetem Abstract This
Cluster Analysis. Potyó László
Cluster Analysis Potyó László What is Cluster Analysis? Cluster: a collection of data objects Similar to one another within the same cluster Dissimilar to the objects in other clusters Cluster analysis
Madonna novellái. 1. szint Július. Madonna képekkel illusztrált novelláskötetet(1) jelentet meg
1. szint Július Madonna novellái Madonna képekkel illusztrált novelláskötetet(1) jelentet meg Madonna képekkel illusztrált novelláskötetet jelentet meg(2) idén(3) szeptember 15-én. Egyébként(12) a következő
ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP
ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP CHILD S DATA / GYERMEK ADATAI PLEASE FILL IN THIS INFORMATION WITH DATA BASED ON OFFICIAL DOCUMENTS / KÉRJÜK, TÖLTSE KI A HIVATALOS DOKUMENTUMOKBAN SZEREPLŐ ADATOK
1. MINTAFELADATSOR KÖZÉPSZINT. Az írásbeli vizsga időtartama: 30 perc. III. Hallott szöveg értése
Oktatáskutató és Fejlesztő Intézet TÁMOP-3.1.1-11/1-2012-0001 XXI. századi közoktatás (fejlesztés, koordináció) II. szakasz ANGOL NYELV 1. MINTAFELADATSOR KÖZÉPSZINT Az írásbeli vizsga időtartama: 30 perc
Descriptive Statistics
Descriptive Statistics Petra Petrovics DESCRIPTIVE STATISTICS Definition: Descriptive statistics is concerned only with collecting and describing data Methods: - statistical tables and graphs - descriptive
Characterizations and Properties of Graphs of Baire Functions
Characterizations and Properties of Graphs of Baire Functions BSc Szakdolgozat Szerz : Témavezet : Maga Balázs Buczolich Zoltán Matematika BSc Matematikus Egyetemi tanár Analízis Tanszék Eötvös Loránd
MATEMATIKA ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2011. május 3. MATEMATIKA ANGOL NYELVEN EMELT SZINTŰ ÍRÁSBELI VIZSGA 2011. május 3. 8:00 Az írásbeli vizsga időtartama: 240 perc Pótlapok száma Tisztázati Piszkozati NEMZETI ERŐFORRÁS
HALLGATÓI KÉRDŐÍV ÉS TESZT ÉRTÉKELÉSE
HALLGATÓI KÉRDŐÍV ÉS TESZT ÉRTÉKELÉSE EVALUATION OF STUDENT QUESTIONNAIRE AND TEST Daragó László, Dinyáné Szabó Marianna, Sára Zoltán, Jávor András Semmelweis Egyetem, Egészségügyi Informatikai Fejlesztő
EPILEPSY TREATMENT: VAGUS NERVE STIMULATION. Sakoun Phommavongsa November 12, 2013
EPILEPSY TREATMENT: VAGUS NERVE STIMULATION Sakoun Phommavongsa November 12, 2013 WHAT IS EPILEPSY? A chronic neurological disorder characterized by having two or more unprovoked seizures Affects nearly
Ismeri Magyarországot?
instrukciók Instrukciók angolul Preparation: print out the worksheets You will need: a dictionary Time: 25-30 minutes With this worksheet, you will learn and share basic information about the location
A golyók felállítása a Pool-biliárd 8-as játékának felel meg. A golyók átmérıje 57.2 mm. 15 számozott és egy fehér golyó. Az elsı 7 egyszínő, 9-15-ig
A golyók elhelyezkedése a Snooker alaphelyzetet mutatja. A golyók átmérıje 52 mm, egyszínőek. 15 db piros, és 1-1 db fehér, fekete, rózsa, kék, barna, zöld, sárga. A garázsban állítjuk fel, ilyenkor az
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Factor Analysis
Factor Analysis Factor analysis is a multiple statistical method, which analyzes the correlation relation between data, and it is for data reduction, dimension reduction and to explore the structure. Aim