ETSI ES V1.2.1 ( )
|
|
- Dénes Pataki
- 6 évvel ezelőtt
- Látták:
Átírás
1 Standard Open Service Access (OSA); Parlay X Web Services; Part 6: Payment (Parlay X 2)
2 2 Reference RES/TISPAN OSA Keywords API, OSA, service 650 Route des Lucioles F Sophia Antipolis Cedex - FRANCE Tel.: Fax: Siret N NAF 742 C Association à but non lucratif enregistrée à la Sous-Préfecture de Grasse (06) N 7803/88 Important notice Individual copies of the present document can be downloaded from: The present document may be made available in more than one electronic version or in print. In any case of existing or perceived difference in contents between such versions, the reference version is the Portable Document Format (PDF). In case of dispute, the reference shall be the printing on printers of the PDF version kept on a specific network drive within Secretariat. Users of the present document should be aware that the document may be subject to revision or change of status. Information on the current status of this and other documents is available at If you find errors in the present document, please send your comment to one of the following services: Copyright Notification No part may be reproduced except as authorized by written permission. The copyright and the foregoing restriction extend to reproduction in all media. European Telecommunications Standards Institute The Parlay Group All rights reserved. DECT TM, PLUGTESTS TM and UMTS TM are Trade Marks of registered for the benefit of its Members. TIPHON TM and the TIPHON logo are Trade Marks currently being registered by for the benefit of its Members. 3GPP TM is a Trade Mark of registered for the benefit of its Members and of the 3GPP Organizational Partners.
3 3 Contents Intellectual Property Rights...5 Foreword Scope References Definitions and abbreviations Definitions Abbreviations Detailed service description Namespaces Sequence diagrams Charge for content XML Schema data type definition Property structure Web Service interface definition Interface: AmountCharging Operation: chargeamount Input message: chargeamountrequest Output message: chargeamountresponse Referenced faults Operation: refundamount Input message: refundamountrequest Output message: refundamountresponse Referenced faults Interface: VolumeCharging Operation: chargevolume Input message: chargevolumerequest Output message: chargevolumeresponse Referenced faults Operation: getamount Input message: getamountrequest Output message: getamountresponse Referenced faults Operation: refundvolume Input message: refundvolumerequest Output message: refundvolumeresponse Referenced faults Interface: ReserveAmountCharging Operation: reserveamount Input message: reserveamountrequest Output message: reserveamountresponse Referenced faults Operation: reserveadditionalamount Input message: reserveadditionalamountrequest Output message : reserveadditionalamountresponse Referenced faults Operation: chargereservation Input message: chargereservationrequest Output message: chargereservationresponse Referenced faults Operation: releasereservation Input message: releasereservationrequest...15
4 Output message: releasereservationresponse Referenced faults Interface: ReserveVolumeCharging Operation: getamount Input message: getamountrequest Output message : getamountresponse Referenced faults Operation: reservevolume Input message: reservevolumerequest Output message: reservevolumeresponse Referenced faults Operation: reserveadditionalvolume Input message: reserveadditionalvolumerequest Output message: reserveadditionalvolumeresponse Referenced faults Operation: chargereservation Input message: chargereservationrequest Output message: chargereservationresponse Referenced faults Operation: releasereservation Input message: releasereservationrequest Output message: releasereservationresponse Referenced faults Fault definitions ServiceException SVC0270: Charge failed Service policies...19 Annex A (normative): WSDL for Payment...20 Annex B (informative): Bibliography...21 History...22
5 5 Intellectual Property Rights IPRs essential or potentially essential to the present document may have been declared to. The information pertaining to these essential IPRs, if any, is publicly available for members and non-members, and can be found in SR : "Intellectual Property Rights (IPRs); Essential, or potentially Essential, IPRs notified to in respect of standards", which is available from the Secretariat. Latest updates are available on the Web server ( Pursuant to the IPR Policy, no investigation, including IPR searches, has been carried out by. No guarantee can be given as to the existence of other IPRs not referenced in SR (or the updates on the Web server) which are, or may be, or may become, essential to the present document. Foreword This Standard (ES) has been produced by Technical Committee Telecommunications and Internet converged Services and Protocols for Advanced Networking (TISPAN). The present document is part 6 of a multi-part deliverable covering Open Service Access (OSA); Parlay X Web Services, as identified below: Part 1: Part 2: Part 3: Part 4: Part 5: Part 6: Part 7: Part 8: Part 9: Part 10: Part 11: Part 12: Part 13: Part 14: "Common"; "Third Party Call"; "Call Notification"; "Short Messaging"; "Multimedia Messaging"; "Payment"; "Account Management"; "Terminal Status"; "Terminal Location"; "Call Handling"; "Audio Call"; "Multimedia Conference"; "Address List Management"; "Presence". The present document has been defined jointly between, The Parlay Group ( PayCircle ( and the 3GPP. The present document forms part of the Parlay X 2.1 set of specifications. The present document is equivalent to 3GPP TS V6.3.0 (Release 6).
6 6 1 Scope The present document is part 6 of the Stage 3 Parlay X 2 Web Services specification for Open Service Access (OSA). The OSA specifications define an architecture that enables application developers to make use of network functionality through an open standardized interface, i.e. the OSA APIs. The present document specifies the Payment Web Service. The following are defined here: Name spaces. Sequence diagrams. Data definitions. Interface specification plus detailed method descriptions. Fault definitions. Service Policies. WSDL Description of the interfaces. 2 References The following documents contain provisions which, through reference in this text, constitute provisions of the present document. References are either specific (identified by date of publication and/or edition number or version number) or non-specific. For a specific reference, subsequent revisions do not apply. For a non-specific reference, the latest version applies. Referenced documents which are not found to be publicly available in the expected location might be found at NOTE: While any hyperlinks included in this clause were valid at the time of publication cannot guarantee their long term validity. [1] W3C Recommendation (2 May 2001): "XML Schema Part 2: Datatypes". NOTE: Available at: [2] ES : "Open Service Access (OSA); Parlay X Web Services; Part 1: Common (Parlay X 2)". [3] ISO 4217: "Codes for the representation of currencies and funds". 3 Definitions and abbreviations 3.1 Definitions For the purposes of the present document, the terms and definitions given in ES [2] apply.
7 7 3.2 Abbreviations For the purposes of the present document, the abbreviations given in ES [2] apply. 4 Detailed service description A vast amount of content, both information and entertainment, will be made available to subscribers. To support a business model that enables operators to offer integrated billing, a payment API is crucial. Open and inter-operable "payment APIs" are the key to market growth and investment protection. The Payment Web Service supports payments for any content in an open, Web-like environment. The Payment Web Service described in the present document supports payment reservation, pre-paid payments, and post-paid payments. It supports charging of both volume and currency amounts, a conversion function and a settlement function in case of a financially resolved dispute. Note that certain parameters are negotiated off line. For example the currency, volume type, default reservation enforcement time, as well as the taxation procedures and parameters. An example of an application scenario could be a multimedia service. Assume a subscriber is interested in receiving a stream of, say, a soccer match. The subscriber selects a match and establishes a trusted relation with the provider. Again, the provider obtains the MSISDN and other information from the subscriber. The subscriber wants to know what the service will cost and the provider interacts with the operators rating engine (getamount) taking into account the subscriber's subscription, time of day, etc. The value returned is a ChargingInformation amount and is printed on the page that is displayed at the MS. The subscriber then decides to stream the match to his MS. Subsequently, the provider will reserve the appropriate amount with the operator (reserveamount) to ensure that the subscriber can fulfil his payment obligations. The match starts and the provider periodically charges against the reservation (chargereservation). The match ends in a draw and is extended with a "sudden death" phase. The subscriber continues listening, so the existing reservation is enlarged (reserveadditionalamount). Suddenly, one of the teams scores a goal, so the match abruptly ends, leaving part of the reserved amount unused. The provider now releases the reservation (releasereservation), and the remaining amount is available for future use by the subscriber. Now we can extend this scenario by having the subscriber participate in a game of chance in which the provider refunds a percentage of the usage costs (refundamount) based on the ranking of a particular team in this tournament. For example, the subscriber gambling on the team that wins the tournament receives a full refund, while for gambling on the team that finishes in second place, the refund is 50 %, etc. 5 Namespaces The AmountCharging interface uses the namespace: The VolumeCharging interface uses the namespace: The ReserveAmountCharging interface uses the namespace: The ReserveVolumeCharging interface uses the namespace: The data types are defined in the namespace: The "xsd" namespace is used in the present document to refer to the XML Schema data types defined in XML Schema [1]. The use of the name "xsd" is not semantically significant.
8 8 6 Sequence diagrams 6.1 Charge for content Assume a subscriber is interested in downloading a ring tone to his device. The subscriber selects a ring tone and establishes a trusted relation with the ring tone provider. Essentially, the ring tone provider obtains the address (MSISDN) and other information from the subscriber. The ring tone may be downloaded to the device using SMS. As soon as the download succeeds, the provider of the ring tone will charge the subscriber (chargeamount). : End User : Self Serve Portal Log on to content portal : Send Sms Web Service : Amount Charging Web Service Order Ringtone Send ringtone to device Message identifier Create charge for content Display status page Figure 1 7 XML Schema data type definition 7.1 Property structure Property with a name and value. Element name Type Optional Description name xsd:string No Name of property value xsd:string No Value of property
9 9 8 Web Service interface definition 8.1 Interface: AmountCharging Charge operations by amount Operation: chargeamount This operation results in directly charging to the account indicated by the end user identifier. The charge is specified as a ChargingInformation data structure, consisting of information on the amount to be charged and a description to appear on the bill. The reference code is used to uniquely identify the request; it is the application's responsibility to provide a unique reference code within the scope of the application Input message: chargeamountrequest enduseridentifier xsd:anyuri No The end user's account to be charged charge common:chargingi nformation No Information on the charge to be made. In the ChargingInformation structure: The description element is information to appear on the bill. The amount to be charged appears either directly in the amount element or encoded in the code element. If both these elements are missing or empty, a service exception (SVC0007) will be thrown. The optional currency element specifies the currency to be used for the charge. referencecode xsd:string No Textual information to uniquely identify the request, e.g. in case of disputes Output message: chargeamountresponse None Referenced faults SVC Invalid charging information. SVC Charge failed Operation: refundamount This operation results in directly applying a refund to the account indicated by the end user identifier. The refund is specified as a currency amount. The billing text field is used for textual information to appear on the bill. The reference code is used to uniquely identify the request; it is the application's responsibility to provide a unique reference code within the scope of the application.
10 Input message: refundamountrequest enduseridentifier xsd:anyuri No The end user's account to be refunded charge common:chargingi nformation No Information on the refund to be made. In the ChargingInformation structure: The description element is information to appear on the bill. The amount to be refunded appears either directly in the amount element or encoded in the code element. If both these elements are missing or empty, a service exception (SVC0007) will be thrown. The optional currency element specifies the currency to be used for the refund. referencecode xsd:string No Textual information to uniquely identify the request, e.g. in case of disputes Output message: refundamountresponse None Referenced faults SVC Invalid charging information. SVC Charge failed. 8.2 Interface: VolumeCharging Charging operations by volume Operation: chargevolume This operation results in directly charging to the account indicated by the end user identifier. The charge is specified as a volume. The billing text field is used for textual information to appear on the bill. The reference code is used to uniquely identify the request; it is the application's responsibility to provide a unique reference code within the scope of the application Input message: chargevolumerequest enduseridentifier xsd:anyuri No The end user's account to be charged volume xsd:long No The volume to be charged billingtext xsd:string No Textual information to appear on the bill referencecode xsd:string No Textual information to uniquely identify the request, e.g. in case of disputes parameters Property [0..unbounded] Yes Parameters to use to perform rating ("unit", "contract", "service", "operation")
11 Output message: chargevolumeresponse None Referenced faults SVC Charge failed Operation: getamount This operation results in converting the given volume to a currency amount. The end user identifier is given to indicate the subscriber for whom this conversion calculation must be made. The message returns a currency amount if successful. The following properties may be provided: unit, specifying the unit used for measuring volume (e.g. bytes); contract, number of a contract that may govern the use; service, name of the service to be used (e.g. SendMessageService); operation, name of the operation to be used (e.g. sendmessage) Input message: getamountrequest enduseridentifier xsd:anyuri No The end user's account to be charged volume xsd:long No The volume to be converted parameters Property [0..unbounded] Yes Parameters to use to perform rating ("unit", "contract", "service", "operation") Output message: getamountresponse result common:chargingi nformation No The conversion process results in the return of a ChargingInformation structure, where the description, amount and currency elements must be non-null Referenced faults
12 Operation: refundvolume This operation results in directly applying a refund to the account indicated by the end user identifier. The refund is specified as a volume. The billing text field is used for textual information to appear on the bill. The reference code is used to uniquely identify the request; it is the application's responsibility to provide a unique reference code within the scope of the application Input message: refundvolumerequest enduseridentifier xsd:anyuri No The end user's account to be refunded volume xsd:long No The volume to be refunded billingtext xsd:string No Textual information to appear on the bill referencecode xsd:string No Textual information to uniquely identify the request, e.g. in case of disputes parameters Property [0..unbounded] Yes Parameters to use to perform rating ("unit", "contract", "service", "operation") Output message: refundvolumeresponse None Referenced faults SVC Charge failed. 8.3 Interface: ReserveAmountCharging Operations to manage reservation charging by amount Operation: reserveamount This operation reserves a charge for an account indicated by the end user identifier. The charge to be reserved is specified as a ChargingInformation data structure. Note that reservations do not last forever; it is assumed the default reservation enforcement time is negotiated off-line. If the reservation times out, the remaining funds will be returned to the account from which this reservation was made. However, the remaining funds shall preferably be returned explicitly to the account using the releasereservation operation. The description element of the ChargingInformation data structure is used for textual information to appear on the bill. Subsequent textual information provided during this charging session will be appended to this textual information; one charging session to a reservation will result in only one entry on the bill. In case of success, a reservation id is returned for future reference; e.g. subsequent charging against the existing reservation using the chargereservation operation.
13 Input message: reserveamountrequest enduseridentifier xsd:anyuri No The end user's account subject to the reservation charge common: ChargingInformation No Information on the charge to be reserved. In the ChargingInformation structure: The description element is information to appear on the bill. The charge to be reserved appears either directly in the amount element or encoded in the code element. If both these elements are missing or empty, a service exception (SVC0007) will be thrown. The optional currency element specifies the currency to be used for the charge reservation Output message: reserveamountresponse result xsd:string No It is an identifier for the newly created reservation Referenced faults SVC Invalid charging information Operation: reserveadditionalamount This operation results in the addition/subtraction of a charge to/from an existing reservation indicated by the reservation id. The charge is specified as a ChargingInformation data structure. Note that reservations do not last forever; it is assumed the default reservation enforcement time is negotiated off-line. Invoking this message will extend the reservation enforcement time for another off-line-negotiated period. The description element of the ChargingInformation data structure is used for appending textual information to appear on the bill. The textual information is appended to the initial textual information given by the reserveamount operation; one charging session to a reservation will result in only one entry on the bill. Reserved credit can be returned to the account through the releasereservation operation Input message: reserveadditionalamountrequest reservationidentifier xsd:string No An identifier for the reservation to be amended charge No Information on the charge to be added to (or subtracted common:chargingi nformation from) the reservation. In the ChargingInformation structure: The description element is information to appear on the bill. The charge to be reserved appears either directly in the amount element or encoded in the code element. If both these elements are missing or empty, a service exception (SVC0007) will be thrown. The currency element is not applicable: the currency is defined only when the reservation is established (i.e. the reserveamount operation is invoked).
14 Output message : reserveadditionalamountresponse None Referenced faults SVC Invalid charging information Operation: chargereservation This operation results in charging to a reservation indicated by the reservation id. Reservations, identified by reservation id, are established through invoking the reserveamount operation. The charge is specified as a ChargingInformation data structure. The description element of the ChargingInformation data structure is used for appending textual information to appear on the bill. The textual information is appended to the initial textual information given by the reserveamount operation; one charging session to a reservation will result in only one entry on the bill. The reference code is used to uniquely identify the request; it is the application's responsibility to provide a unique reference code within the scope of the application Input message: chargereservationrequest reservationidentifier xsd:string No An identifier for the reservation to be charged charge No Information on the charge to the reservation. In the common:chargingi ChargingInformation structure: nformation The description element is information to appear on the bill. The charge to the reservation appears either directly in the amount element or encoded in the code element. If both these elements are missing or empty, a service exception (SVC0007) will be thrown. The currency element is not applicable: the currency is defined only when the reservation is established (i.e. the reserveamount operation is invoked). referencecode xsd:string No Textual information to uniquely identify the request, e.g. in case of disputes Output message: chargereservationresponse None Referenced faults
15 15 SVC Invalid charging information. SVC Charge failed Operation: releasereservation This operation returns funds left in a reservation indicated by reservation id to the account from which this reservation was made. Reservations, identified by reservation id, are established by invoking the reserveamount operation Input message: releasereservationrequest reservationidentifier xsd:string No An identifier for the reservation to be released Output message: releasereservationresponse None Referenced faults 8.4 Interface: ReserveVolumeCharging Operations to manage reservation charging by amount Operation: getamount This operation returns the amount resulting from converting the given volume. The end user identifier is given to indicate the subscriber for whom this calculation must be made. The message returns a currency amount if successful. The following properties may be provided: unit, specifying the unit used for measuring volume (e.g. bytes); contract, number of a contract that may govern the use; service, name of the service to be used (e.g. SendMessageService); operation, name of the operation to be used (e.g. sendmessage).
16 Input message: getamountrequest enduseridentifier xsd:anyuri No The end user's account to be charged volume xsd:long No The volume to be converted parameters Property [0..unbounded] Yes Parameters to use to perform rating ("unit", "contract", "service", "operation") Output message : getamountresponse result common:charging Information No The conversion process results in the return of a ChargingInformation structure, where the description, amount and currency elements must be non-null Referenced faults Operation: reservevolume This operation reserves a volume for an account indicated by the end user identifier. Note that reservations do not last forever; it is assumed the default reservation enforcement time is negotiated off-line. If the reservation times out, the remaining volume will be returned to the account from which this reservation was made. However, the remaining volume should preferably be returned explicitly to the account using the releasereservation operation. The billing text field is used for textual information to appear on the bill. Subsequent textual information provided during this charging session will be appended to this textual information; one charging session to a reservation will result in only one entry on the bill. In case of success, a reservation identifier is returned for future reference; e.g. subsequent charging against the existing reservation using the chargereservation operation Input message: reservevolumerequest enduseridentifier xsd:anyuri No The end user's account subject to the reservation volume xsd:long No The volume of the reservation billingtext xsd:string No Textual information to appear on the bill parameters Property [0..unbounded] Yes Parameters to use to perform rating ("unit", "contract", "service", "operation"). There is a maximum of one instance of each parameter type. Example, for the request "reserve 5 minutes of the gold video service", the volume part value is 5 and the parameters part has the following properties: "unit"=minutes "contract"=gold "service"=video
17 Output message: reservevolumeresponse result xsd:string No It is an identifier for the newly created reservation Referenced faults Operation: reserveadditionalvolume This operation adds/subtracts a volume to/from an existing volume reservation indicated by the reservation id. Note that reservations do not last forever; it is assumed the default reservation enforcement time is negotiated off-line. Invoking this message will extend the reservation enforcement time for another off-line-negotiated period. The billing text field is used for appending textual information to appear on the bill. The textual information is appended to the initial textual information given by the reservevolume operation; one charging session to a reservation will result in only one entry on the bill. A reserved credit can be returned to the account through the releasereservation operation Input message: reserveadditionalvolumerequest reservationidentifier xsd:string No An identifier for the reservation to be amended volume xsd:long No The volume to be added to (or subtracted from) the reservation. [Note the associated rating parameters are the same as those defined in the parameters part of the original reservevolumerequest message.] billingtext xsd:string No Textual information to appear on the bill Output message: reserveadditionalvolumeresponse None Referenced faults
18 Operation: chargereservation This operation results in charging to a volume reservation indicated by the reservation id. Reservations, identified by reservation id., are established through invoking the reservevolume operation. Optionally, the billing text field can be used for appending textual information to appear on the bill. The textual information is appended to the initial textual information given by the reservevolume operation; one charging session to a reservation will result in only one entry on the bill. The reference code is used to uniquely identify the request; it is the application's responsibility to provide a unique reference code within the scope of the application Input message: chargereservationrequest reservationidentifier xsd:string No An identifier for the reservation to be charged volume xsd:long No The volume to be charged. (Note the associated rating parameters are the same as those defined in the parameters part of the original reservevolumerequest message.) billingtext xsd:string Yes Textual information to appear on the bill (optional) referencecode xsd:string No Textual information to uniquely identify the request, e.g. in case of disputes Output message: chargereservationresponse None Referenced faults SVC Charge failed Operation: releasereservation This operation returns funds left in a volume reservation indicated by reservation id. to the account from which this reservation was made. Reservations, identified by reservation id., are established through invoking the reservevolume operation Input message: releasereservationrequest reservationidentifier xsd:string No An identifier for the reservation to be released Output message: releasereservationresponse None
19 Referenced faults 9 Fault definitions 9.1 ServiceException SVC0270: Charge failed Name messageid text variables Description SVC0270 Charging operation failed, the charge was not applied. None 10 Service policies Service policies for this service. Name Type Description Currency xsd:string Currency used by service (per ISO 4217 [3])
20 20 Annex A (normative): WSDL for Payment The document/literal WSDL representation of this interface specification is compliant to ES [2] and is contained in text files (contained in archive es_ v010201p0.zip) which accompany the present document.
21 21 Annex B (informative): Bibliography TR : " Digital cellular telecommunications system (Phase 2+); Universal Mobile Telecommunications System (UMTS); Vocabulary for 3GPP Specifications (3GPP TR )".
22 22 History Document history V1.1.1 March 2005 Publication V1.2.1 October 2006 Membership Approval Procedure MV : to V1.2.1 December 2006 Publication
ETSI ES V1.1.1 ( )
Standard Open Service Access (OSA); Parlay X Web Services; Part 6: Payment 2 Reference DES/TISPAN-01007-06-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis Cedex - FRANCE
Final draft ETSI ES V1.1.1 ( )
Standard Open Service Access (OSA); Parlay X Web Services; Part 11: Audio Call 2 Reference DES/TISPAN-01007-11-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis Cedex - FRANCE
ETSI ES V1.3.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 11: Audio Call (Parlay X 2)
Standard Open Service Access (OSA); Parlay X Web Services; Part 11: Audio Call (Parlay X 2) 2 Reference RES/TISPAN-01056-11-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
ETSI ES V1.3.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 7: Account Management (Parlay X 2)
Standard Open Service Access (OSA); Parlay X Web Services; Part 7: Account Management (Parlay X 2) 2 Reference RES/TISPAN-01056-07-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
ETSI ES V1.2.1 ( )
Standard Open Service Access (OSA); Parlay X Web Services; Part 10: Call Handling (Parlay X 2) 2 Reference RES/TISPAN-01033-10-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
ETSI ES V1.2.1 ( )
Standard Open Service Access (OSA); Parlay X Web Services; Part 2: Third Party Call (Parlay X 2) 2 Reference RES/TISPAN-01033-02-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
ETSI ES V1.1.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 8: Terminal Status (Parlay X 3)
Standard Open Service Access (OSA); Parlay X Web Services; Part 8: Terminal Status (Parlay X 3) 2 Reference DES/TISPAN-01034-8-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
ETSI ES V1.1.1 ( )
Standard Open Service Access (OSA); Parlay X Web Services; Part 5: Multimedia Messaging 2 Reference DES/TISPAN-01007-05-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis Cedex
ETSI ES V1.3.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 13: Address List Management (Parlay X 2)
Standard Open Service Access (OSA); Parlay X Web Services; Part 13: Address List Management (Parlay X 2) 2 Reference RES/TISPAN-01056-13-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia
ETSI ES V1.1.1 ( )
Standard Open Service Access (OSA); Parlay X Web Services; Part 13: Address List Management 2 Reference DES/TISPAN-01007-13-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
ETSI ES V1.2.1 ( )
Standard Open Service Access (OSA); Parlay X Web Services; Part 5: Multimedia Messaging (Parlay X 2) 2 Reference RES/TISPAN-01033-05-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia
ETSI ES V1.3.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 5: Multimedia Messaging (Parlay X 2)
Standard Open Service Access (OSA); Parlay X Web Services; Part 5: Multimedia Messaging (Parlay X 2) 2 Reference RES/TISPAN-01056-05-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia
ETSI ES V1.1.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 16: Geocoding (Parlay X 3)
Standard Open Service Access (OSA); Parlay X Web Services; Part 16: Geocoding (Parlay X 3) 2 Reference DES/TISPAN-01034-16-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
ETSI ES V1.1.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 3: Call Notification (Parlay X 3)
Standard Open Service Access (OSA); Parlay X Web Services; Part 3: Call Notification (Parlay X 3) 2 Reference DES/TISPAN-01034-3-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
ETSI ES V1.1.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 4: Short Messaging (Parlay X 3)
Standard Open Service Access (OSA); Parlay X Web Services; Part 4: Short Messaging (Parlay X 3) 2 Reference DES/TISPAN-01034-4-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
EN United in diversity EN A8-0206/419. Amendment
22.3.2019 A8-0206/419 419 Article 2 paragraph 4 point a point i (i) the identity of the road transport operator; (i) the identity of the road transport operator by means of its intra-community tax identification
ETSI ES V1.1.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 15: Message Broadcast (Parlay X 3)
Standard Open Service Access (OSA); Parlay X Web Services; Part 15: Message Broadcast (Parlay X 3) 2 Reference DES/TISPAN-01034-15-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
Cashback 2015 Deposit Promotion teljes szabályzat
Cashback 2015 Deposit Promotion teljes szabályzat 1. Definitions 1. Definíciók: a) Account Client s trading account or any other accounts and/or registers maintained for Számla Az ügyfél kereskedési számlája
Széchenyi István Egyetem www.sze.hu/~herno
Oldal: 1/6 A feladat során megismerkedünk a C# és a LabVIEW összekapcsolásának egy lehetőségével, pontosabban nagyon egyszerű C#- ban írt kódból fordítunk DLL-t, amit meghívunk LabVIEW-ból. Az eljárás
ETSI ES V1.3.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 1: Common (Parlay X 2)
Standard Open Service Access (OSA); Parlay X Web Services; Part 1: Common (Parlay X 2) 2 Reference RES/TISPAN-01056-01-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis Cedex
PIACI HIRDETMÉNY / MARKET NOTICE
PIACI HIRDETMÉNY / MARKET NOTICE HUPX DAM Másnapi Aukció / HUPX DAM Day-Ahead Auction Iktatási szám / Notice #: Dátum / Of: 18/11/2014 HUPX-MN-DAM-2014-0023 Tárgy / Subject: Változások a HUPX másnapi piac
Megbízási szerződés (KP) Agency Agreement (TP) mely létrejött egyrészről a. concluded by and between
Megbízási szerződés (KP) Agency Agreement (TP) mely létrejött egyrészről a Cégnév: Székhely: Cégjegyzékszám:. Adószám: mint megbízó (továbbiakban: Megbízó) másrészről pedig a concluded by and between Company
USER MANUAL Guest user
USER MANUAL Guest user 1 Welcome in Kutatótér (Researchroom) Top menu 1. Click on it and the left side menu will pop up 2. With the slider you can make left side menu visible 3. Font side: enlarging font
Lexington Public Schools 146 Maple Street Lexington, Massachusetts 02420
146 Maple Street Lexington, Massachusetts 02420 Surplus Printing Equipment For Sale Key Dates/Times: Item Date Time Location Release of Bid 10/23/2014 11:00 a.m. http://lps.lexingtonma.org (under Quick
ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP
ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP CHILD S DATA / GYERMEK ADATAI PLEASE FILL IN THIS INFORMATION WITH DATA BASED ON OFFICIAL DOCUMENTS / KÉRJÜK, TÖLTSE KI A HIVATALOS DOKUMENTUMOKBAN SZEREPLŐ ADATOK
ETSI ES V1.1.1 ( )
Standard Open Service Access (OSA); Parlay X Web Services; Part 1: Common 2 Reference DES/TISPAN-01007-01-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis Cedex - FRANCE Tel.:
Számlakezelés az ELO DocXtraktor modullal
ELOECMSzakmai Kongresszus2013 Számlakezelés az ELO DocXtraktor modullal Kovács Eszter Kovacs.eszter@pentatrade.hu Projekt bemutatása A Cég Cégcsoport Éves árbevétel 140 mrd FT > 5 500 dolgozó ( 1 000 fı
Cut-Off Time for Payment Orders, Incoming Payments And Fulfilment Orders
Cut-Off Time for Payment Orders, Incoming Payments And Fulfilment Orders Effective from 1 st of January 2016 1 Cut-off times for the receipt of payment orders for same-day processing: On every business
BKI13ATEX0030/1 EK-Típus Vizsgálati Tanúsítvány/ EC-Type Examination Certificate 1. kiegészítés / Amendment 1 MSZ EN 60079-31:2014
(1) EK-TípusVizsgálati Tanúsítvány (2) A potenciálisan robbanásveszélyes környezetben történő alkalmazásra szánt berendezések, védelmi rendszerek 94/9/EK Direktíva / Equipment or Protective Systems Intended
Új funkciók az RBP-ben 2015. október 1-től New functions in RBP from 1 October 2015. Tatár Balázs
Új funkciók az RBP-ben 2015. október 1-től New functions in RBP from 1 October 2015 Tatár Balázs Üzletfejlesztés vezető / Business Development Manager Rendszerhasználói Tájékoztató Nap, 2015. szeptember
Intézményi IKI Gazdasági Nyelvi Vizsga
Intézményi IKI Gazdasági Nyelvi Vizsga Név:... Születési hely:... Születési dátum (év/hó/nap):... Nyelv: Angol Fok: Alapfok 1. Feladat: Olvasáskészséget mérő feladat 20 pont Olvassa el a szöveget és válaszoljon
ELO Digital Office ERP integráció
ELO Digital Office ERP integráció Lázár Péter ECM Business Unit Manager peter.lazar@itelligence.hu Enterprise Content Management www.elo.com Miért kell ERP integráció? Hozzáféréseket szabályozni és auditálni
Using the CW-Net in a user defined IP network
Using the CW-Net in a user defined IP network Data transmission and device control through IP platform CW-Net Basically, CableWorld's CW-Net operates in the 10.123.13.xxx IP address range. User Defined
Könnyen bevezethető ITIL alapú megoldások a Novell ZENworks segítségével. Hargitai Zsolt Sales Support Manager Novell Hungary
Könnyen bevezethető ITIL alapú megoldások a Novell ZENworks segítségével Hargitai Zsolt Sales Support Manager Novell Hungary Napirend ITIL rövid áttekintés ITIL komponensek megvalósítása ZENworks segítségével
(NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV
Kommunikációs rendszerek programozása (NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV (5. mérés) SIP telefonközpont készítése Trixbox-szal 1 Mérés helye: Széchenyi István Egyetem, L-1/7 laboratórium, 9026 Győr, Egyetem
Cloud computing. Cloud computing. Dr. Bakonyi Péter.
Cloud computing Cloud computing Dr. Bakonyi Péter. 1/24/2011 1/24/2011 Cloud computing 2 Cloud definició A cloud vagy felhő egy platform vagy infrastruktúra Az alkalmazások és szolgáltatások végrehajtására
Utasítások. Üzembe helyezés
HASZNÁLATI ÚTMUTATÓ Üzembe helyezés Utasítások Windows XP / Vista / Windows 7 / Windows 8 rendszerben történő telepítéshez 1 Töltse le az AORUS makróalkalmazás telepítőjét az AORUS hivatalos webhelyéről.
Paysera VISA cards are secured with "3-D technology" which ensures safer payments with payment cards online.
Paysera VISA card Safe payments online Paysera VISA cards are secured with "3-D technology" which ensures safer payments with payment cards online. When purchasing at e-shops labelled with "Paysera VISA",
Eladni könnyedén? Oracle Sales Cloud. Horváth Tünde Principal Sales Consultant 2014. március 23.
Eladni könnyedén? Oracle Sales Cloud Horváth Tünde Principal Sales Consultant 2014. március 23. Oracle Confidential Internal/Restricted/Highly Restricted Safe Harbor Statement The following is intended
EN United in diversity EN A8-0206/445. Amendment
21.3.2019 A8-0206/445 445 Title Proposal for a DIRECTIVE OF THE EUROPEAN PARLIAMENT AND OF THE COUNCIL amending Directive 2006/22/EC as regards enforcement requirements and laying down specific rules with
STUDENT LOGBOOK. 1 week general practice course for the 6 th year medical students SEMMELWEIS EGYETEM. Name of the student:
STUDENT LOGBOOK 1 week general practice course for the 6 th year medical students Name of the student: Dates of the practice course: Name of the tutor: Address of the family practice: Tel: Please read
Nemzetközi vállalat - a vállalati szoftvermegoldások egyik vezető szállítója
Nemzetközi vállalat - a vállalati szoftvermegoldások egyik vezető szállítója A Novell világszerte vezető szerepet tölt be a Linux-alapú és nyílt forráskódú vállalati operációs rendszerek, valamit a vegyes
EN United in diversity EN A8-0206/473. Amendment
21.3.2019 A8-0206/473 473 Recital 12 d (new) (12d) Since there is no sufficient link of a driver with a territory of a Member State of transit, transit operations should not be considered as posting situations.
Cloud computing Dr. Bakonyi Péter.
Cloud computing Dr. Bakonyi Péter. 1/24/2011 Cloud computing 1/24/2011 Cloud computing 2 Cloud definició A cloud vagy felhő egy platform vagy infrastruktúra Az alkalmazások és szolgáltatások végrehajtására
Computer Architecture
Computer Architecture Locality-aware programming 2016. április 27. Budapest Gábor Horváth associate professor BUTE Department of Telecommunications ghorvath@hit.bme.hu Számítógép Architektúrák Horváth
PIACI HIRDETMÉNY / MARKET NOTICE
PIACI HIRDETMÉNY / MARKET NOTICE HUPX DAM Másnapi Aukció / HUPX DAM Day-Ahead Auction Iktatási szám / Notice #: HUPX-MN-DAM-2018-0001 Dátum / Of: 26/01/2018 Tárgy / Subject: Hatályos díjszabás és kedvezmények
ELOECMSzakmai Kongresszus2013
ELOECMSzakmai Kongresszus2013 Keynote Horváth Szilvia Ügyvezető s.horvath@elo.com Cégünk rövid bemutatása 1871 Louis Leitz megalapítja első vállalatát 1995 Az első elektronikus Leitz dokumentumkezelő (ELOoffice)
On The Number Of Slim Semimodular Lattices
On The Number Of Slim Semimodular Lattices Gábor Czédli, Tamás Dékány, László Ozsvárt, Nóra Szakács, Balázs Udvari Bolyai Institute, University of Szeged Conference on Universal Algebra and Lattice Theory
PIACI HIRDETMÉNY / MARKET NOTICE
PIACI HIRDETMÉNY / MARKET NOTICE HUPX DAM Másnapi Aukció / HUPX DAM Day-Ahead Auction Iktatási szám / Notice #: HUPX-MN-DAM-2018-0010 Dátum / Of: 12/10/2018 Tárgy / Subject: Hatályos díjszabás és kedvezmények
Proxer 7 Manager szoftver felhasználói leírás
Proxer 7 Manager szoftver felhasználói leírás A program az induláskor elkezdi keresni az eszközöket. Ha van olyan eszköz, amely virtuális billentyűzetként van beállítva, akkor azokat is kijelzi. Azokkal
DETAILED GUIDELINE Content Page
1 DETAILED GUIDELINE Content Page Purchase for official purposes by Foreign Armed Forces and International Military Headquarters: VAT exemption 2 Purchase for official purposes by Foreign Armed Forces
INFORMATION ON COMPLAINT HANDLING
PANASZKEZELÉSI TÁJÉKOZTATÓ Az ACN Communications Hungary Korlátolt Felelősségű Társaság (székhely: 1132 Budapest, Váci út 30, VI emelet; ACN ) az alábbiakban tájékoztatja előfizetőit az ACN által nyújtott
Tájékoztató a 2012. évi határon átnyúló pénzügyi fogyasztói jogviták rendezésével összefüggő és egyéb nemzetközi tevékenységről
Tájékoztató a 2012. évi határon átnyúló pénzügyi fogyasztói jogviták rendezésével összefüggő és egyéb nemzetközi tevékenységről Pénzügyi Békéltető Testület A Pénzügyi Szervezetek Állami Felügyelete mellett
NSR Settlements. This session will discuss:
NSR Settlements NSR Settlements This session will discuss: purpose and meaning of settlement agreements and the types of settlement agreements relationship between Consent Decrees and Title V applicable
PIACI HIRDETMÉNY / MARKET NOTICE
PIACI HIRDETMÉNY / MARKET NOTICE HUPX Fizikai Futures (PhF) / HUPX Physical Futures (PhF) Iktatási szám / Notice #: HUPX-MN-PhF-2015-0003 Dátum / Of: 20/04/2015 Tárgy / Subject: Hatályos díjszabás és kedvezmények
General information for the participants of the GTG Budapest, 2017 meeting
General information for the participants of the GTG Budapest, 2017 meeting Currency is Hungarian Forint (HUF). 1 EUR 310 HUF, 1000 HUF 3.20 EUR. Climate is continental, which means cold and dry in February
Directors and Officers Liability Insurance Questionnaire Adatlap vezetõ tisztségviselõk és felügyelõbizottsági tagok felelõsségbiztosításához
Directors and Officers Liability Insurance Questionnaire Adatlap vezetõ tisztségviselõk és felügyelõbizottsági tagok felelõsségbiztosításához 1. Name, legal form and address of company Társaság neve, címe,
USA Befektetési Útmutató
USA Befektetési Útmutató COPYRIGHT OPISAS. ALL RIGHTS RESERVED. DISCLAIMER. All prices on this list are subject to change without notice. Whilst we make every effort to provide you the most accurate, up-to-date
Web Services. (webszolgáltatások): egy osztott alkalmazásfejlesztési plattform
(webszolgáltatások): egy osztott alkalmazásfejlesztési plattform Ficsor Lajos Általános Informatikai Tanszék Miskolci Egyetem A Web Service Web Service definíciója Számos definíció létezik. IBM [4] A Web
Tavaszi Sporttábor / Spring Sports Camp. 2016. május 27 29. (péntek vasárnap) 27 29 May 2016 (Friday Sunday)
Tavaszi Sporttábor / Spring Sports Camp 2016. május 27 29. (péntek vasárnap) 27 29 May 2016 (Friday Sunday) SZÁLLÁS / ACCOMODDATION on a Hotel Gellért*** szálloda 2 ágyas szobáiban, vagy 2x2 ágyas hostel
Vállalati kockázatkezelés jelentősége
www.pwc.com/hu Vállalati kockázatkezelés jelentősége Fedor Péter 2013. szeptember 19. Miről lesz szó 1. Mi is az az ERM? 2. Miért fontos? 3. Gyakorlati sajátosságok PwC Magyarország Mi is az az ERM? PwC
KOGGM614 JÁRMŰIPARI KUTATÁS ÉS FEJLESZTÉS FOLYAMATA
KOGGM614 JÁRMŰIPARI KUTATÁS ÉS FEJLESZTÉS FOLYAMATA System Design Wahl István 2019.03.26. BME FACULTY OF TRANSPORTATION ENGINEERING AND VEHICLE ENGINEERING Tartalomjegyzék Rövidítések A rendszer definiálása
This document has been provided by the International Center for Not-for-Profit Law (ICNL).
This document has been provided by the International Center for Not-for-Profit Law (ICNL). ICNL is the leading source for information on the legal environment for civil society and public participation.
Create & validate a signature
IOTA TUTORIAL 7 Create & validate a signature v.0.0 KNBJDBIRYCUGVWMSKPVA9KOOGKKIRCBYHLMUTLGGAV9LIIPZSBGIENVBQ9NBQWXOXQSJRIRBHYJ9LCTJLISGGBRFRTTWD ABBYUVKPYFDJWTFLICYQQWQVDPCAKNVMSQERSYDPSSXPCZLVKWYKYZMREAEYZOSPWEJLHHFPYGSNSUYRZXANDNQTTLLZA
Mobile-telephone services
Mobile-telephone services Info Version 2 Url http://com.mercell.com/permalink/40188421.aspx External tender id 17462-2014 Tender type Contract Award Document type Contract award Procurement procedure Negotiated
Megbízási szerződés (CEEGEX) Agency Agreement (CEEGEX) concluded by and between. mely létrejött egyrészről a
Megbízási szerződés (CEEGEX) Agency Agreement (CEEGEX) mely létrejött egyrészről a Cégnév: Székhely: Cégjegyzékszám:. Adószám:.. mint megbízó (továbbiakban: Megbízó) másrészről pedig a KELER KSZF Központi
székhely: 1133 Budapest, Tutaj u. 6/A Registered office: 1133 Budapest, Tutaj u. 6/A
Átvállalási megállapodás a gyártó visszavételi és begyűjtési kötelezettségeinek átvállalásáról Agreement on Transfer of Responsibility in respect of the manufacturer s obligations to take back and collect
Mapping Sequencing Reads to a Reference Genome
Mapping Sequencing Reads to a Reference Genome High Throughput Sequencing RN Example applications: Sequencing a genome (DN) Sequencing a transcriptome and gene expression studies (RN) ChIP (chromatin immunoprecipitation)
Social services. Info. Buyer. Version changes Contract award. Description. Version 3. Publish date 11/13/2013 4:25 AM
Social services Info Version 3 Url http://com.mercell.com/permalink/40022336.aspx External tender id 383594-2013 Tender type Contract Award Document type Contract award Procurement procedure Open procedure
Teszt topológia E1/1 E1/0 SW1 E1/0 E1/0 SW3 SW2. Kuris Ferenc - [HUN] Cisco Blog -
VTP Teszt topológia E1/1 E1/0 SW1 E1/0 E1/0 SW2 SW3 2 Alap konfiguráció SW1-2-3 conf t interface e1/0 switchport trunk encapsulation dot1q switchport mode trunk vtp domain CCIE vtp mode transparent vtp
Deposits and Withdrawals policy Pénz befizetések és kifizetések szabályzata TeleTrade-DJ International Consulting Ltd
Deposits and Withdrawals policy Pénz befizetések és kifizetések szabályzata TeleTrade-DJ International Consulting Ltd 2011-2015 TeleTrade-DJ International Consulting Ltd. 1 Bank Wire Transfers: When depositing
SQL/PSM kurzorok rész
SQL/PSM kurzorok --- 2.rész Tankönyv: Ullman-Widom: Adatbázisrendszerek Alapvetés Második, átdolgozott kiadás, Panem, 2009 9.3. Az SQL és a befogadó nyelv közötti felület (sormutatók) 9.4. SQL/PSM Sémában
Construction of a cube given with its centre and a sideline
Transformation of a plane of projection Construction of a cube given with its centre and a sideline Exercise. Given the center O and a sideline e of a cube, where e is a vertical line. Construct the projections
PIACI HIRDETMÉNY / MARKET NOTICE
PIACI HIRDETMÉNY / MARKET NOTICE HUPX Másnapi Aukciós (DAM) Piac / HUPX Day-Ahead (DAM) Market Iktatási szám / Notice #: HUPX-MN-DAM-2017-0021 Dátum / Of: 22/12/2017 Tárgy / Subject: Piaci Szabályzat módosítása
Azonnali átvezetés Terhelés konverzió nélkül december 31. nincs december 31.
MELLÉKLETEK APPENDICES 1. számú melléklet Fizetési megbízás benyújtása elektronikus csatornán Fizetés iránya Tranzakció Pénznemek közötti átváltás (konverzió) Saját számlák között Befogadás Árfolyammegállapítás
Új fenomén a magyar biztosítási jogban: a biztosítottak közvetlen perlési joga a viszontbiztosítóval szemben a direkt biztosító csődje esetén
Új fenomén a magyar biztosítási jogban: a biztosítottak közvetlen perlési joga a viszontbiztosítóval szemben a direkt biztosító csődje esetén Dr. Molnár István ügyvéd Berke & Molnár Ügyvédi Iroda Istvan.molnar@berkemolnarlawfirm.hu
Health services. Info. Buyer. Description. Publish date 1/24/2014 4:28 AM. Version 1. Url http://com.mercell.com/permalink/42903579.
Health services Info Version 1 Url http://com.mercell.com/permalink/42903579.aspx External tender id 26407-2014 Tender type Contract Award Document type Contract award Procurement procedure Award of a
ACO burkolható fedlapok. ACO műszaki katalógus ACO Burkolható fedlapok UNIFACE PAVING SOLID
ACO burkolható fedlapok ACO burkolható fedlapok ACO műszaki katalógus ACO Burkolható fedlapok UNIFACE PAVING SOLID ACO gully Tartalom Általános információk 3 page ACO Uniface ACO UNIFACE burkolható fedlap
Nagyvállalati Linux üzemeltetés Horváth Gábor Kálmán
Nagyvállalati Linux üzemeltetés Horváth Gábor Kálmán vezető tanácsadó gabor.horvath@npsh.hu Szerverek életciklusa Szerver életciklus Telepít Beállít Tesztel Frissít Kivezet 3 Élesít Üzemel Problémák? Tömeges
Megfelelés az új iratkezelési rendeletnek az ELOik modullal
Megfelelés az új iratkezelési rendeletnek az ELOik modullal Dezsényi Csaba csaba.dezsenyi@ovitas.hu Mindenki nyugodjon meg! Az meg fog felelni az új jogszabályoknak! 2 Mit jelent? Felülvizsgálat Szerelés
Operation of water supplies
Operation of water supplies Info Version 3 Url http://com.mercell.com/permalink/41670211.aspx External tender id 396958-2013 Tender type Tender Document type Additional information Procurement procedure
SUSE Success Stories Varga Zsolt
SUSE Success Stories Varga Zsolt operatív igazgató / Novell PSH Varga.zsolt@npsh.hu 2 Nagy forgalmú webes portál infrastruktúra kialakítása (közszféra) Megoldandó feladatok, nehézségek Igen nagy számú
Furniture. Info. Buyer. Version changes Contract award. Description. Version 3. Publish date 5/13/2014 4:21 AM
Furniture Info Version 3 Url http://com.mercell.com/permalink/41155242.aspx External tender id 159264-2014 Tender type Contract Award Document type Contract award Procurement procedure Open procedure Contract
Job search services. Info. Buyer. Description. Publish date 3/2/2013 4:12 AM. Version 1. Url http://com.mercell.com/permalink/37970320.
Job search services Info Version 1 Url http://com.mercell.com/permalink/37970320.aspx External tender id 69695-2013 Tender type Contract Award Document type Contract award Procurement procedure Award of
A HUEDU OpenLab iskolai alkalmazáscsomag Kovács Lajos
A HUEDU OpenLab iskolai alkalmazáscsomag Kovács Lajos Rendszermérnök kovacs.lajos@npsh.hu A HUEDU program háttere 2 2009: 3 éves megállapodás az NFM és a Novell között --» 2012: keretszerződés meghosszabbítása
Sebastián Sáez Senior Trade Economist INTERNATIONAL TRADE DEPARTMENT WORLD BANK
Sebastián Sáez Senior Trade Economist INTERNATIONAL TRADE DEPARTMENT WORLD BANK Despite enormous challenges many developing countries are service exporters Besides traditional activities such as tourism;
Meal-cooking services
Meal-cooking services Info Version 2 Url http://com.mercell.com/permalink/45080144.aspx External tender id 281415-2014 Tender type Contract Award Document type Contract award Procurement procedure Open
SAJTÓKÖZLEMÉNY Budapest 2011. július 13.
SAJTÓKÖZLEMÉNY Budapest 2011. július 13. A MinDig TV a legdinamikusabban bıvülı televíziós szolgáltatás Magyarországon 2011 elsı öt hónapjában - A MinDig TV Extra a vezeték nélküli digitális televíziós
1. Gyakorlat: Telepítés: Windows Server 2008 R2 Enterprise, Core, Windows 7
1. Gyakorlat: Telepítés: Windows Server 2008 R2 Enterprise, Core, Windows 7 1.1. Új virtuális gép és Windows Server 2008 R2 Enterprise alap lemez létrehozása 1.2. A differenciális lemezek és a két új virtuális
Engineering services. Info. Buyer. Version changes Contract award. Description. Version 3. Publish date 10/22/2013 4:26 AM
Engineering services Info Version 3 Url http://com.mercell.com/permalink/38746327.aspx External tender id 355577-2013 Tender type Contract Award Document type Contract award Procurement procedure Open
DANS és Narcis. Burmeister Erzsébet. HUNOR találkozó, Budapest 2013. március 13.
DANS és Narcis Burmeister Erzsébet HUNOR találkozó, Budapest 2013. március 13. DANS DANS (Data Archiving and Network Services) http://www.dans.knaw.nl Kutatási adatok archiválása a saját fejlesztésű EASY
Having regard to the Treaty establishing the European Community,
L 323/10 EN Official Journal of the European Communities 7.12.2001 COMMISSION REGULATION (EC) No 2387/2001 of 6 December 2001 approving operations to check conformity to the marketing standards applicable
Vállalatirányítási rendszerek
Vállalatirányítási rendszerek Varga Zsigmond Üzletfejlesztési igazgató Budapest, 2015. március 03. Nyilvános Motiváció? 2013 SAP AG. All rights reserved. 2 Adatrögzítés része a fejlődésnek 3 Mestermunkától
Számítógépes Hálózatok GY 8.hét
Számítógépes Hálózatok GY 8.hét Laki Sándor ELTE-Ericsson Kommunikációs Hálózatok Laboratórium ELTE IK - Információs Rendszerek Tanszék lakis@elte.hu http://lakis.web.elte.hu Teszt 10 kérdés 10 perc canvas.elte.hu
Nemzeti Adó- és Vámhivatal Központi Hivatala 1095 Budapest IX., Mester u Budapest Pf. 109 H-Magyarország
MOVEMENT CERTIFICATE EUR. 1 1. Exporter (Name, full address, country) No C 6779801 See notes overleaf before completing this form. 2. Certificate used in preferential trade between 3. Consignee (Name,
Investment performance of the Hungarian Private and Voluntary Pension Funds (1999-2008)
Investment performance of the Hungarian Private and Voluntary Pension Funds In compliance with its legal reporting obligation (pursuant to Paragraph 24 Section 2 of the Government Decree No. 281/2001 (XII.26.)
1. ÁLTALÁNOS RENDELKEZÉSEK 1. GENERAL PROVISIONS
ADATVÉDELMI SZABÁLYZAT PRIVACY POLICY 1. ÁLTALÁNOS RENDELKEZÉSEK 1. GENERAL PROVISIONS 1.1 A jelen Adatvédelmi Szabályzat meghatározza a I.T. Magyar Cinema Kft. New Age Advertising Reklámszolgáltatási
2. Tavasz Kupa. Uszonyos és Búvárúszó Verseny Kiírása
2. Tavasz Kupa Uszonyos és Búvárúszó Verseny Kiírása 1,/ A verseny célja: Az uszonyos-, és búvárúszás népszerűsítése, versenyzők részére versenyzési lehetőség biztosítása. 2,/ A verseny rendezője: HÓD
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében. Dicse Jenő üzletfejlesztési igazgató
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében Dicse Jenő üzletfejlesztési igazgató How to apply modern e-learning to improve the training of firefighters Jenő Dicse Director of
Correlation & Linear Regression in SPSS
Petra Petrovics Correlation & Linear Regression in SPSS 4 th seminar Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Correlation