ETSI ES V1.3.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 7: Account Management (Parlay X 2)

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "ETSI ES V1.3.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 7: Account Management (Parlay X 2)"

Átírás

1 Standard Open Service Access (OSA); Parlay X Web Services; Part 7: Account Management (Parlay X 2)

2 2 Reference RES/TISPAN OSA Keywords API, OSA, service 650 Route des Lucioles F Sophia Antipolis Cedex - FRANCE Tel.: Fax: Siret N NAF 742 C Association à but non lucratif enregistrée à la Sous-Préfecture de Grasse (06) N 7803/88 Important notice Individual copies of the present document can be downloaded from: The present document may be made available in more than one electronic version or in print. In any case of existing or perceived difference in contents between such versions, the reference version is the Portable Document Format (PDF). In case of dispute, the reference shall be the printing on printers of the PDF version kept on a specific network drive within Secretariat. Users of the present document should be aware that the document may be subject to revision or change of status. Information on the current status of this and other documents is available at If you find errors in the present document, please send your comment to one of the following services: Copyright Notification No part may be reproduced except as authorized by written permission. The copyright and the foregoing restriction extend to reproduction in all media. European Telecommunications Standards Institute The Parlay Group All rights reserved. DECT TM, PLUGTESTS TM, UMTS TM, TIPHON TM, the TIPHON logo and the logo are Trade Marks of registered for the benefit of its Members. 3GPP TM is a Trade Mark of registered for the benefit of its Members and of the 3GPP Organizational Partners.

3 3 Contents Intellectual Property Rights...5 Foreword Scope References Normative references Definitions and abbreviations Definitions Abbreviations Detailed service description Namespaces Sequence diagrams Prepaid account recharge using a voucher Prepaid account recharge using direct payment XML Schema data type definition DatedTransaction structure Balance structure BalanceExpireDetails structure Web Service interface definition Interface: AccountManagement Operation: getbalance Input message: getbalancerequest Output message: getbalanceresponse Referenced faults Operation: getcreditexpirydate Input message: getcreditexpirydaterequest Output message: getcreditexpirydateresponse Referenced faults Operation: balanceupdate Input message: balanceupdaterequest Output message: balanceupdateresponse Referenced faults Operation: voucherupdate Input message: voucherupdaterequest Output message: voucherupdateresponse Referenced Faults Operation: gethistory Input message: gethistoryrequest Output message: gethistoryresponse Referenced faults Operation: getbalancetypes Input message: getbalancetypesrequest Output message: getbalancetypesresponse Referenced faults Fault definitions ServiceException SVC0250: End user authentication failed SVC0251: Unknown Voucher PolicyException POL0220: Vouchers not accepted Service policies...15

4 4 Annex A (normative): WSDL for Account Management...16 Annex B (informative): Bibliography...17 History...18

5 5 Intellectual Property Rights IPRs essential or potentially essential to the present document may have been declared to. The information pertaining to these essential IPRs, if any, is publicly available for members and non-members, and can be found in SR : "Intellectual Property Rights (IPRs); Essential, or potentially Essential, IPRs notified to in respect of standards", which is available from the Secretariat. Latest updates are available on the Web server ( Pursuant to the IPR Policy, no investigation, including IPR searches, has been carried out by. No guarantee can be given as to the existence of other IPRs not referenced in SR (or the updates on the Web server) which are, or may be, or may become, essential to the present document. Foreword This Standard (ES) has been produced by Technical Committee Telecommunications and Internet converged Services and Protocols for Advanced Networking (TISPAN). The present document is part 7 of a multi-part deliverable covering Open Service Access (OSA); Parlay X Web Services, as identified below: Part 1: Part 2: Part 3: Part 4: Part 5: Part 6: Part 7: Part 8: Part 9: Part 10: Part 11: Part 12: Part 13: Part 14: "Common"; "Third Party Call"; "Call Notification"; "Short Messaging"; "Multimedia Messaging"; "Payment"; "Account Management"; "Terminal Status"; "Terminal Location"; "Call Handling"; "Audio Call"; "Multimedia Conference"; "Address List Management"; "Presence". The present document has been defined jointly between, The Parlay Group ( and the 3GPP. The present document forms part of the Parlay X 2.2 set of specifications. The present document is equivalent to 3GPP TS V6.6.0 (Release 6).

6 6 1 Scope The present document is part 7 of the Stage 3 Parlay X 2 Web Services specification for Open Service Access (OSA). The OSA specifications define an architecture that enables application developers to make use of network functionality through an open standardized interface, i.e. the OSA APIs. The present document specifies the Account Management Web Service. The following are defined here: Name spaces. Sequence diagrams. Data definitions. Interface specification plus detailed method descriptions. Fault definitions. Service Policies. WSDL Description of the interfaces. 2 References References are either specific (identified by date of publication and/or edition number or version number) or non-specific. For a specific reference, subsequent revisions do not apply. Non-specific reference may be made only to a complete document or a part thereof and only in the following cases: - if it is accepted that it will be possible to use all future changes of the referenced document for the purposes of the referring document; - for informative references. Referenced documents which are not found to be publicly available in the expected location might be found at For online referenced documents, information sufficient to identify and locate the source shall be provided. Preferably, the primary source of the referenced document should be cited, in order to ensure traceability. Furthermore, the reference should, as far as possible, remain valid for the expected life of the document. The reference shall include the method of access to the referenced document and the full network address, with the same punctuation and use of upper case and lower case letters. NOTE: While any hyperlinks included in this clause were valid at the time of publication cannot guarantee their long term validity. 2.1 Normative references The following referenced documents are indispensable for the application of the present document. For dated references, only the edition cited applies. For non-specific references, the latest edition of the referenced document (including any amendments) applies. [1] W3C Recommendation (2 May 2001): "XML Schema Part 2: Datatypes". NOTE: Available at:

7 7 [2] ES : "Open Service Access (OSA); Parlay X Web Services; Part 1: Common (Parlay X 2)". [3] ISO 4217: "Codes for the representation of currencies and funds". 3 Definitions and abbreviations 3.1 Definitions For the purposes of the present document, the terms and definitions given in ES [2] apply. 3.2 Abbreviations For the purposes of the present document, the abbreviations given in ES [2] apply. 4 Detailed service description Pre-paid subscribers, whether they have subscribed to pre-paid telephony, SMS, or data service, have credits with their service providers; the consumption of services will lead to reduction of their credit, or the credit may expire. Therefore, from time to time, subscribers may have to recharge their accounts. This occurs through an application that interfaces with the subscriber either directly or indirectly. Examples of direct interaction are voice prompts and WAP/web pages, or even SMS. Typically, such multi-modal applications either request a currency amount and, e.g. credit card information, or a voucher number plus credentials. The voucher number and credentials are then validated and causes a pre-determined currency amount to be transferred. The Parlay X 2 Account Management API described in the present document supports account querying, direct recharging and recharging through vouchers. As a side effect, it may prevent subscribers from having their account balance credits expire. 5 Namespaces The AccountManagement interface uses the namespace: The data types are defined in the namespace: The "xsd" namespace is used in the present document to refer to the XML Schema data types defined in XML Schema [1]. The use of the name "xsd" is not semantically significant. 6 Sequence diagrams This clause discusses three scenarios; one where a subscriber uses a voucher, one where the subscriber directly recharges after the payment is cleared, and one where the subscriber checks the recent transactions. NOTE: Associated Account Management API messages are shown in "bold" format: e.g. (getbalance).

8 8 6.1 Prepaid account recharge using a voucher The prepaid subscriber wishes to recharge their account with a voucher and query their account balance. The subscriber uses their mobile phone or other wireline phone to interact with an IVR system. In order to recharge their account, the subscriber must enter the voucher number, the MSISDN to be recharged, and PIN(s). The IVR system accesses an external voucher database to validate the voucher number. The subscriber's account balance is then increased with the value of the voucher (voucherupdate). The subscriber queries their account balance (getbalance), before and/or after the recharge. : End User : IVR : Payment Web Service Log on to IVR Enter voucher information Update voucher Acknowledge receipt Request balance Get balance Balance Play balance message Figure Prepaid account recharge using direct payment Directly recharging (i.e. without a voucher) works much along the same way. In this case, we assume the prepaid subscriber interacts with a web page. After providing the MSISDN, along with the PIN, the user can query the account balance (getbalance). For recharging, the subscriber must enter payment details, for example credit card information, from which the payment will be made. After clearing the payment details, the currency amount will be transferred and the subscriber's prepaid account balance expiration date will be reset (balanceupdate). The subscriber also queries their account balance expiration date (getcreditexpirydate), after the recharge.

9 9 : End User : Self Serve Portal : Payment Web Service Log on to portal Request balance Get balance Balance Display account status Input recharge information Update balance Display account status Request credit expiry date Get credit expiry date Expiry date Display expiry date Log off Figure 2

10 10 7 XML Schema data type definition 7.1 DatedTransaction structure This data structure represents a transaction record. Element Name Element Type Optional Description transactiondate xsd:datetime No The date the transaction occurred. transactiondetails xsd:string No The transaction details. 7.2 Balance structure This data structure represents a balance record. Element Name Element Type Optional Description balancetype xsd:string No Identifies the type of balance. End user accounts may have one or more balances for different types of usage (e.g Voice, SMS, gaming etc) amount xsd:decimal No Amount of balance 7.3 BalanceExpireDetails structure This data structure represents balance expiry details. Element Name Element Type Optional Description balancetype xsd:string No Identifies the type of balance. End user accounts may have one or more balances for different types of usage (e.g Voice, SMS, gaming etc) date xsd:datetime Yes It is the date the identified balance will expire. Do not specify if the balance does not expire 8 Web Service interface definition 8.1 Interface: AccountManagement The Account Management interface provides access to account information for update and query operations Operation: getbalance This message results in getting account balances indicated by the end user identifier and associated end user PIN. The returned amount for each balance is specified as a currency amount. End users accounts may have a single balance for all usage, or may have multiple balances for different uses. For example, an end user may have a separate balance for voice calls, SMS messages, and GPRS usage Input message: getbalancerequest enduseridentifier xsd:anyuri No This parameter identifies the end user's account. enduserpin xsd:string Yes Contains the end user's credentials for authorizing access to the account

11 Output message: getbalanceresponse result Balance [1.. unbounded] No It is a set of Balance records, where each record specifies a balance type and the associated amount Referenced faults ServiceException from ES [2]: SVC Service error. SVC Invalid input value. SVC End user authentication failed. PolicyException from ES [2]: POL Policy error Operation: getcreditexpirydate This message results in getting the expiration date of the credit indicated by the end user identifier and associated end user PIN. The returned date is the date the current balance will expire Input message: getcreditexpirydaterequest enduseridentifier xsd:anyuri No This parameter identifies the end user's account. enduserpin xsd:string Yes Contains the end user's credentials for authorizing access to the account Output message: getcreditexpirydateresponse result BalanceExpireDetails [1.. unbounded] No It is a set of records, where each record specifies a balance type and the associated date that the balance will expire Referenced faults ServiceException from ES [2]: SVC Service error. SVC Invalid input value. SVC End user authentication failed. PolicyException from ES [2]: POL Policy error.

12 Operation: balanceupdate This message results in directly recharging the account indicated by the end user identifier and optional associated end user PIN. The reference code is used to uniquely identify the request; it is the application's responsibility to provide a unique reference code within the scope of the application. The balance type identifies an existing balance type in the account, or a new balance type to be added to the account. (Note that the getbalancetypes operation is used to discover the set of allowed balance types that can be associated with a specific end user s account.) The recharge is specified as a currency amount. The balance is requested to expire in the number of days indicated by the period parameter. The operator's policies may overrule this parameter. If the optional period parameter is not present, the operator's policy on balance expiration is always in effect Input message: balanceupdaterequest enduseridentifier xsd:anyuri No This parameter identifies the end user's account. enduserpin xsd:string Yes Contains the end user's credentials for authorizing access to the account. referencecode xsd:string No Textual information to uniquely identify the request, e.g. in case of disputes. balancetype xsd:string No Identifies the type of balance to be recharged. An end user s account may have a balance for each type of usage (e.g. Voice, SMS, gaming etc.). amount xsd:decimal No Currency amount that should be added to the balance identified in the balancetype part. period xsd:int Yes The balance is requested to expire in the number of days indicated by this parameter. The operator's policies may overrule this parameter. If this optional parameter is not present, the operator's policy on balance expiration is always in effect Output message: balanceupdateresponse None Referenced faults ServiceException from ES [2]: SVC Service error. SVC Invalid input value. SVC End user authentication failed. PolicyException from ES [2]: POL Policy error Operation: voucherupdate This message results in directly recharging the account indicated by the end user identifier and optional associated end user PIN. The reference code is used to uniquely identify the request; it is the application's responsibility to provide a unique reference code within the scope of the application. A voucher identifier indirectly specifies the charge. The optional voucher PIN code can be used to verify the voucher.

13 Input message: voucherupdaterequest enduseridentifier xsd:anyuri No This parameter identifies the end user's account. enduserpin xsd:string Yes Contains the end user's credentials for authorizing access to the account. referencecode xsd:string No Textual information to uniquely identify the request, e.g. in case of disputes. voucheridentifier xsd:string No This parameter identifies the voucher. voucherpin xsd:string Yes Contains the voucher's credentials for authentication Output message: voucherupdateresponse None Referenced Faults ServiceException from ES [2]: SVC Service error. SVC Invalid input value. SVC End user authentication failed. SVC Unknown voucher. PolicyException from ES [2]: POL Policy error. POL Vouchers not accepted Operation: gethistory This message results in returning the transaction history of the account indicated by the end user identifier and associated optional end user PIN. The maximum number of entries to return and the start date define the range of transactions that are of interest to the requester. If the total number of entries in the transaction history, starting at the specified date, is larger than the specified maximum number of entries, only the most recent events are returned. Note that the operator might limit the maximum amount of entries to be returned or the period for which the entries are to be returned Input message: gethistoryrequest enduseridentifier xsd:anyuri No This parameter identifies the end user's account. enduserpin xsd:string Yes Contains the end user's credentials for authorizing access to the account. date xsd:datetime Yes This parameter indicates the desired starting date for the entries to be returned. If this parameter is not present, it is up to the discretion of the service to decide this date. maxentries xsd:int Yes This parameter indicates the maximum number of entries that shall be returned. If this parameter is not present, it is up to the discretion of the service to decide how many entries to return.

14 Output message: gethistoryresponse result DatedTransaction [0.. unbounded] Yes It is a DatedTransaction array that consists of types with a date field and a string field: i.e. the date of the occurrence and the transaction details, respectively Referenced faults ServiceException from ES [2]: SVC Service error. SVC Invalid input value. PolicyException from ES [2]: POL Policy error Operation: getbalancetypes This operation is used to discover the set of all possible balance types that are permitted for a specified end user s account Input message: getbalancetypesrequest enduseridentifier xsd:anyuri No This parameter identifies the end user's account. enduserpin xsd:string Yes Contains the end user's credentials for authorizing access to the account Output message: getbalancetypesresponse result xsd:string [1.. unbounded] No Identifies all the balance types that are permitted for this end user s account. An end user s account may have one or more balances for different types of usage (e.g Voice, SMS, gaming etc.) Referenced faults ServiceException from ES [2]: SVC Service error. SVC Invalid input value. SVC End user authentication failed. PolicyException from ES [2]: POL Policy error.

15 15 9 Fault definitions 9.1 ServiceException SVC0250: End user authentication failed Name messageid text variables SVC0250 End user authentication failed. None. Description SVC0251: Unknown Voucher Name messageid text variables SVC0251 Voucher %1 is not valid. %1 Voucher identifier. Description 9.2 PolicyException POL0220: Vouchers not accepted Name messageid text variables POL0220 Vouchers not accepted. None. Description 10 Service policies Service policies for this service. Name Type Description VouchersAccepted xsd:boolean Indicates whether vouchers are accepted? Currency xsd:string Currency used by service (per ISO 4217 [3])

16 16 Annex A (normative): WSDL for Account Management The document/literal WSDL representation of this interface specification is compliant to ES [2] and is contained in text files (contained in archive es_ v010301p0.zip) which accompany the present document.

17 17 Annex B (informative): Bibliography TR : "Digital cellular telecommunications system (Phase 2+); Universal Mobile Telecommunications System (UMTS); Vocabulary for 3GPP Specifications (3GPP TR )".

18 18 History Document history V1.1.1 March 2005 Publication V1.2.1 December 2006 Publication V1.3.1 February 2008 Membership Approval Procedure MV : to V1.3.1 May 2008 Publication

Final draft ETSI ES V1.1.1 ( )

Final draft ETSI ES V1.1.1 ( ) Standard Open Service Access (OSA); Parlay X Web Services; Part 11: Audio Call 2 Reference DES/TISPAN-01007-11-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis Cedex - FRANCE

Részletesebben

ETSI ES V1.3.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 11: Audio Call (Parlay X 2)

ETSI ES V1.3.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 11: Audio Call (Parlay X 2) Standard Open Service Access (OSA); Parlay X Web Services; Part 11: Audio Call (Parlay X 2) 2 Reference RES/TISPAN-01056-11-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis

Részletesebben

ETSI ES V1.2.1 ( )

ETSI ES V1.2.1 ( ) Standard Open Service Access (OSA); Parlay X Web Services; Part 10: Call Handling (Parlay X 2) 2 Reference RES/TISPAN-01033-10-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis

Részletesebben

ETSI ES V1.2.1 ( )

ETSI ES V1.2.1 ( ) Standard Open Service Access (OSA); Parlay X Web Services; Part 2: Third Party Call (Parlay X 2) 2 Reference RES/TISPAN-01033-02-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis

Részletesebben

ETSI ES V1.1.1 ( )

ETSI ES V1.1.1 ( ) Standard Open Service Access (OSA); Parlay X Web Services; Part 6: Payment 2 Reference DES/TISPAN-01007-06-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis Cedex - FRANCE

Részletesebben

ETSI ES V1.1.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 8: Terminal Status (Parlay X 3)

ETSI ES V1.1.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 8: Terminal Status (Parlay X 3) Standard Open Service Access (OSA); Parlay X Web Services; Part 8: Terminal Status (Parlay X 3) 2 Reference DES/TISPAN-01034-8-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis

Részletesebben

ETSI ES V1.2.1 ( )

ETSI ES V1.2.1 ( ) Standard Open Service Access (OSA); Parlay X Web Services; Part 6: Payment (Parlay X 2) 2 Reference RES/TISPAN-01033-06-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis Cedex

Részletesebben

ETSI ES V1.3.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 13: Address List Management (Parlay X 2)

ETSI ES V1.3.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 13: Address List Management (Parlay X 2) Standard Open Service Access (OSA); Parlay X Web Services; Part 13: Address List Management (Parlay X 2) 2 Reference RES/TISPAN-01056-13-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia

Részletesebben

ETSI ES V1.1.1 ( )

ETSI ES V1.1.1 ( ) Standard Open Service Access (OSA); Parlay X Web Services; Part 5: Multimedia Messaging 2 Reference DES/TISPAN-01007-05-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis Cedex

Részletesebben

ETSI ES V1.1.1 ( )

ETSI ES V1.1.1 ( ) Standard Open Service Access (OSA); Parlay X Web Services; Part 13: Address List Management 2 Reference DES/TISPAN-01007-13-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis

Részletesebben

ETSI ES V1.1.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 16: Geocoding (Parlay X 3)

ETSI ES V1.1.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 16: Geocoding (Parlay X 3) Standard Open Service Access (OSA); Parlay X Web Services; Part 16: Geocoding (Parlay X 3) 2 Reference DES/TISPAN-01034-16-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis

Részletesebben

ETSI ES V1.2.1 ( )

ETSI ES V1.2.1 ( ) Standard Open Service Access (OSA); Parlay X Web Services; Part 5: Multimedia Messaging (Parlay X 2) 2 Reference RES/TISPAN-01033-05-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia

Részletesebben

ETSI ES V1.3.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 5: Multimedia Messaging (Parlay X 2)

ETSI ES V1.3.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 5: Multimedia Messaging (Parlay X 2) Standard Open Service Access (OSA); Parlay X Web Services; Part 5: Multimedia Messaging (Parlay X 2) 2 Reference RES/TISPAN-01056-05-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia

Részletesebben

ETSI ES V1.1.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 3: Call Notification (Parlay X 3)

ETSI ES V1.1.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 3: Call Notification (Parlay X 3) Standard Open Service Access (OSA); Parlay X Web Services; Part 3: Call Notification (Parlay X 3) 2 Reference DES/TISPAN-01034-3-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis

Részletesebben

ETSI ES V1.1.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 15: Message Broadcast (Parlay X 3)

ETSI ES V1.1.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 15: Message Broadcast (Parlay X 3) Standard Open Service Access (OSA); Parlay X Web Services; Part 15: Message Broadcast (Parlay X 3) 2 Reference DES/TISPAN-01034-15-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis

Részletesebben

ETSI ES V1.1.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 4: Short Messaging (Parlay X 3)

ETSI ES V1.1.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 4: Short Messaging (Parlay X 3) Standard Open Service Access (OSA); Parlay X Web Services; Part 4: Short Messaging (Parlay X 3) 2 Reference DES/TISPAN-01034-4-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis

Részletesebben

EN United in diversity EN A8-0206/419. Amendment

EN United in diversity EN A8-0206/419. Amendment 22.3.2019 A8-0206/419 419 Article 2 paragraph 4 point a point i (i) the identity of the road transport operator; (i) the identity of the road transport operator by means of its intra-community tax identification

Részletesebben

ETSI ES V1.3.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 1: Common (Parlay X 2)

ETSI ES V1.3.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 1: Common (Parlay X 2) Standard Open Service Access (OSA); Parlay X Web Services; Part 1: Common (Parlay X 2) 2 Reference RES/TISPAN-01056-01-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis Cedex

Részletesebben

PIACI HIRDETMÉNY / MARKET NOTICE

PIACI HIRDETMÉNY / MARKET NOTICE PIACI HIRDETMÉNY / MARKET NOTICE HUPX DAM Másnapi Aukció / HUPX DAM Day-Ahead Auction Iktatási szám / Notice #: Dátum / Of: 18/11/2014 HUPX-MN-DAM-2014-0023 Tárgy / Subject: Változások a HUPX másnapi piac

Részletesebben

Using the CW-Net in a user defined IP network

Using the CW-Net in a user defined IP network Using the CW-Net in a user defined IP network Data transmission and device control through IP platform CW-Net Basically, CableWorld's CW-Net operates in the 10.123.13.xxx IP address range. User Defined

Részletesebben

USER MANUAL Guest user

USER MANUAL Guest user USER MANUAL Guest user 1 Welcome in Kutatótér (Researchroom) Top menu 1. Click on it and the left side menu will pop up 2. With the slider you can make left side menu visible 3. Font side: enlarging font

Részletesebben

Széchenyi István Egyetem www.sze.hu/~herno

Széchenyi István Egyetem www.sze.hu/~herno Oldal: 1/6 A feladat során megismerkedünk a C# és a LabVIEW összekapcsolásának egy lehetőségével, pontosabban nagyon egyszerű C#- ban írt kódból fordítunk DLL-t, amit meghívunk LabVIEW-ból. Az eljárás

Részletesebben

ETSI ES V1.1.1 ( )

ETSI ES V1.1.1 ( ) Standard Open Service Access (OSA); Parlay X Web Services; Part 1: Common 2 Reference DES/TISPAN-01007-01-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis Cedex - FRANCE Tel.:

Részletesebben

Cashback 2015 Deposit Promotion teljes szabályzat

Cashback 2015 Deposit Promotion teljes szabályzat Cashback 2015 Deposit Promotion teljes szabályzat 1. Definitions 1. Definíciók: a) Account Client s trading account or any other accounts and/or registers maintained for Számla Az ügyfél kereskedési számlája

Részletesebben

BKI13ATEX0030/1 EK-Típus Vizsgálati Tanúsítvány/ EC-Type Examination Certificate 1. kiegészítés / Amendment 1 MSZ EN 60079-31:2014

BKI13ATEX0030/1 EK-Típus Vizsgálati Tanúsítvány/ EC-Type Examination Certificate 1. kiegészítés / Amendment 1 MSZ EN 60079-31:2014 (1) EK-TípusVizsgálati Tanúsítvány (2) A potenciálisan robbanásveszélyes környezetben történő alkalmazásra szánt berendezések, védelmi rendszerek 94/9/EK Direktíva / Equipment or Protective Systems Intended

Részletesebben

ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP

ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP CHILD S DATA / GYERMEK ADATAI PLEASE FILL IN THIS INFORMATION WITH DATA BASED ON OFFICIAL DOCUMENTS / KÉRJÜK, TÖLTSE KI A HIVATALOS DOKUMENTUMOKBAN SZEREPLŐ ADATOK

Részletesebben

Számlakezelés az ELO DocXtraktor modullal

Számlakezelés az ELO DocXtraktor modullal ELOECMSzakmai Kongresszus2013 Számlakezelés az ELO DocXtraktor modullal Kovács Eszter Kovacs.eszter@pentatrade.hu Projekt bemutatása A Cég Cégcsoport Éves árbevétel 140 mrd FT > 5 500 dolgozó ( 1 000 fı

Részletesebben

Eladni könnyedén? Oracle Sales Cloud. Horváth Tünde Principal Sales Consultant 2014. március 23.

Eladni könnyedén? Oracle Sales Cloud. Horváth Tünde Principal Sales Consultant 2014. március 23. Eladni könnyedén? Oracle Sales Cloud Horváth Tünde Principal Sales Consultant 2014. március 23. Oracle Confidential Internal/Restricted/Highly Restricted Safe Harbor Statement The following is intended

Részletesebben

Cloud computing. Cloud computing. Dr. Bakonyi Péter.

Cloud computing. Cloud computing. Dr. Bakonyi Péter. Cloud computing Cloud computing Dr. Bakonyi Péter. 1/24/2011 1/24/2011 Cloud computing 2 Cloud definició A cloud vagy felhő egy platform vagy infrastruktúra Az alkalmazások és szolgáltatások végrehajtására

Részletesebben

Paysera VISA cards are secured with "3-D technology" which ensures safer payments with payment cards online.

Paysera VISA cards are secured with 3-D technology which ensures safer payments with payment cards online. Paysera VISA card Safe payments online Paysera VISA cards are secured with "3-D technology" which ensures safer payments with payment cards online. When purchasing at e-shops labelled with "Paysera VISA",

Részletesebben

Új funkciók az RBP-ben 2015. október 1-től New functions in RBP from 1 October 2015. Tatár Balázs

Új funkciók az RBP-ben 2015. október 1-től New functions in RBP from 1 October 2015. Tatár Balázs Új funkciók az RBP-ben 2015. október 1-től New functions in RBP from 1 October 2015 Tatár Balázs Üzletfejlesztés vezető / Business Development Manager Rendszerhasználói Tájékoztató Nap, 2015. szeptember

Részletesebben

STUDENT LOGBOOK. 1 week general practice course for the 6 th year medical students SEMMELWEIS EGYETEM. Name of the student:

STUDENT LOGBOOK. 1 week general practice course for the 6 th year medical students SEMMELWEIS EGYETEM. Name of the student: STUDENT LOGBOOK 1 week general practice course for the 6 th year medical students Name of the student: Dates of the practice course: Name of the tutor: Address of the family practice: Tel: Please read

Részletesebben

Lexington Public Schools 146 Maple Street Lexington, Massachusetts 02420

Lexington Public Schools 146 Maple Street Lexington, Massachusetts 02420 146 Maple Street Lexington, Massachusetts 02420 Surplus Printing Equipment For Sale Key Dates/Times: Item Date Time Location Release of Bid 10/23/2014 11:00 a.m. http://lps.lexingtonma.org (under Quick

Részletesebben

Cloud computing Dr. Bakonyi Péter.

Cloud computing Dr. Bakonyi Péter. Cloud computing Dr. Bakonyi Péter. 1/24/2011 Cloud computing 1/24/2011 Cloud computing 2 Cloud definició A cloud vagy felhő egy platform vagy infrastruktúra Az alkalmazások és szolgáltatások végrehajtására

Részletesebben

DANS és Narcis. Burmeister Erzsébet. HUNOR találkozó, Budapest 2013. március 13.

DANS és Narcis. Burmeister Erzsébet. HUNOR találkozó, Budapest 2013. március 13. DANS és Narcis Burmeister Erzsébet HUNOR találkozó, Budapest 2013. március 13. DANS DANS (Data Archiving and Network Services) http://www.dans.knaw.nl Kutatási adatok archiválása a saját fejlesztésű EASY

Részletesebben

Megbízási szerződés (KP) Agency Agreement (TP) mely létrejött egyrészről a. concluded by and between

Megbízási szerződés (KP) Agency Agreement (TP) mely létrejött egyrészről a. concluded by and between Megbízási szerződés (KP) Agency Agreement (TP) mely létrejött egyrészről a Cégnév: Székhely: Cégjegyzékszám:. Adószám: mint megbízó (továbbiakban: Megbízó) másrészről pedig a concluded by and between Company

Részletesebben

Utasítások. Üzembe helyezés

Utasítások. Üzembe helyezés HASZNÁLATI ÚTMUTATÓ Üzembe helyezés Utasítások Windows XP / Vista / Windows 7 / Windows 8 rendszerben történő telepítéshez 1 Töltse le az AORUS makróalkalmazás telepítőjét az AORUS hivatalos webhelyéről.

Részletesebben

PIACI HIRDETMÉNY / MARKET NOTICE

PIACI HIRDETMÉNY / MARKET NOTICE PIACI HIRDETMÉNY / MARKET NOTICE HUPX Fizikai Futures (PhF) / HUPX Physical Futures (PhF) Iktatási szám / Notice #: HUPX-MN-PhF-2015-0003 Dátum / Of: 20/04/2015 Tárgy / Subject: Hatályos díjszabás és kedvezmények

Részletesebben

Könnyen bevezethető ITIL alapú megoldások a Novell ZENworks segítségével. Hargitai Zsolt Sales Support Manager Novell Hungary

Könnyen bevezethető ITIL alapú megoldások a Novell ZENworks segítségével. Hargitai Zsolt Sales Support Manager Novell Hungary Könnyen bevezethető ITIL alapú megoldások a Novell ZENworks segítségével Hargitai Zsolt Sales Support Manager Novell Hungary Napirend ITIL rövid áttekintés ITIL komponensek megvalósítása ZENworks segítségével

Részletesebben

PIACI HIRDETMÉNY / MARKET NOTICE

PIACI HIRDETMÉNY / MARKET NOTICE PIACI HIRDETMÉNY / MARKET NOTICE HUPX DAM Másnapi Aukció / HUPX DAM Day-Ahead Auction Iktatási szám / Notice #: HUPX-MN-DAM-2018-0001 Dátum / Of: 26/01/2018 Tárgy / Subject: Hatályos díjszabás és kedvezmények

Részletesebben

PIACI HIRDETMÉNY / MARKET NOTICE

PIACI HIRDETMÉNY / MARKET NOTICE PIACI HIRDETMÉNY / MARKET NOTICE HUPX DAM Másnapi Aukció / HUPX DAM Day-Ahead Auction Iktatási szám / Notice #: HUPX-MN-DAM-2018-0010 Dátum / Of: 12/10/2018 Tárgy / Subject: Hatályos díjszabás és kedvezmények

Részletesebben

(NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV

(NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV Kommunikációs rendszerek programozása (NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV (5. mérés) SIP telefonközpont készítése Trixbox-szal 1 Mérés helye: Széchenyi István Egyetem, L-1/7 laboratórium, 9026 Győr, Egyetem

Részletesebben

Vállalati kockázatkezelés jelentősége

Vállalati kockázatkezelés jelentősége www.pwc.com/hu Vállalati kockázatkezelés jelentősége Fedor Péter 2013. szeptember 19. Miről lesz szó 1. Mi is az az ERM? 2. Miért fontos? 3. Gyakorlati sajátosságok PwC Magyarország Mi is az az ERM? PwC

Részletesebben

Correlation & Linear Regression in SPSS

Correlation & Linear Regression in SPSS Petra Petrovics Correlation & Linear Regression in SPSS 4 th seminar Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Correlation

Részletesebben

Az egészségügyi munkaerő toborzása és megtartása Európában

Az egészségügyi munkaerő toborzása és megtartása Európában Az egészségügyi munkaerő toborzása és megtartása Európában Vezetői összefoglaló Európai Egészségügyi Menedzsment Társaság. április Fogyasztó-, Egészség-, Élelmiszerügyi és Mezőgazdasági Végrehajtó Ügynökség

Részletesebben

Proxer 7 Manager szoftver felhasználói leírás

Proxer 7 Manager szoftver felhasználói leírás Proxer 7 Manager szoftver felhasználói leírás A program az induláskor elkezdi keresni az eszközöket. Ha van olyan eszköz, amely virtuális billentyűzetként van beállítva, akkor azokat is kijelzi. Azokkal

Részletesebben

INFORMATION ON COMPLAINT HANDLING

INFORMATION ON COMPLAINT HANDLING PANASZKEZELÉSI TÁJÉKOZTATÓ Az ACN Communications Hungary Korlátolt Felelősségű Társaság (székhely: 1132 Budapest, Váci út 30, VI emelet; ACN ) az alábbiakban tájékoztatja előfizetőit az ACN által nyújtott

Részletesebben

Computer Architecture

Computer Architecture Computer Architecture Locality-aware programming 2016. április 27. Budapest Gábor Horváth associate professor BUTE Department of Telecommunications ghorvath@hit.bme.hu Számítógép Architektúrák Horváth

Részletesebben

ELOECMSzakmai Kongresszus2013

ELOECMSzakmai Kongresszus2013 ELOECMSzakmai Kongresszus2013 Keynote Horváth Szilvia Ügyvezető s.horvath@elo.com Cégünk rövid bemutatása 1871 Louis Leitz megalapítja első vállalatát 1995 Az első elektronikus Leitz dokumentumkezelő (ELOoffice)

Részletesebben

Web Services. (webszolgáltatások): egy osztott alkalmazásfejlesztési plattform

Web Services. (webszolgáltatások): egy osztott alkalmazásfejlesztési plattform (webszolgáltatások): egy osztott alkalmazásfejlesztési plattform Ficsor Lajos Általános Informatikai Tanszék Miskolci Egyetem A Web Service Web Service definíciója Számos definíció létezik. IBM [4] A Web

Részletesebben

Szakmai továbbképzési nap akadémiai oktatóknak. 2012. december 14. HISZK, Hódmezővásárhely / Webex

Szakmai továbbképzési nap akadémiai oktatóknak. 2012. december 14. HISZK, Hódmezővásárhely / Webex Szakmai továbbképzési nap akadémiai oktatóknak 2012. december 14. HISZK, Hódmezővásárhely / Webex 14.00-15.00 15.00-15.30 15.30-15.40 Mai program 1. Amit feltétlenül ismernünk kell: az irányítótábla közelebbről.

Részletesebben

Teszt topológia E1/1 E1/0 SW1 E1/0 E1/0 SW3 SW2. Kuris Ferenc - [HUN] Cisco Blog -

Teszt topológia E1/1 E1/0 SW1 E1/0 E1/0 SW3 SW2. Kuris Ferenc - [HUN] Cisco Blog - VTP Teszt topológia E1/1 E1/0 SW1 E1/0 E1/0 SW2 SW3 2 Alap konfiguráció SW1-2-3 conf t interface e1/0 switchport trunk encapsulation dot1q switchport mode trunk vtp domain CCIE vtp mode transparent vtp

Részletesebben

Adatbázis-kezelés ODBC driverrel

Adatbázis-kezelés ODBC driverrel ADATBÁZIS-KEZELÉS ODBC DRIVERREL... 1 ODBC: OPEN DATABASE CONNECTIVITY (NYÍLT ADATBÁZIS KAPCSOLÁS)... 1 AZ ODBC FELÉPÍTÉSE... 2 ADATBÁZIS REGISZTRÁCIÓ... 2 PROJEKT LÉTREHOZÁSA... 3 A GENERÁLT PROJEKT FELÉPÍTÉSE...

Részletesebben

ELO Digital Office ERP integráció

ELO Digital Office ERP integráció ELO Digital Office ERP integráció Lázár Péter ECM Business Unit Manager peter.lazar@itelligence.hu Enterprise Content Management www.elo.com Miért kell ERP integráció? Hozzáféréseket szabályozni és auditálni

Részletesebben

Nemzetközi vállalat - a vállalati szoftvermegoldások egyik vezető szállítója

Nemzetközi vállalat - a vállalati szoftvermegoldások egyik vezető szállítója Nemzetközi vállalat - a vállalati szoftvermegoldások egyik vezető szállítója A Novell világszerte vezető szerepet tölt be a Linux-alapú és nyílt forráskódú vállalati operációs rendszerek, valamit a vegyes

Részletesebben

Intézményi IKI Gazdasági Nyelvi Vizsga

Intézményi IKI Gazdasági Nyelvi Vizsga Intézményi IKI Gazdasági Nyelvi Vizsga Név:... Születési hely:... Születési dátum (év/hó/nap):... Nyelv: Angol Fok: Alapfok 1. Feladat: Olvasáskészséget mérő feladat 20 pont Olvassa el a szöveget és válaszoljon

Részletesebben

INTELLIGENT ENERGY EUROPE PROGRAMME BUILD UP SKILLS TRAINBUD. Quality label system

INTELLIGENT ENERGY EUROPE PROGRAMME BUILD UP SKILLS TRAINBUD. Quality label system INTELLIGENT ENERGY EUROPE PROGRAMME BUILD UP SKILLS TRAINBUD WP4: Deliverable 4.5 Development of voluntary qualification system Quality label system 1 INTELLIGENT ENERGY EUROPE PROGRAMME BUILD UP SKILLS

Részletesebben

Directors and Officers Liability Insurance Questionnaire Adatlap vezetõ tisztségviselõk és felügyelõbizottsági tagok felelõsségbiztosításához

Directors and Officers Liability Insurance Questionnaire Adatlap vezetõ tisztségviselõk és felügyelõbizottsági tagok felelõsségbiztosításához Directors and Officers Liability Insurance Questionnaire Adatlap vezetõ tisztségviselõk és felügyelõbizottsági tagok felelõsségbiztosításához 1. Name, legal form and address of company Társaság neve, címe,

Részletesebben

2. Tavasz Kupa. Uszonyos és Búvárúszó Verseny Kiírása

2. Tavasz Kupa. Uszonyos és Búvárúszó Verseny Kiírása 2. Tavasz Kupa Uszonyos és Búvárúszó Verseny Kiírása 1,/ A verseny célja: Az uszonyos-, és búvárúszás népszerűsítése, versenyzők részére versenyzési lehetőség biztosítása. 2,/ A verseny rendezője: HÓD

Részletesebben

székhely: 1133 Budapest, Tutaj u. 6/A Registered office: 1133 Budapest, Tutaj u. 6/A

székhely: 1133 Budapest, Tutaj u. 6/A Registered office: 1133 Budapest, Tutaj u. 6/A Átvállalási megállapodás a gyártó visszavételi és begyűjtési kötelezettségeinek átvállalásáról Agreement on Transfer of Responsibility in respect of the manufacturer s obligations to take back and collect

Részletesebben

ACO burkolható fedlapok. ACO műszaki katalógus ACO Burkolható fedlapok UNIFACE PAVING SOLID

ACO burkolható fedlapok. ACO műszaki katalógus ACO Burkolható fedlapok UNIFACE PAVING SOLID ACO burkolható fedlapok ACO burkolható fedlapok ACO műszaki katalógus ACO Burkolható fedlapok UNIFACE PAVING SOLID ACO gully Tartalom Általános információk 3 page ACO Uniface ACO UNIFACE burkolható fedlap

Részletesebben

Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel

Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel Timea Farkas Click here if your download doesn"t start

Részletesebben

10. Gyakorlat: Alkalmazások publikálása Remote Desktop Szervízen keresztül

10. Gyakorlat: Alkalmazások publikálása Remote Desktop Szervízen keresztül 10. Gyakorlat: Alkalmazások publikálása Remote Desktop Szervízen keresztül 10.1. Jogosultságok és csoportok létrehozása 10.2. Az RDS szerver szerepkör telepítése a DC01-es szerverre 10.3. Az RDS01-es szerver

Részletesebben

Azonnali átvezetés Terhelés konverzió nélkül december 31. nincs december 31.

Azonnali átvezetés Terhelés konverzió nélkül december 31. nincs december 31. MELLÉKLETEK APPENDICES 1. számú melléklet Fizetési megbízás benyújtása elektronikus csatornán Fizetés iránya Tranzakció Pénznemek közötti átváltás (konverzió) Saját számlák között Befogadás Árfolyammegállapítás

Részletesebben

On The Number Of Slim Semimodular Lattices

On The Number Of Slim Semimodular Lattices On The Number Of Slim Semimodular Lattices Gábor Czédli, Tamás Dékány, László Ozsvárt, Nóra Szakács, Balázs Udvari Bolyai Institute, University of Szeged Conference on Universal Algebra and Lattice Theory

Részletesebben

DETAILED GUIDELINE Content Page

DETAILED GUIDELINE Content Page 1 DETAILED GUIDELINE Content Page Purchase for official purposes by Foreign Armed Forces and International Military Headquarters: VAT exemption 2 Purchase for official purposes by Foreign Armed Forces

Részletesebben

Személyes adatváltoztatási formanyomtatvány- Magyarország / Personal Data Change Form - Hungary

Személyes adatváltoztatási formanyomtatvány- Magyarország / Personal Data Change Form - Hungary Személyes adatváltoztatási formanyomtatvány- Magyarország / Personal Data Change Form - Hungary KITÖLTÉSI ÚTMUTATÓ: A formanyomtatványon a munkavállaló a személyes adatainak módosítását kezdeményezheti.

Részletesebben

Mapping Sequencing Reads to a Reference Genome

Mapping Sequencing Reads to a Reference Genome Mapping Sequencing Reads to a Reference Genome High Throughput Sequencing RN Example applications: Sequencing a genome (DN) Sequencing a transcriptome and gene expression studies (RN) ChIP (chromatin immunoprecipitation)

Részletesebben

Cut-Off Time for Payment Orders, Incoming Payments And Fulfilment Orders

Cut-Off Time for Payment Orders, Incoming Payments And Fulfilment Orders Cut-Off Time for Payment Orders, Incoming Payments And Fulfilment Orders Effective from 1 st of January 2016 1 Cut-off times for the receipt of payment orders for same-day processing: On every business

Részletesebben

EN United in diversity EN A8-0206/473. Amendment

EN United in diversity EN A8-0206/473. Amendment 21.3.2019 A8-0206/473 473 Recital 12 d (new) (12d) Since there is no sufficient link of a driver with a territory of a Member State of transit, transit operations should not be considered as posting situations.

Részletesebben

Néhány folyóiratkereső rendszer felsorolása és példa segítségével vázlatos bemutatása Sasvári Péter

Néhány folyóiratkereső rendszer felsorolása és példa segítségével vázlatos bemutatása Sasvári Péter Néhány folyóiratkereső rendszer felsorolása és példa segítségével vázlatos bemutatása Sasvári Péter DOI: http://doi.org/10.13140/rg.2.2.28994.22721 A tudományos közlemények írása minden szakma művelésének

Részletesebben

Csatlakozás a BME eduroam hálózatához Setting up the BUTE eduroam network

Csatlakozás a BME eduroam hálózatához Setting up the BUTE eduroam network Csatlakozás a BME eduroam hálózatához Setting up the BUTE eduroam network Table of Contents Windows 7... 2 Windows 8... 6 Windows Phone... 11 Android... 12 iphone... 14 Linux (Debian)... 20 Sebők Márton

Részletesebben

EN United in diversity EN A8-0206/445. Amendment

EN United in diversity EN A8-0206/445. Amendment 21.3.2019 A8-0206/445 445 Title Proposal for a DIRECTIVE OF THE EUROPEAN PARLIAMENT AND OF THE COUNCIL amending Directive 2006/22/EC as regards enforcement requirements and laying down specific rules with

Részletesebben

General information for the participants of the GTG Budapest, 2017 meeting

General information for the participants of the GTG Budapest, 2017 meeting General information for the participants of the GTG Budapest, 2017 meeting Currency is Hungarian Forint (HUF). 1 EUR 310 HUF, 1000 HUF 3.20 EUR. Climate is continental, which means cold and dry in February

Részletesebben

KELER KSZF Zrt. bankgarancia-befogadási kondíciói. Hatályos: 2014. július 8.

KELER KSZF Zrt. bankgarancia-befogadási kondíciói. Hatályos: 2014. július 8. KELER KSZF Zrt. bankgarancia-befogadási kondíciói Hatályos: 2014. július 8. A KELER KSZF a nem-pénzügyi klíringtagjaitól, és az energiapiaci alklíringtagjaitól a KELER KSZF Általános Üzletszabályzata szerinti

Részletesebben

Megfelelés az új iratkezelési rendeletnek az ELOik modullal

Megfelelés az új iratkezelési rendeletnek az ELOik modullal Megfelelés az új iratkezelési rendeletnek az ELOik modullal Dezsényi Csaba csaba.dezsenyi@ovitas.hu Mindenki nyugodjon meg! Az meg fog felelni az új jogszabályoknak! 2 Mit jelent? Felülvizsgálat Szerelés

Részletesebben

FOSS4G-CEE Prágra, 2012 május. Márta Gergely Sándor Csaba

FOSS4G-CEE Prágra, 2012 május. Márta Gergely Sándor Csaba FOSS4G-CEE Prágra, 2012 május Márta Gergely Sándor Csaba Reklám helye 2009 óta Intergraph szoftverek felől jöttünk FOSS4G felé megyünk Békés egymás mellett élés több helyen: Geoshop.hu Terkep.torokbalint.hu

Részletesebben

Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Factor Analysis

Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Factor Analysis Factor Analysis Factor analysis is a multiple statistical method, which analyzes the correlation relation between data, and it is for data reduction, dimension reduction and to explore the structure. Aim

Részletesebben

Create & validate a signature

Create & validate a signature IOTA TUTORIAL 7 Create & validate a signature v.0.0 KNBJDBIRYCUGVWMSKPVA9KOOGKKIRCBYHLMUTLGGAV9LIIPZSBGIENVBQ9NBQWXOXQSJRIRBHYJ9LCTJLISGGBRFRTTWD ABBYUVKPYFDJWTFLICYQQWQVDPCAKNVMSQERSYDPSSXPCZLVKWYKYZMREAEYZOSPWEJLHHFPYGSNSUYRZXANDNQTTLLZA

Részletesebben

www.pwc.com Aktuális adózási és szabályozási kérdések a turizmusban 2012-es adóváltozások Személyi jövedelemadó

www.pwc.com Aktuális adózási és szabályozási kérdések a turizmusban 2012-es adóváltozások Személyi jövedelemadó www.pwc.com Aktuális adózási és szabályozási kérdések a turizmusban 2012-es adóváltozások Személyi jövedelemadó SZJA változások Tartalom Személyi jövedelemadó Összevonás alá eső juttatások Béren kívüli

Részletesebben

1. Gyakorlat: Telepítés: Windows Server 2008 R2 Enterprise, Core, Windows 7

1. Gyakorlat: Telepítés: Windows Server 2008 R2 Enterprise, Core, Windows 7 1. Gyakorlat: Telepítés: Windows Server 2008 R2 Enterprise, Core, Windows 7 1.1. Új virtuális gép és Windows Server 2008 R2 Enterprise alap lemez létrehozása 1.2. A differenciális lemezek és a két új virtuális

Részletesebben

Személyes adatváltoztatási formanyomtatvány - Magyarország / Personal Data Change Form - Hungary

Személyes adatváltoztatási formanyomtatvány - Magyarország / Personal Data Change Form - Hungary Személyes adatváltoztatási formanyomtatvány - Magyarország / Personal Data Change Form - Hungary Kitöltési útmutató: A formanyomtatványon a munkavállaló a személyes adatainak módosítását kezdeményezheti.

Részletesebben

Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz

Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz Kvantumkapuk, áramkörök 2016. március 3. A kvantummechanika posztulátumai (1-2) 1. Állapotleírás Zárt fizikai rendszer aktuális állapota

Részletesebben

Készítették: Katzenberger Péter és Wieszt Ferenc. Mobile Messaging 3.0. Szolgáltatások és alkalmazások tárgy szemináriuma

Készítették: Katzenberger Péter és Wieszt Ferenc. Mobile Messaging 3.0. Szolgáltatások és alkalmazások tárgy szemináriuma Készítették: Katzenberger Péter és Wieszt Ferenc Mobile Messaging 3.0 Szolgáltatások és alkalmazások tárgy szemináriuma Tartalomjegyzék Bevezető Mobil Messaging kezdetek (SMS, EMS, MMS) Mobile Messaging

Részletesebben

4. Gyakorlat: Csoportházirend beállítások

4. Gyakorlat: Csoportházirend beállítások 4. Gyakorlat: Csoportházirend beállítások 4.1. A Default Domain Policy jelszóra vonatkozó beállításai 4.2. Parancsikon, mappa és hálózati meghajtó megjelenítése csoport házirend segítségével 4.3. Alkalmazások

Részletesebben

Rotary District 1911 DISTRICT TÁMOGATÁS IGÉNYLŐ LAP District Grants Application Form

Rotary District 1911 DISTRICT TÁMOGATÁS IGÉNYLŐ LAP District Grants Application Form 1 A Future Vision pilot célja a Future Vision Plan (Jövőkép terv) egyszerűsített támogatási modelljének tesztelése, és a Rotaristák részvételének növelése a segélyezési folyamatokban. A teszt során a districteknek

Részletesebben

KOGGM614 JÁRMŰIPARI KUTATÁS ÉS FEJLESZTÉS FOLYAMATA

KOGGM614 JÁRMŰIPARI KUTATÁS ÉS FEJLESZTÉS FOLYAMATA KOGGM614 JÁRMŰIPARI KUTATÁS ÉS FEJLESZTÉS FOLYAMATA System Design Wahl István 2019.03.26. BME FACULTY OF TRANSPORTATION ENGINEERING AND VEHICLE ENGINEERING Tartalomjegyzék Rövidítések A rendszer definiálása

Részletesebben

Affinium LED string lp w6300 P10

Affinium LED string lp w6300 P10 Affinium LED string lp w6300 P10 Termékcsalád leírás Komplett, egyszerűen felszerelhető, flexibilis vezetékre szerelt LED modulok Philips LED Power meghajtóval Ideális reklámvilágítás; nagyméretű betükhöz

Részletesebben

Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Nonparametric Tests

Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Nonparametric Tests Nonparametric Tests Petra Petrovics Hypothesis Testing Parametric Tests Mean of a population Population proportion Population Standard Deviation Nonparametric Tests Test for Independence Analysis of Variance

Részletesebben

Vállalatirányítási rendszerek

Vállalatirányítási rendszerek Vállalatirányítási rendszerek Varga Zsigmond Üzletfejlesztési igazgató Budapest, 2015. március 03. Nyilvános Motiváció? 2013 SAP AG. All rights reserved. 2 Adatrögzítés része a fejlődésnek 3 Mestermunkától

Részletesebben

Investment performance of the Hungarian Private and Voluntary Pension Funds (1999-2008)

Investment performance of the Hungarian Private and Voluntary Pension Funds (1999-2008) Investment performance of the Hungarian Private and Voluntary Pension Funds In compliance with its legal reporting obligation (pursuant to Paragraph 24 Section 2 of the Government Decree No. 281/2001 (XII.26.)

Részletesebben

USA Befektetési Útmutató

USA Befektetési Útmutató USA Befektetési Útmutató COPYRIGHT OPISAS. ALL RIGHTS RESERVED. DISCLAIMER. All prices on this list are subject to change without notice. Whilst we make every effort to provide you the most accurate, up-to-date

Részletesebben

Nagyvállalati Linux üzemeltetés Horváth Gábor Kálmán

Nagyvállalati Linux üzemeltetés Horváth Gábor Kálmán Nagyvállalati Linux üzemeltetés Horváth Gábor Kálmán vezető tanácsadó gabor.horvath@npsh.hu Szerverek életciklusa Szerver életciklus Telepít Beállít Tesztel Frissít Kivezet 3 Élesít Üzemel Problémák? Tömeges

Részletesebben

Operation of water supplies

Operation of water supplies Operation of water supplies Info Version 3 Url http://com.mercell.com/permalink/41670211.aspx External tender id 396958-2013 Tender type Tender Document type Additional information Procurement procedure

Részletesebben

SUSE Success Stories Varga Zsolt

SUSE Success Stories Varga Zsolt SUSE Success Stories Varga Zsolt operatív igazgató / Novell PSH Varga.zsolt@npsh.hu 2 Nagy forgalmú webes portál infrastruktúra kialakítása (közszféra) Megoldandó feladatok, nehézségek Igen nagy számú

Részletesebben

SQL/PSM kurzorok rész

SQL/PSM kurzorok rész SQL/PSM kurzorok --- 2.rész Tankönyv: Ullman-Widom: Adatbázisrendszerek Alapvetés Második, átdolgozott kiadás, Panem, 2009 9.3. Az SQL és a befogadó nyelv közötti felület (sormutatók) 9.4. SQL/PSM Sémában

Részletesebben

István Micsinai Csaba Molnár: Analysing Parliamentary Data in Hungarian

István Micsinai Csaba Molnár: Analysing Parliamentary Data in Hungarian István Micsinai Csaba Molnár: Analysing Parliamentary Data in Hungarian The Hungarian Comparative Agendas Project Participant of international Comparative Agendas Project Datasets on: Laws (1949-2014)

Részletesebben

Utolsó frissítés / Last update: február Szerkesztő / Editor: Csatlós Árpádné

Utolsó frissítés / Last update: február Szerkesztő / Editor: Csatlós Árpádné Utolsó frissítés / Last update: 2016. február Szerkesztő / Editor: Csatlós Árpádné TARTALOM / Contents BEVEZETŐ / Introduction... 2 FELNŐTT TAGBÉLYEGEK / Adult membership stamps... 3 IFJÚSÁGI TAGBÉLYEGEK

Részletesebben

A HUEDU OpenLab iskolai alkalmazáscsomag Kovács Lajos

A HUEDU OpenLab iskolai alkalmazáscsomag Kovács Lajos A HUEDU OpenLab iskolai alkalmazáscsomag Kovács Lajos Rendszermérnök kovacs.lajos@npsh.hu A HUEDU program háttere 2 2009: 3 éves megállapodás az NFM és a Novell között --» 2012: keretszerződés meghosszabbítása

Részletesebben

Deposits and Withdrawals policy Pénz befizetések és kifizetések szabályzata TeleTrade-DJ International Consulting Ltd

Deposits and Withdrawals policy Pénz befizetések és kifizetések szabályzata TeleTrade-DJ International Consulting Ltd Deposits and Withdrawals policy Pénz befizetések és kifizetések szabályzata TeleTrade-DJ International Consulting Ltd 2011-2015 TeleTrade-DJ International Consulting Ltd. 1 Bank Wire Transfers: When depositing

Részletesebben