ETSI ES V1.1.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 3: Call Notification (Parlay X 3)
|
|
- Lilla Török
- 5 évvel ezelőtt
- Látták:
Átírás
1 Standard Open Service Access (OSA); Parlay X Web Services; Part 3: Call Notification (Parlay X 3)
2 2 Reference DES/TISPAN OSA Keywords API, OSA, service 650 Route des Lucioles F Sophia Antipolis Cedex - FRANCE Tel.: Fax: Siret N NAF 742 C Association à but non lucratif enregistrée à la Sous-Préfecture de Grasse (06) N 7803/88 Important notice Individual copies of the present document can be downloaded from: The present document may be made available in more than one electronic version or in print. In any case of existing or perceived difference in contents between such versions, the reference version is the Portable Document Format (PDF). In case of dispute, the reference shall be the printing on printers of the PDF version kept on a specific network drive within Secretariat. Users of the present document should be aware that the document may be subject to revision or change of status. Information on the current status of this and other documents is available at If you find errors in the present document, please send your comment to one of the following services: Copyright Notification No part may be reproduced except as authorized by written permission. The copyright and the foregoing restriction extend to reproduction in all media. European Telecommunications Standards Institute The Parlay Group All rights reserved. DECT TM, PLUGTESTS TM, UMTS TM, TIPHON TM, the TIPHON logo and the logo are Trade Marks of registered for the benefit of its Members. 3GPP TM is a Trade Mark of registered for the benefit of its Members and of the 3GPP Organizational Partners.
3 3 Contents Intellectual Property Rights...5 Foreword Scope References Normative references Definitions and abbreviations Definitions Abbreviations Detailed service description Namespaces Sequence diagrams SMS notification of a missed call Media interaction Collection of digits from end user Notification of media interaction XML Schema data type definition ActionValues enumeration Action structure CallEvents enumeration Web Service interface definition Interface: CallDirection Operation: handlebusy Input message: handlebusyrequest Output message: handlebusyresponse Referenced faults Operation: handlenotreachable Input message: handlenotreachablerequest Output message: handlenotreachableresponse Referenced faults Operation: handlenoanswer Input message: handlenoanswerrequest Output message: handlenoanswerresponse Referenced faults Operation: handlecallednumber Input message: handlecallednumberrequest Output message: handlecallednumberresponse Referenced faults Interface: CallNotification Operation: notifybusy Input message: notifybusyrequest Output message: notifybusyresponse Referenced faults Operation: notifynotreachable Input message: notifynotreachablerequest Output message: notifynotreachableresponse Referenced faults Operation: notifynoanswer Input message: notifynoanswerrequest Output message: notifynoanswerresponse Referenced faults Operation: notifycallednumber Input message: notifycallednumberrequest...17
4 Output message: notifycallednumberresponse Referenced faults Operation: notifyanswer Input message: notifyanswerrequest Output message: notifyanswerresponse Referenced faults Operation: notifyplayandcollectevent Input message: notifyplayandcollecteventrequest Output message: notifyplayandcollecteventresponse Referenced faults Operation: notifyplayandrecordevent Input message: notifyplayandrecordeventrequest Output message: notifyplayandrecordeventresponse Referenced faults Interface: CallDirectionManager Operation: startcalldirectionnotification Input message: startcalldirectionnotificationrequest Output message: startcalldirectionnotificationresponse Referenced Faults Operation: stopcalldirectionnotification Input message: stopcalldirectionnotificationrequest Output message: stopcalldirectionnotificationresponse Referenced Faults Operation: startplayandcollectnotification Input message: startplayandcollectnotificationrequest Output message: startplayandcollectnotificationresponse Referenced Faults Operation: startplayandrecordnotification Input message: startplayandrecordnotificationrequest Output message: startplayandrecordnotificationresponse Referenced Faults Operation: stopmediainteractionnotification Input Message: stopmediainteractionnotificationrequest Output Message: stopmediainteractionnotificationresponse Referenced Faults Interface: CallNotificationManager Operation: StartCallNotification Input message: startcallnotificationrequest Output message: startcallnotificationresponse Referenced Faults Operation: stopcallnotification Input message: stopcallnotificationrequest Output message: stopcallnotificationresponse Referenced Faults Fault definitions Service policies...23 Annex A (normative): WSDL for Call Notification...24 Annex B (informative): Bibliography...25 History...26
5 5 Intellectual Property Rights IPRs essential or potentially essential to the present document may have been declared to. The information pertaining to these essential IPRs, if any, is publicly available for members and non-members, and can be found in SR : "Intellectual Property Rights (IPRs); Essential, or potentially Essential, IPRs notified to in respect of standards", which is available from the Secretariat. Latest updates are available on the Web server ( Pursuant to the IPR Policy, no investigation, including IPR searches, has been carried out by. No guarantee can be given as to the existence of other IPRs not referenced in SR (or the updates on the Web server) which are, or may be, or may become, essential to the present document. Foreword This Standard (ES) has been produced by Technical Committee Telecommunications and Internet converged Services and Protocols for Advanced Networking (TISPAN). The present document is part 3 of a multi-part deliverable covering Open Service Access (OSA); Parlay X Web Services, as identified below: Part 1: Part 2: Part 3: Part 4: Part 5: Part 6: Part 7: Part 8: Part 9: Part 10: Part 11: Part 12: Part 13: Part 14: Part 15: Part 16: Part 17: Part 18: Part 19: Part 20: "Common"; "Third Party Call"; "Call Notification"; "Short Messaging"; "Multimedia Messaging"; "Payment"; "Account Management"; "Terminal Status"; "Terminal Location"; "Call Handling"; "Audio Call"; "Multimedia Conference"; "Address List Management"; "Presence"; "Message Broadcast"; "Geocoding"; "Application-driven Quality of Service (QoS)"; "Device Capabilities and Configuration"; "Multimedia Streaming Control"; "Multimedia Multicast Session Management". The present document has been defined jointly between, The Parlay Group ( and the 3GPP. The present document forms part of the Parlay X 3.0 set of specifications.
6 6 The present document is equivalent to 3GPP TS V7.2.0 (Release 7).
7 7 1 Scope The present document is part 3 of the Stage 3 Parlay X 3 Web Services specification for Open Service Access (OSA). The OSA specifications define an architecture that enables application developers to make use of network functionality through an open standardized interface, i.e. the OSA APIs. The present document specifies the Call Notification Web Service. The following are defined here: Name spaces. Sequence diagrams. Data definitions. Interface specification plus detailed method descriptions. Fault definitions. Service Policies. WSDL Description of the interfaces. 2 References References are either specific (identified by date of publication and/or edition number or version number) or non-specific. For a specific reference, subsequent revisions do not apply. Non-specific reference may be made only to a complete document or a part thereof and only in the following cases: - if it is accepted that it will be possible to use all future changes of the referenced document for the purposes of the referring document; - for informative references. Referenced documents which are not found to be publicly available in the expected location might be found at For online referenced documents, information sufficient to identify and locate the source shall be provided. Preferably, the primary source of the referenced document should be cited, in order to ensure traceability. Furthermore, the reference should, as far as possible, remain valid for the expected life of the document. The reference shall include the method of access to the referenced document and the full network address, with the same punctuation and use of upper case and lower case letters. NOTE: While any hyperlinks included in this clause were valid at the time of publication cannot guarantee their long term validity. 2.1 Normative references The following referenced documents are indispensable for the application of the present document. For dated references, only the edition cited applies. For non-specific references, the latest edition of the referenced document (including any amendments) applies. [1] W3C Recommendation (2 May 2001): "XML Schema Part 2: Datatypes". NOTE: Available at:
8 8 [2] ES : "Open Service Access (OSA); Parlay X Web Services; Part 1: Common (Parlay X 3)". 3 Definitions and abbreviations 3.1 Definitions For the purposes of the present document, the terms and definitions given in ES [2] apply. 3.2 Abbreviations For the purposes of the present document, the abbreviations given in ES [2] apply. 4 Detailed service description Currently, in order to determine the handling of a subscriber initiated call in telecommunication networks we have to write applications using specific protocols to access Call Control functions provided by network elements. This approach requires a high degree of network expertise. We can also use the OSA gateway approach, invoking standard interfaces to gain access to call control capabilities, but these interfaces are usually perceived to be quite complex by application IT developers. Developers must have advanced telecommunication skills to use Call Control OSA interfaces. In this clause we will describe a Parlay X Web Service, Call Notification, for handling calls initiated by a subscriber in the network. A (third party) application determines how the call should be treated. The overall scope of this Web Service is to provide simple functions to application developers to determine how a call should be treated. It is possible to request to end the call, continue the call or re-route the call. Optionally, it is also possible to request the media type(s) when the action is to re-route the call. It provides, for example, the capability to route a call to an IVR in order to play a video stream to the calling subscriber. A service policy determines if multimedia application control is supported. The media types used in the call can be retrieved using the getmediaforparticipant or getmediaforcall operations of the Audio Call web service. Using the Web Services, application developers can perform simple handling of network-initiated calls without specific Telco knowledge. Examples of usage include the following: Incoming call handling: A subscriber receives a call while he is logged-on to the Internet. Since this occupies his telephone connection, he is regarded as busy by the network. The subscriber has an application that is invoked when somebody tries to call him while he is busy. The application provides the subscriber with a list of choices on how to handle the call (e.g. route the call to voic or other media server, redirect the call to a secretary, reject the call). Based on the response of the subscriber the call is handled in the network. Alternatively, the call is re-routed or released depending on the preferences of the subscriber and some context information (e.g. based on the status or location of the subscriber). Service numbers: An application is triggered whenever a certain service number is dialled. This number is used to connect the caller to one of the maintenance personnel. The application redirects the call to the appropriate maintenance person based on, e.g. calling party number, time, location and availability of the maintenance personnel. SMS notification of missed calls: An application offers the subscriber the possibility to be notified via SMS whenever he misses a call. The application registers to be notified when calls to its subscribers encounter busy, no-answer or not-reachable. The application does not influence the call treatment, but sends an SMS containing the calling party number, the time and reason why the call was missed.
9 9 MediaInteraction: An application is provided information regarding the start of a media stream to an end user, the termination of a media stream that the end user is watching, and other media events, e.g. the end-user pausing playback of a media stream. For example, starting to stream a video to an end user, the end user pausing the ongoing video stream and the ending of the video stream. 5 Namespaces The CallDirection interface uses the namespace: The CallDirectionNotificationManager interface uses the namespace: The CallNotification interface uses the namespace: The CallNotificationManager interface uses the namespace: The data types are defined in the namespace: The "xsd" namespace is used in the present document to refer to the XML Schema data types defined in XML Schema [1]. The use of the name "xsd" is not semantically significant. 6 Sequence diagrams 6.1 SMS notification of a missed call Showing the use of the CallNotification and Short Messaging Web Services, an SMS is sent to a person who misses a call (no answer). This sequence assumes that the provisioning of the "no answer" call notification has occurred independently.
10 10 Application Call Notification Web Service notifynoanswerrequest A does not answer event report (call monitor mode) notifynoanswerresponse sendsmsrequest Short Messaging Web Service (ref. Part 4) sendsmsresponse Sends an SMS missed call notification to A Figure Media interaction Collection of digits from end user The application requests the CallNotificationManager to start the process of receiving media notifications. In this example the application requests to receive notifications for the playing of a file and the network collecting digits from the end user. Requesting Application CallNotificationManager API Digit Collection Resource StartPlayAndCollectNotification collectinformation( digits ) Figure 2
11 Notification of media interaction In this example the application is being notified of the collection of a digit string that was collected by a digit collection resource. Requesting Application CallNotification API # Digit Collection Resource NotifyPlayAndCollectEvent Figure 3 7 XML Schema data type definition 7.1 ActionValues enumeration The ActionValues data type is an enumeration with the following values. Enumeration value Route Continue EndCall Description Request to (re-)route the call to the address indicated with routingaddress. Request to continue the call without any changes. This will result in normal handling of the event in the network. Request to end the call. This will result in termination of the call. The callingparty will receive a tone or announcement. 7.2 Action structure The Action data type is a structure containing the following parameters. Element name Element type Optional Description actiontoperform ActionValues No Indicates the action as described above routingaddress xsd:anyuri Yes The address to be used in case the action indicates "Route" charging common:charging Yes Charge to apply to this call session mediainfo Information common:mediainfo [0..unbounded] Yes Indicates the desired media type(s) for the case where actiontoperform=route. It identifies one or more media type(s) for the call, i.e. the media type(s) to be applied to the participants in the call session. For each media type the media direction - incoming, outgoing, or bidirectional - shall be indicated. An empty array shall have the same meaning as if the parameter is omitted: i.e. the media type(s) shall be negotiated by the underlying network.
12 CallEvents enumeration The CallEvents data type is an enumeration with the following values. Enumeration value Busy NotReachable NoAnswer CalledNumber Answer Description Called party is busy. Called party is not reachable. Called party does not answer. A call session between two parties, a calling participant and a called participant (called number), is being attempted. Called participant has confirmed (answered) the call. 8 Web Service interface definition 8.1 Interface: CallDirection This clause describes an initial set of capabilities in terms of message invocations, parameters and data types. The message-based invocations are: handlebusy. handlenotreachable. handlenoanswer. handlecallednumber. These messages are initiated by the Call Notification Web Service (running in a Parlay X Gateway) and invoke an application Web Service(s), as a result of activity in the network. The result of the invocation of a handle<event> operation is used as an indication on how the call should be handled in the network. The application can only indicate the call handling required prior to the call being established, and cannot keep control over the call after handling the event; every event handling is a separate occurrence. Note that because the results of the invocations of the application Web Service(s) determine call handling in the network, the names of the methods are prefixed with "handle", rather than "notify". The prefix "notify" would imply a more asynchronous behaviour, whereas "handle" shows the synchronous nature of these invocations Operation: handlebusy The invocation of handlebusy requests the application to inform the gateway how to handle the call between two addresses, the callingparticipant and the calledparticipanty, where the calledparticipant is busy when the call is received. Optionally, the caller's name is provided. The application returns the action, which directs the gateway to perform one of the following actions: "Continue", resulting in normal handling of the busy event in the network, e.g. playing of a busy tone to the callingparticipant. "EndCall", resulting in the call being terminated; the exact tone or announcement that will be played to the callingparticipant is operator-specific. "Route", resulting in the call being re-routed to a calledparticipant specified by the application. Optionally, in the action parameter, the application can also indicate the charging information.
13 Input message: handlebusyrequest correlator xsd:string No Correlator provided in the request to set up this notification. A unique identifier for the application Web Service which has requested this notification. See also the startcalldirectionnotification operation. callingparticipant xsd:anyuri No It contains the address of the caller callingparticipant Name xsd:string Yes It contains the name of the caller calledparticipant xsd:anyuri No It contains the address of the called participant. This participant is busy callsession Identifier xsd:string Yes Identifies the call session. If provided, it allows applications to avail of additional Parlay X web service features and capabilities that rely upon a callsessionidentifier Output message: handlebusyresponse result Action No It indicates the action to be performed by the gateway Referenced faults Operation: handlenotreachable The invocation of handlenotreachable requests the application to inform the gateway how to handle the call between two addresses, the callingparticipant and the calledparticipant, where the calledparticipant is not reachable when the call is received. Optionally, the caller's name is provided. The application returns the action, which directs the gateway to perform one of the following actions: "Continue", resulting in normal handling of the "not reachable" event in the network, e.g. playing of a busy tone to the callingparticipant. "EndCall", resulting in the call being terminated; the exact tone or announcement that will be played to the callingparticipant is operator-specific. "Route", resulting in the call being re-routed to a calledparticipant specified by the application. Optionally, in the action parameter, the application can also indicate the charging information Input message: handlenotreachablerequest correlator xsd:string No Correlator provided in the request to set up this notification. A unique identifier for the application Web Service which has requested this notification. See also the startcalldirectionnotification operation. callingparticipant xsd:anyuri No It contains the address of the caller callingparticipant xsd:string Yes It contains the name of the caller Name calledparticipant xsd:anyuri No It contains the address of the called participant. This participant is not callsession Identifier reachable xsd:string Yes Identifies the call session. If provided, it allows applications to avail of additional Parlay X web service features and capabilities that rely upon a callsessionidentifier Output message: handlenotreachableresponse result Action No It indicates the action to be performed by the gateway
14 Referenced faults Operation: handlenoanswer The invocation of handlenoanswer requests the application to inform the gateway how to handle the call between two addresses, the callingparticipant and the calledparticipant, where the calledparticipant does not answer the received call. Optionally, the caller's name is provided. The application returns the action, which directs the gateway to perform one of the following actions: "Continue", resulting in normal handling of the "no answer" event in the network, e.g. playing of a busy tone to the callingparticipant. "EndCall", resulting in the call being terminated; the exact tone or announcement that will be played to the callingparticipant is operator-specific. "Route", resulting in the call being re-routed to a calledparticipant specified by the application. Optionally, in the action parameter, the application can also indicate the charging information Input message: handlenoanswerrequest correlator xsd:string No Correlator provided in the request to set up this notification. A unique identifier for the application Web Service which has requested this notification. See also the startcalldirectionnotification operation. callingparticipant xsd:anyuri No It contains the address of the caller callingparticipantn xsd:string Yes It contains the name of the caller ame calledparticipant xsd:anyuri No It contains the address of the called participant. This participant does not callsession Identifier answer the call xsd:string Yes Identifies the call session. If provided, it allows applications to avail of additional Parlay X web service features and capabilities that rely upon a callsessionidentifier Output message: handlenoanswerresponse result Action No It indicates the action to be performed by the gateway Referenced faults Operation: handlecallednumber The invocation of handlecallednumber requests the application to inform the gateway how to handle the call between two addresses, the callingparticipant and the calledparticipant. The method is invoked when the callingparticipant tries to call the calledparticipant, but before the network routes the call to the calledparticipant. For example, the calledparticipant does not have to refer to a real end user, i.e. it could be a service number. Optionally, the caller's name is provided. The application returns the action, which directs the gateway to perform one of the following actions: "Continue", resulting in normal handling in the network, i.e. the call will be routed to the calledparticipant number, as originally dialled. "EndCall", resulting in the call being terminated; the exact tone or announcement that will be played to the callingparticipant is operator-specific. "Route", resulting in the call being re-routed to a calledparticipant specified by the application.
15 15 Optionally, in the action parameter, the application can also indicate the charging information Input message: handlecallednumberrequest correlator xsd:string No Correlator provided in the request to set up this notification. A unique identifier for the application Web Service which has requested this notification. See also the startcalldirectionnotification operation. callingparticipant xsd:anyuri No It contains the address of the caller callingparticipant Name xsd:string Yes It contains the name of the caller calledparticipant xsd:anyuri No It contains the address of the called participant callsession Identifier xsd:string Yes Identifies the call session. If provided, it allows applications to avail of additional Parlay X web service features and capabilities that rely upon a callsessionidentifier Output message: handlecallednumberresponse result Action No It indicates the action to be performed by the gateway Referenced faults. 8.2 Interface: CallNotification When call events occur in the network, the application may be notified of these events. The application does not have the ability to influence the call, as call processing continues. Notifications are provided for call attempt, busy, not reachable, answer and no answer events Operation: notifybusy A busy notification informs the application that a call between two parties was attempted, but the called participant was busy Input message: notifybusyrequest correlator xsd:string No Correlator provided in the request to set up this notification. A unique identifier for the application Web Service which has requested this notification. See also the startcallnotification operation. callingparticipant xsd:anyuri No It contains the address of the caller callingparticipantn ame xsd:string Yes It contains the name of the caller calledparticipant xsd:anyuri No It contains the address of the called participant. This participant is busy callsession Identifier xsd:string Yes Identifies the call session. If provided, it allows applications to avail of additional Parlay X web service features and capabilities that rely upon a callsessionidentifier Output message: notifybusyresponse
16 Referenced faults Operation: notifynotreachable A not reachable notification informs the application that a call between two parties was attempted, but the called participant was not reachable Input message: notifynotreachablerequest correlator xsd:string No Correlator provided in the request to set up this notification. A unique identifier for the application Web Service which has requested this notification. See also the startcallnotification operation. callingparticipant xsd:anyuri No It contains the address of the caller callingparticipantn xsd:string Yes It contains the name of the caller ame calledparticipant xsd:anyuri No It contains the address of the called participant. This participant is not callsession Identifier reachable xsd:string Yes Identifies the call session. If provided, it allows applications to avail of additional Parlay X web service features and capabilities that rely upon a callsessionidentifier Output message: notifynotreachableresponse Referenced faults Operation: notifynoanswer A no answer notification informs the application that a call between two parties was attempted, but the called participant did not answer Input message: notifynoanswerrequest correlator xsd:string No Correlator provided in the request to set up this notification. A unique identifier for the application Web Service which has requested this notification. See also the startcallnotification operation. callingparticipant xsd:anyuri No It contains the address of the caller callingparticipantn xsd:string Yes It contains the name of the caller ame calledparticipant xsd:anyuri No It contains the address of the called participant. This participant did not callsession Identifier answer xsd:string Yes Identifies the call session. If provided, it allows applications to avail of additional Parlay X web service features and capabilities that rely upon a callsessionidentifier Output message: notifynoanswerresponse
17 Referenced faults Operation: notifycallednumber A called number notification informs the application that a call between two parties is being attempted Input message: notifycallednumberrequest correlator xsd:string No Correlator provided in the request to set up this notification. A unique identifier for the application Web Service which has requested this notification. See also the startcallnotification operation. callingparticipant xsd:anyuri No It contains the address of the caller callingparticipantn ame xsd:string Yes It contains the name of the caller calledparticipant xsd:anyuri No It contains the address of the called participant callsession Identifier xsd:string Yes Identifies the call session. If provided, it allows applications to avail of additional Parlay X web service features and capabilities that rely upon a callsessionidentifier Output message: notifycallednumberresponse Referenced faults Operation: notifyanswer An answer notification informs the application that a call between two parties is in progress Input message: notifyanswerrequest correlator xsd:string No Correlator provided in the request to set up this notification. A unique identifier for the application Web Service which has requested this notification. See also the startcallnotification operation. callingparticipant xsd:anyuri No It contains the address of the caller callingparticipantn ame xsd:string Yes It contains the name of the caller calledparticipant xsd:anyuri No It contains the address of the called participant callsession Identifier xsd:string Yes Identifies the call session. If provided, it allows applications to avail of additional Parlay X web service features and capabilities that rely upon a callsessionidentifier Output message: notifyanswerresponse Referenced faults.
18 Operation: notifyplayandcollectevent This operation shall be sent to the application to provide the result of a media interaction (play and collect). The correlator part shall match the information provided by the application in the reference part of the startplayandcollectnotificationrequest message and shall allow the application to correlate the event with the event registration. The callparticipant part identifies the source of the collected digits. The mediainteraction part shall contain the result of the media interaction, including the digits collected Input message: notifyplayandcollecteventrequest correlator xsd:string No The correlator that is associated with the notification registration callparticipant xsd:anyuri No The call participant who has generated the media interaction Event mediainteraction xsd:string No The result of the media interaction Output message: notifyplayandcollecteventresponse Referenced faults Operation: notifyplayandrecordevent The application shall invoke this operation in order to provide the result of a media interaction (play and record information). The correlator part shall match the information provided by the application in the reference part of the startplayandcollectnotificationrequest message. The callparticipant part identifies the end user from whom the digits are collected. The mediainteraction part shall contain the result of the media interaction, including the location of the recorded information Input message: notifyplayandrecordeventrequest correlator xsd:string No The correlator that is associated with the notification registration callparticipant xsd:anyuri No The call participant who has generated the media interaction event mediainteraction xsd:string No The result of the media interaction Output message: notifyplayandrecordeventresponse Referenced faults. 8.3 Interface: CallDirectionManager The call direction manager enables applications to set up and tear down notifications for calls online.
19 Operation: startcalldirectionnotification This operation initiates notifications to the application for the specified called party addresses, which are Address Data items as defined in ES [2]. The correlator provided in the reference must be unique for the application Web Service at the time the notification is initiated, otherwise a fault (SVC0005) will be returned to the application. The criteria specifies the event-specific criteria used by application to define the call event(s) required. Only events that meet this criteria are notified. If the criteria parameter is not present, all supported call events for the CallDirectionManager interface (i.e. all except Answer) will be notified Input message: startcalldirectionnotificationrequest reference common:simplereference No Notification endpoint definition addresses xsd:anyuri [1..unbounded] No Called party addresses for which to receive notifications criteria CallEvents [0..unbounded] Yes Call events, excluding the Answer event, for which a notification is required. If not specified, all call events (except Answer) are notified Output message: startcalldirectionnotificationresponse Referenced Faults ServiceException from ES [2]: SVC Service error SVC Invalid input value SVC Duplicate correlator PolicyException from ES [2]: POL Policy error Operation: stopcalldirectionnotification The application may end a call direction notification using this operation Input message: stopcalldirectionnotificationrequest correlator xsd:string No Correlator of request to end Output message: stopcalldirectionnotificationresponse
20 Referenced Faults ServiceException from ES [2]: SVC Service error SVC Invalid input value PolicyException from ES [2]: POL Policy error Operation: startplayandcollectnotification The application shall invoke this operation in order to request notifications resulting from media interaction (i.e. the startplayandcollectinteraction operation in the Audio Call web service) associated with an existing call session. In the request message, the application shall specify the call session (callsessionidentifier) and the endpoint (reference) for receiving the notifications Input message: startplayandcollectnotificationrequest reference common:simplereference No Notification endpoint definition callsessionidentifier xsd:string No Identifies the existing call session Output message: startplayandcollectnotificationresponse Referenced Faults ServiceException from ES [2]: SVC Service error SVC Invalid input value SVC Duplicate correlator SVC Overlapping Criteria PolicyException from ES [2]: POL Policy error Operation: startplayandrecordnotification The application shall invoke this operation in order to request notifications resulting from media interaction (i.e. the startplayandrecordinteraction operation in the Audio Call web service) associated with an existing call session. In the request message, the application shall specify the call session (callsessionidentifier) and the endpoint (reference) for receiving the notifications Input message: startplayandrecordnotificationrequest reference common:simplereference No Notification endpoint definition callsessionidentifier xsd:string No Identifies the existing call session.
21 Output message: startplayandrecordnotificationresponse Referenced Faults ServiceException from ES [2]: SVC Service error SVC Invalid input value SVC Duplicate correlator SVC Overlapping Criteria PolicyException from ES [2]: POL Policy error Operation: stopmediainteractionnotification The application shall invoke this operation in order to stop receipt of media interaction notifications associated with an existing call session Input Message: stopmediainteractionnotificationrequest correlator xsd:string No Correlator of request to end Output Message: stopmediainteractionnotificationresponse Referenced Faults ServiceException from ES [2]: SVC Service error SVC Invalid input value PolicyException from ES [2]: POL Policy error 8.4 Interface: CallNotificationManager The call notification manager enables applications to set up and tear down notifications for calls online Operation: StartCallNotification This operation initiates notifications to the application for the specified called party addresses, which are Address Data items as defined in ES [2].
22 22 The correlator provided in the reference must be unique for the application Web Service at the time the notification is initiated, otherwise a fault (SVC0005) will be returned to the application. The criteria specifies the event-specific criteria used by application to define the call event(s) required. Only events that meet this criteria are notified. If the criteria parameter is not present, all call events will be notified Input message: startcallnotificationrequest reference common:simplereference No Notification endpoint definition addresses xsd:anyuri [1..unbounded] No Called party addresses for which to receive notifications criteria CallEvents [0..unbounded] Yes Call events, including Answer, for which a notification is required. If not specified, all call events are notified Output message: startcallnotificationresponse Referenced Faults ServiceException from ES [2]: SVC Service error SVC Invalid input value SVC Duplicate correlator PolicyException from ES [2]: POL Policy error Operation: stopcallnotification The application may end a call notification using this operation Input message: stopcallnotificationrequest correlator xsd:string No Correlator of request to end Output message: stopcallnotificationresponse Referenced Faults ServiceException from ES [2]: SVC Service error SVC Invalid input value
23 23 PolicyException from ES [2]: POL Policy error 9 Fault definitions No new faults are defined for this service. 10 Service policies The following service policies are defined for the Call Notification service. Name Type Description MultimediaSupported xsd:boolean Indicates whether multimedia is supported and whether an application can change the media types used in a call.
24 24 Annex A (normative): WSDL for Call Notification The document/literal WSDL representation of this interface specification is compliant to ES [2] and is contained in text files (contained in archive es_ v010101p0.zip) which accompany the present document.
25 25 Annex B (informative): Bibliography TR : "Digital cellular telecommunications system (Phase 2+); Universal Mobile Telecommunications System (UMTS); Vocabulary for 3GPP Specifications (3GPP TR )".
26 26 History Document history V1.1.1 February 2008 Membership Approval Procedure MV : to V1.1.1 May 2008 Publication
Final draft ETSI ES V1.1.1 ( )
Standard Open Service Access (OSA); Parlay X Web Services; Part 11: Audio Call 2 Reference DES/TISPAN-01007-11-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis Cedex - FRANCE
ETSI ES V1.3.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 11: Audio Call (Parlay X 2)
Standard Open Service Access (OSA); Parlay X Web Services; Part 11: Audio Call (Parlay X 2) 2 Reference RES/TISPAN-01056-11-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
ETSI ES V1.2.1 ( )
Standard Open Service Access (OSA); Parlay X Web Services; Part 2: Third Party Call (Parlay X 2) 2 Reference RES/TISPAN-01033-02-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
ETSI ES V1.2.1 ( )
Standard Open Service Access (OSA); Parlay X Web Services; Part 10: Call Handling (Parlay X 2) 2 Reference RES/TISPAN-01033-10-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
ETSI ES V1.1.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 8: Terminal Status (Parlay X 3)
Standard Open Service Access (OSA); Parlay X Web Services; Part 8: Terminal Status (Parlay X 3) 2 Reference DES/TISPAN-01034-8-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
ETSI ES V1.3.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 7: Account Management (Parlay X 2)
Standard Open Service Access (OSA); Parlay X Web Services; Part 7: Account Management (Parlay X 2) 2 Reference RES/TISPAN-01056-07-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
ETSI ES V1.1.1 ( )
Standard Open Service Access (OSA); Parlay X Web Services; Part 5: Multimedia Messaging 2 Reference DES/TISPAN-01007-05-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis Cedex
ETSI ES V1.1.1 ( )
Standard Open Service Access (OSA); Parlay X Web Services; Part 6: Payment 2 Reference DES/TISPAN-01007-06-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis Cedex - FRANCE
ETSI ES V1.2.1 ( )
Standard Open Service Access (OSA); Parlay X Web Services; Part 5: Multimedia Messaging (Parlay X 2) 2 Reference RES/TISPAN-01033-05-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia
ETSI ES V1.1.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 16: Geocoding (Parlay X 3)
Standard Open Service Access (OSA); Parlay X Web Services; Part 16: Geocoding (Parlay X 3) 2 Reference DES/TISPAN-01034-16-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
ETSI ES V1.3.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 5: Multimedia Messaging (Parlay X 2)
Standard Open Service Access (OSA); Parlay X Web Services; Part 5: Multimedia Messaging (Parlay X 2) 2 Reference RES/TISPAN-01056-05-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia
ETSI ES V1.3.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 13: Address List Management (Parlay X 2)
Standard Open Service Access (OSA); Parlay X Web Services; Part 13: Address List Management (Parlay X 2) 2 Reference RES/TISPAN-01056-13-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia
ETSI ES V1.2.1 ( )
Standard Open Service Access (OSA); Parlay X Web Services; Part 6: Payment (Parlay X 2) 2 Reference RES/TISPAN-01033-06-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis Cedex
ETSI ES V1.1.1 ( )
Standard Open Service Access (OSA); Parlay X Web Services; Part 13: Address List Management 2 Reference DES/TISPAN-01007-13-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
ETSI ES V1.1.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 4: Short Messaging (Parlay X 3)
Standard Open Service Access (OSA); Parlay X Web Services; Part 4: Short Messaging (Parlay X 3) 2 Reference DES/TISPAN-01034-4-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
ETSI ES V1.1.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 15: Message Broadcast (Parlay X 3)
Standard Open Service Access (OSA); Parlay X Web Services; Part 15: Message Broadcast (Parlay X 3) 2 Reference DES/TISPAN-01034-15-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis
ETSI ES V1.3.1 ( ) ETSI Standard. Open Service Access (OSA); Parlay X Web Services; Part 1: Common (Parlay X 2)
Standard Open Service Access (OSA); Parlay X Web Services; Part 1: Common (Parlay X 2) 2 Reference RES/TISPAN-01056-01-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis Cedex
EN United in diversity EN A8-0206/419. Amendment
22.3.2019 A8-0206/419 419 Article 2 paragraph 4 point a point i (i) the identity of the road transport operator; (i) the identity of the road transport operator by means of its intra-community tax identification
ETSI ES V1.1.1 ( )
Standard Open Service Access (OSA); Parlay X Web Services; Part 1: Common 2 Reference DES/TISPAN-01007-01-OSA Keywords API, OSA, service 650 Route des Lucioles F-06921 Sophia Antipolis Cedex - FRANCE Tel.:
Using the CW-Net in a user defined IP network
Using the CW-Net in a user defined IP network Data transmission and device control through IP platform CW-Net Basically, CableWorld's CW-Net operates in the 10.123.13.xxx IP address range. User Defined
USER MANUAL Guest user
USER MANUAL Guest user 1 Welcome in Kutatótér (Researchroom) Top menu 1. Click on it and the left side menu will pop up 2. With the slider you can make left side menu visible 3. Font side: enlarging font
INFORMATION ON COMPLAINT HANDLING
PANASZKEZELÉSI TÁJÉKOZTATÓ Az ACN Communications Hungary Korlátolt Felelősségű Társaság (székhely: 1132 Budapest, Váci út 30, VI emelet; ACN ) az alábbiakban tájékoztatja előfizetőit az ACN által nyújtott
VoIP (Voice over IP)
VoIP (Voice over IP) Analog Telephone Adapter (ATA) Public Switched Telephone Network (PSTN) Private Branch exchang (PBX) Interactive Voice Response (IVR) Helyi hálózatok tervezése és üzemeltetése 1 Történelem
Könnyen bevezethető ITIL alapú megoldások a Novell ZENworks segítségével. Hargitai Zsolt Sales Support Manager Novell Hungary
Könnyen bevezethető ITIL alapú megoldások a Novell ZENworks segítségével Hargitai Zsolt Sales Support Manager Novell Hungary Napirend ITIL rövid áttekintés ITIL komponensek megvalósítása ZENworks segítségével
Proxer 7 Manager szoftver felhasználói leírás
Proxer 7 Manager szoftver felhasználói leírás A program az induláskor elkezdi keresni az eszközöket. Ha van olyan eszköz, amely virtuális billentyűzetként van beállítva, akkor azokat is kijelzi. Azokkal
Nemzetközi vállalat - a vállalati szoftvermegoldások egyik vezető szállítója
Nemzetközi vállalat - a vállalati szoftvermegoldások egyik vezető szállítója A Novell világszerte vezető szerepet tölt be a Linux-alapú és nyílt forráskódú vállalati operációs rendszerek, valamit a vegyes
Lexington Public Schools 146 Maple Street Lexington, Massachusetts 02420
146 Maple Street Lexington, Massachusetts 02420 Surplus Printing Equipment For Sale Key Dates/Times: Item Date Time Location Release of Bid 10/23/2014 11:00 a.m. http://lps.lexingtonma.org (under Quick
ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP
ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP CHILD S DATA / GYERMEK ADATAI PLEASE FILL IN THIS INFORMATION WITH DATA BASED ON OFFICIAL DOCUMENTS / KÉRJÜK, TÖLTSE KI A HIVATALOS DOKUMENTUMOKBAN SZEREPLŐ ADATOK
BKI13ATEX0030/1 EK-Típus Vizsgálati Tanúsítvány/ EC-Type Examination Certificate 1. kiegészítés / Amendment 1 MSZ EN 60079-31:2014
(1) EK-TípusVizsgálati Tanúsítvány (2) A potenciálisan robbanásveszélyes környezetben történő alkalmazásra szánt berendezések, védelmi rendszerek 94/9/EK Direktíva / Equipment or Protective Systems Intended
Széchenyi István Egyetem www.sze.hu/~herno
Oldal: 1/6 A feladat során megismerkedünk a C# és a LabVIEW összekapcsolásának egy lehetőségével, pontosabban nagyon egyszerű C#- ban írt kódból fordítunk DLL-t, amit meghívunk LabVIEW-ból. Az eljárás
(NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV
Kommunikációs rendszerek programozása (NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV (5. mérés) SIP telefonközpont készítése Trixbox-szal 1 Mérés helye: Széchenyi István Egyetem, L-1/7 laboratórium, 9026 Győr, Egyetem
Számlakezelés az ELO DocXtraktor modullal
ELOECMSzakmai Kongresszus2013 Számlakezelés az ELO DocXtraktor modullal Kovács Eszter Kovacs.eszter@pentatrade.hu Projekt bemutatása A Cég Cégcsoport Éves árbevétel 140 mrd FT > 5 500 dolgozó ( 1 000 fı
Cashback 2015 Deposit Promotion teljes szabályzat
Cashback 2015 Deposit Promotion teljes szabályzat 1. Definitions 1. Definíciók: a) Account Client s trading account or any other accounts and/or registers maintained for Számla Az ügyfél kereskedési számlája
PIACI HIRDETMÉNY / MARKET NOTICE
PIACI HIRDETMÉNY / MARKET NOTICE HUPX DAM Másnapi Aukció / HUPX DAM Day-Ahead Auction Iktatási szám / Notice #: Dátum / Of: 18/11/2014 HUPX-MN-DAM-2014-0023 Tárgy / Subject: Változások a HUPX másnapi piac
Teszt topológia E1/1 E1/0 SW1 E1/0 E1/0 SW3 SW2. Kuris Ferenc - [HUN] Cisco Blog -
VTP Teszt topológia E1/1 E1/0 SW1 E1/0 E1/0 SW2 SW3 2 Alap konfiguráció SW1-2-3 conf t interface e1/0 switchport trunk encapsulation dot1q switchport mode trunk vtp domain CCIE vtp mode transparent vtp
KOGGM614 JÁRMŰIPARI KUTATÁS ÉS FEJLESZTÉS FOLYAMATA
KOGGM614 JÁRMŰIPARI KUTATÁS ÉS FEJLESZTÉS FOLYAMATA System Design Wahl István 2019.03.26. BME FACULTY OF TRANSPORTATION ENGINEERING AND VEHICLE ENGINEERING Tartalomjegyzék Rövidítések A rendszer definiálása
Utasítások. Üzembe helyezés
HASZNÁLATI ÚTMUTATÓ Üzembe helyezés Utasítások Windows XP / Vista / Windows 7 / Windows 8 rendszerben történő telepítéshez 1 Töltse le az AORUS makróalkalmazás telepítőjét az AORUS hivatalos webhelyéről.
Cloud computing. Cloud computing. Dr. Bakonyi Péter.
Cloud computing Cloud computing Dr. Bakonyi Péter. 1/24/2011 1/24/2011 Cloud computing 2 Cloud definició A cloud vagy felhő egy platform vagy infrastruktúra Az alkalmazások és szolgáltatások végrehajtására
10. Gyakorlat: Alkalmazások publikálása Remote Desktop Szervízen keresztül
10. Gyakorlat: Alkalmazások publikálása Remote Desktop Szervízen keresztül 10.1. Jogosultságok és csoportok létrehozása 10.2. Az RDS szerver szerepkör telepítése a DC01-es szerverre 10.3. Az RDS01-es szerver
Új funkciók az RBP-ben 2015. október 1-től New functions in RBP from 1 October 2015. Tatár Balázs
Új funkciók az RBP-ben 2015. október 1-től New functions in RBP from 1 October 2015 Tatár Balázs Üzletfejlesztés vezető / Business Development Manager Rendszerhasználói Tájékoztató Nap, 2015. szeptember
PIACI HIRDETMÉNY / MARKET NOTICE
PIACI HIRDETMÉNY / MARKET NOTICE HUPX Fizikai Futures (PhF) / HUPX Physical Futures (PhF) Iktatási szám / Notice #: HUPX-MN-PhF-2015-0003 Dátum / Of: 20/04/2015 Tárgy / Subject: Hatályos díjszabás és kedvezmények
ELO Digital Office ERP integráció
ELO Digital Office ERP integráció Lázár Péter ECM Business Unit Manager peter.lazar@itelligence.hu Enterprise Content Management www.elo.com Miért kell ERP integráció? Hozzáféréseket szabályozni és auditálni
Cloud computing Dr. Bakonyi Péter.
Cloud computing Dr. Bakonyi Péter. 1/24/2011 Cloud computing 1/24/2011 Cloud computing 2 Cloud definició A cloud vagy felhő egy platform vagy infrastruktúra Az alkalmazások és szolgáltatások végrehajtására
székhely: 1133 Budapest, Tutaj u. 6/A Registered office: 1133 Budapest, Tutaj u. 6/A
Átvállalási megállapodás a gyártó visszavételi és begyűjtési kötelezettségeinek átvállalásáról Agreement on Transfer of Responsibility in respect of the manufacturer s obligations to take back and collect
STUDENT LOGBOOK. 1 week general practice course for the 6 th year medical students SEMMELWEIS EGYETEM. Name of the student:
STUDENT LOGBOOK 1 week general practice course for the 6 th year medical students Name of the student: Dates of the practice course: Name of the tutor: Address of the family practice: Tel: Please read
Correlation & Linear Regression in SPSS
Petra Petrovics Correlation & Linear Regression in SPSS 4 th seminar Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Correlation
Directors and Officers Liability Insurance Questionnaire Adatlap vezetõ tisztségviselõk és felügyelõbizottsági tagok felelõsségbiztosításához
Directors and Officers Liability Insurance Questionnaire Adatlap vezetõ tisztségviselõk és felügyelõbizottsági tagok felelõsségbiztosításához 1. Name, legal form and address of company Társaság neve, címe,
Személyes adatváltoztatási formanyomtatvány- Magyarország / Personal Data Change Form - Hungary
Személyes adatváltoztatási formanyomtatvány- Magyarország / Personal Data Change Form - Hungary KITÖLTÉSI ÚTMUTATÓ: A formanyomtatványon a munkavállaló a személyes adatainak módosítását kezdeményezheti.
PIACI HIRDETMÉNY / MARKET NOTICE
PIACI HIRDETMÉNY / MARKET NOTICE HUPX DAM Másnapi Aukció / HUPX DAM Day-Ahead Auction Iktatási szám / Notice #: HUPX-MN-DAM-2018-0010 Dátum / Of: 12/10/2018 Tárgy / Subject: Hatályos díjszabás és kedvezmények
PIACI HIRDETMÉNY / MARKET NOTICE
PIACI HIRDETMÉNY / MARKET NOTICE HUPX DAM Másnapi Aukció / HUPX DAM Day-Ahead Auction Iktatási szám / Notice #: HUPX-MN-DAM-2018-0001 Dátum / Of: 26/01/2018 Tárgy / Subject: Hatályos díjszabás és kedvezmények
Nagyvállalati Linux üzemeltetés Horváth Gábor Kálmán
Nagyvállalati Linux üzemeltetés Horváth Gábor Kálmán vezető tanácsadó gabor.horvath@npsh.hu Szerverek életciklusa Szerver életciklus Telepít Beállít Tesztel Frissít Kivezet 3 Élesít Üzemel Problémák? Tömeges
Mapping Sequencing Reads to a Reference Genome
Mapping Sequencing Reads to a Reference Genome High Throughput Sequencing RN Example applications: Sequencing a genome (DN) Sequencing a transcriptome and gene expression studies (RN) ChIP (chromatin immunoprecipitation)
EN United in diversity EN A8-0206/473. Amendment
21.3.2019 A8-0206/473 473 Recital 12 d (new) (12d) Since there is no sufficient link of a driver with a territory of a Member State of transit, transit operations should not be considered as posting situations.
ELOECMSzakmai Kongresszus2013
ELOECMSzakmai Kongresszus2013 Keynote Horváth Szilvia Ügyvezető s.horvath@elo.com Cégünk rövid bemutatása 1871 Louis Leitz megalapítja első vállalatát 1995 Az első elektronikus Leitz dokumentumkezelő (ELOoffice)
1. Gyakorlat: Telepítés: Windows Server 2008 R2 Enterprise, Core, Windows 7
1. Gyakorlat: Telepítés: Windows Server 2008 R2 Enterprise, Core, Windows 7 1.1. Új virtuális gép és Windows Server 2008 R2 Enterprise alap lemez létrehozása 1.2. A differenciális lemezek és a két új virtuális
Szakmai továbbképzési nap akadémiai oktatóknak. 2012. december 14. HISZK, Hódmezővásárhely / Webex
Szakmai továbbképzési nap akadémiai oktatóknak 2012. december 14. HISZK, Hódmezővásárhely / Webex 14.00-15.00 15.00-15.30 15.30-15.40 Mai program 1. Amit feltétlenül ismernünk kell: az irányítótábla közelebbről.
T/3402. számú. törvényjavaslat
MAGYARORSZÁG KORMÁNYA T/3402. számú törvényjavaslat a Magyarország Kormánya és a Koreai Köztársaság Kormánya között a vezetői engedélyek kölcsönös elismeréséről és cseréjéről szóló megállapodás kihirdetéséről
Intézményi IKI Gazdasági Nyelvi Vizsga
Intézményi IKI Gazdasági Nyelvi Vizsga Név:... Születési hely:... Születési dátum (év/hó/nap):... Nyelv: Angol Fok: Alapfok 1. Feladat: Olvasáskészséget mérő feladat 20 pont Olvassa el a szöveget és válaszoljon
Web Services. (webszolgáltatások): egy osztott alkalmazásfejlesztési plattform
(webszolgáltatások): egy osztott alkalmazásfejlesztési plattform Ficsor Lajos Általános Informatikai Tanszék Miskolci Egyetem A Web Service Web Service definíciója Számos definíció létezik. IBM [4] A Web
INTELLIGENT ENERGY EUROPE PROGRAMME BUILD UP SKILLS TRAINBUD. Quality label system
INTELLIGENT ENERGY EUROPE PROGRAMME BUILD UP SKILLS TRAINBUD WP4: Deliverable 4.5 Development of voluntary qualification system Quality label system 1 INTELLIGENT ENERGY EUROPE PROGRAMME BUILD UP SKILLS
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel Timea Farkas Click here if your download doesn"t start
A HUEDU OpenLab iskolai alkalmazáscsomag Kovács Lajos
A HUEDU OpenLab iskolai alkalmazáscsomag Kovács Lajos Rendszermérnök kovacs.lajos@npsh.hu A HUEDU program háttere 2 2009: 3 éves megállapodás az NFM és a Novell között --» 2012: keretszerződés meghosszabbítása
Személyes adatváltoztatási formanyomtatvány - Magyarország / Personal Data Change Form - Hungary
Személyes adatváltoztatási formanyomtatvány - Magyarország / Personal Data Change Form - Hungary Kitöltési útmutató: A formanyomtatványon a munkavállaló a személyes adatainak módosítását kezdeményezheti.
SIP. Jelzés a telefóniában. Session Initiation Protocol
SIP Jelzés a telefóniában Session Initiation Protocol 1 Telefon hívás létrehozása 2 Jelzés és hálózat terhelés 3 Jelzés sík és jelzés típusok 4 TDM - CAS Channel Associated Signaling 5 CCS - Signaling
SUSE Success Stories Varga Zsolt
SUSE Success Stories Varga Zsolt operatív igazgató / Novell PSH Varga.zsolt@npsh.hu 2 Nagy forgalmú webes portál infrastruktúra kialakítása (közszféra) Megoldandó feladatok, nehézségek Igen nagy számú
Üzleti élet Nyitás. Nagyon hivatalos, a címzettnek meghatározott rangja van, aminek szerepelnie kell
- Nyitás angol magyar Dear Mr. President, Tisztelt Elnök Úr! Nagyon hivatalos, a címzettnek meghatározott rangja van, aminek szerepelnie kell Dear Sir, Hivatalos, férfi címzett, ismeretlen név Dear Madam,
Üzleti élet Nyitás. Nagyon hivatalos, a címzettnek meghatározott rangja van, aminek szerepelnie kell
- Nyitás magyar angol Tisztelt Elnök Úr! Dear Mr. President, Nagyon hivatalos, a címzettnek meghatározott rangja van, aminek szerepelnie kell Tisztelt Uram! Hivatalos, férfi címzett, ismeretlen név Tisztelt
Nemzeti Adó- és Vámhivatal Központi Hivatala 1095 Budapest IX., Mester u Budapest Pf. 109 H-Magyarország
MOVEMENT CERTIFICATE EUR. 1 1. Exporter (Name, full address, country) No C 6779801 See notes overleaf before completing this form. 2. Certificate used in preferential trade between 3. Consignee (Name,
ACO burkolható fedlapok. ACO műszaki katalógus ACO Burkolható fedlapok UNIFACE PAVING SOLID
ACO burkolható fedlapok ACO burkolható fedlapok ACO műszaki katalógus ACO Burkolható fedlapok UNIFACE PAVING SOLID ACO gully Tartalom Általános információk 3 page ACO Uniface ACO UNIFACE burkolható fedlap
Megfelelés az új iratkezelési rendeletnek az ELOik modullal
Megfelelés az új iratkezelési rendeletnek az ELOik modullal Dezsényi Csaba csaba.dezsenyi@ovitas.hu Mindenki nyugodjon meg! Az meg fog felelni az új jogszabályoknak! 2 Mit jelent? Felülvizsgálat Szerelés
Megbízási szerződés (KP) Agency Agreement (TP) mely létrejött egyrészről a. concluded by and between
Megbízási szerződés (KP) Agency Agreement (TP) mely létrejött egyrészről a Cégnév: Székhely: Cégjegyzékszám:. Adószám: mint megbízó (továbbiakban: Megbízó) másrészről pedig a concluded by and between Company
IP/09/473. Brüsszel, 2009. március 25
IP/09/473 Brüsszel, 2009. március 25 A mobiltelefon-használat nő, míg a fogyasztói árak csökkennek: a Bizottság jelentése szerint az európai távközlési ágazat ellenáll a gazdasági lassulásnak 2008-ban
Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz
Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz Kvantumkapuk, áramkörök 2016. március 3. A kvantummechanika posztulátumai (1-2) 1. Állapotleírás Zárt fizikai rendszer aktuális állapota
Rotary District 1911 DISTRICT TÁMOGATÁS IGÉNYLŐ LAP District Grants Application Form
1 A Future Vision pilot célja a Future Vision Plan (Jövőkép terv) egyszerűsített támogatási modelljének tesztelése, és a Rotaristák részvételének növelése a segélyezési folyamatokban. A teszt során a districteknek
Adatbázis-kezelés ODBC driverrel
ADATBÁZIS-KEZELÉS ODBC DRIVERREL... 1 ODBC: OPEN DATABASE CONNECTIVITY (NYÍLT ADATBÁZIS KAPCSOLÁS)... 1 AZ ODBC FELÉPÍTÉSE... 2 ADATBÁZIS REGISZTRÁCIÓ... 2 PROJEKT LÉTREHOZÁSA... 3 A GENERÁLT PROJEKT FELÉPÍTÉSE...
On The Number Of Slim Semimodular Lattices
On The Number Of Slim Semimodular Lattices Gábor Czédli, Tamás Dékány, László Ozsvárt, Nóra Szakács, Balázs Udvari Bolyai Institute, University of Szeged Conference on Universal Algebra and Lattice Theory
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében. Dicse Jenő üzletfejlesztési igazgató
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében Dicse Jenő üzletfejlesztési igazgató How to apply modern e-learning to improve the training of firefighters Jenő Dicse Director of
2. Tavasz Kupa. Uszonyos és Búvárúszó Verseny Kiírása
2. Tavasz Kupa Uszonyos és Búvárúszó Verseny Kiírása 1,/ A verseny célja: Az uszonyos-, és búvárúszás népszerűsítése, versenyzők részére versenyzési lehetőség biztosítása. 2,/ A verseny rendezője: HÓD
Az egészségügyi munkaerő toborzása és megtartása Európában
Az egészségügyi munkaerő toborzása és megtartása Európában Vezetői összefoglaló Európai Egészségügyi Menedzsment Társaság. április Fogyasztó-, Egészség-, Élelmiszerügyi és Mezőgazdasági Végrehajtó Ügynökség
Ezt a levelet kaptad (alatta a tennivalók magyarul) March 30, 2012 VIA EMAIL. Dear Beneficiary:
Amennyiben részvényt vásároltál nagyobb tételben (5000 USD felett) a DubLi alapítványától, ezt a levelet kaptad emailben, melyre LEGKÉSŐBB 2012 április 30.ig kell elküldjed a választ, hogy megkapd a részvényeket.
Cut-Off Time for Payment Orders, Incoming Payments And Fulfilment Orders
Cut-Off Time for Payment Orders, Incoming Payments And Fulfilment Orders Effective from 1 st of January 2016 1 Cut-off times for the receipt of payment orders for same-day processing: On every business
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2008. május 26. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2008. május 26. 8:00 Az írásbeli vizsga időtartama: 180 perc Pótlapok száma Tisztázati Piszkozati OKTATÁSI
Create & validate a signature
IOTA TUTORIAL 7 Create & validate a signature v.0.0 KNBJDBIRYCUGVWMSKPVA9KOOGKKIRCBYHLMUTLGGAV9LIIPZSBGIENVBQ9NBQWXOXQSJRIRBHYJ9LCTJLISGGBRFRTTWD ABBYUVKPYFDJWTFLICYQQWQVDPCAKNVMSQERSYDPSSXPCZLVKWYKYZMREAEYZOSPWEJLHHFPYGSNSUYRZXANDNQTTLLZA
Eladni könnyedén? Oracle Sales Cloud. Horváth Tünde Principal Sales Consultant 2014. március 23.
Eladni könnyedén? Oracle Sales Cloud Horváth Tünde Principal Sales Consultant 2014. március 23. Oracle Confidential Internal/Restricted/Highly Restricted Safe Harbor Statement The following is intended
DANS és Narcis. Burmeister Erzsébet. HUNOR találkozó, Budapest 2013. március 13.
DANS és Narcis Burmeister Erzsébet HUNOR találkozó, Budapest 2013. március 13. DANS DANS (Data Archiving and Network Services) http://www.dans.knaw.nl Kutatási adatok archiválása a saját fejlesztésű EASY
Cluster Analysis. Potyó László
Cluster Analysis Potyó László What is Cluster Analysis? Cluster: a collection of data objects Similar to one another within the same cluster Dissimilar to the objects in other clusters Cluster analysis
USA Befektetési Útmutató
USA Befektetési Útmutató COPYRIGHT OPISAS. ALL RIGHTS RESERVED. DISCLAIMER. All prices on this list are subject to change without notice. Whilst we make every effort to provide you the most accurate, up-to-date
Affinium LED string lp w6300 P10
Affinium LED string lp w6300 P10 Termékcsalád leírás Komplett, egyszerűen felszerelhető, flexibilis vezetékre szerelt LED modulok Philips LED Power meghajtóval Ideális reklámvilágítás; nagyméretű betükhöz
Vállalatirányítási rendszerek
Vállalatirányítási rendszerek Varga Zsigmond Üzletfejlesztési igazgató Budapest, 2015. március 03. Nyilvános Motiváció? 2013 SAP AG. All rights reserved. 2 Adatrögzítés része a fejlődésnek 3 Mestermunkától
XV1100K(C)/XV1100SK(C)
Lg C18ahr XV1100K(C)/XV1100SK(C) All rights reserverd. Any reprinting or unauthorized use wihout the written permission of Lg C18ahr Corporation, is expressly prohibited. P/N LIT-11646-12-51 1.1. INTRODUCTION
Can/be able to. Using Can in Present, Past, and Future. A Can jelen, múlt és jövő idejű használata
Can/ Can is one of the most commonly used modal verbs in English. It be used to express ability or opportunity, to request or offer permission, and to show possibility or impossibility. A az egyik leggyakrabban
Sebastián Sáez Senior Trade Economist INTERNATIONAL TRADE DEPARTMENT WORLD BANK
Sebastián Sáez Senior Trade Economist INTERNATIONAL TRADE DEPARTMENT WORLD BANK Despite enormous challenges many developing countries are service exporters Besides traditional activities such as tourism;
Csatlakozás a BME eduroam hálózatához Setting up the BUTE eduroam network
Csatlakozás a BME eduroam hálózatához Setting up the BUTE eduroam network Table of Contents Windows 7... 2 Windows 8... 6 Windows Phone... 11 Android... 12 iphone... 14 Linux (Debian)... 20 Sebők Márton
9el[hW][e\L;BI IjWdZWhZi
9el[hW][e\L;BI IjWdZWhZi The content and activities in Alive 3 and Alive 4 have been prepared to allow students to achieve the Victorian Essential Learning Standards (VELS) for Level 6. The key elements
International Open TABLE TENNIS. Competition to the Memory of János Molnár RESULTS
International Open RESULTS SCHEDULE Thursday, 6 th February, 2014 Mini cadet single, age group No. 2. (born between 01.01.2002. and 31.12.2002.) and age group No. 3. (born after 01.01.2003.) 15.30 round
Az M2M szabványosítási helyzete
Az M2M szabványosítási helyzete Dr. Bartolits István Főosztályvezető Nemzeti Média- és Hírközlési Hatóság Technológia-elemző főosztály HTE Infokom 2014 Kecskemét, 2014. október 8-10. HTE Infokom 2014,
Tájékoztató a 2012. évi határon átnyúló pénzügyi fogyasztói jogviták rendezésével összefüggő és egyéb nemzetközi tevékenységről
Tájékoztató a 2012. évi határon átnyúló pénzügyi fogyasztói jogviták rendezésével összefüggő és egyéb nemzetközi tevékenységről Pénzügyi Békéltető Testület A Pénzügyi Szervezetek Állami Felügyelete mellett
4. Gyakorlat: Csoportházirend beállítások
4. Gyakorlat: Csoportházirend beállítások 4.1. A Default Domain Policy jelszóra vonatkozó beállításai 4.2. Parancsikon, mappa és hálózati meghajtó megjelenítése csoport házirend segítségével 4.3. Alkalmazások
Paysera VISA cards are secured with "3-D technology" which ensures safer payments with payment cards online.
Paysera VISA card Safe payments online Paysera VISA cards are secured with "3-D technology" which ensures safer payments with payment cards online. When purchasing at e-shops labelled with "Paysera VISA",
General information for the participants of the GTG Budapest, 2017 meeting
General information for the participants of the GTG Budapest, 2017 meeting Currency is Hungarian Forint (HUF). 1 EUR 310 HUF, 1000 HUF 3.20 EUR. Climate is continental, which means cold and dry in February