Texture Analysis. Selim Aksoy Department of Computer Engineering Bilkent University
|
|
- Edit Fodorné
- 6 évvel ezelőtt
- Látták:
Átírás
1 Texture Analysis Selim Aksoy Department of Computer Engineering Bilkent University
2 Texture An important approach to image description is to quantify its texture content. Texture gives us information about the spatial arrangement of the colors or intensities in an image. CS 484, Spring , Selim Aksoy 2
3 Texture Although no formal definition of texture exists, intuitively it can be defined as the uniformity, density, coarseness, roughness, regularity, intensity and directionality of discrete tonal features and their spatial relationships. Texture is commonly found in natural scenes, particularly in outdoor scenes containing both natural and man-made objects. CS 484, Spring , Selim Aksoy 3
4 Texture Bark Bark Fabric Fabric Fabric Flowers Flowers Flowers CS 484, Spring , Selim Aksoy 4
5 Texture Food Food Leaves Leaves Leaves Leaves Water Water CS 484, Spring , Selim Aksoy 5
6 Texture Whether an effect is a texture or not depends on the scale at which it is viewed. CS 484, Spring , Selim Aksoy 6
7 Texture The approaches for characterizing and measuring texture can be grouped as: structural approaches that use the idea that textures are made up of primitives appearing in a near-regular repetitive arrangement, statistical approaches that yield a quantitative measure of the arrangement of intensities. While the first approach is appealing and can work well for man-made, regular patterns, the second approach is more general and easier to compute and is used more often in practice. CS 484, Spring , Selim Aksoy 7
8 Structural approaches Structural approaches model texture as a set of primitive texels (texture elements) in a particular spatial relationship. A structural description of a texture includes a description of the texels and a specification of the spatial relationship. Of course, the texels must be identifiable and the relationship must be efficiently computable. CS 484, Spring , Selim Aksoy 8
9 Structural approaches Voronoi tessellation of texels by Tuceryan and Jain (PAMI 1990) Texels are extracted by thresholding. Spatial relationships are characterized by their Voronoi tessellation. Shape features of the Voronoi polygons are used to group the polygons into clusters that define uniformly texture regions. CS 484, Spring , Selim Aksoy 9
10 Structural approaches Computational model for periodic pattern perception based on frieze and wallpaper groups by Liu, Collins and Tsin (PAMI 2004) A frieze pattern is a 2D strip in the plane that is periodic along one dimension. A periodic pattern extended in two linearly independent directions to cover the 2D plane is known as a wallpaper pattern. CS 484, Spring , Selim Aksoy 10
11 Structural approaches CS 484, Spring , Selim Aksoy 11
12 Statistical approaches Usually, segmenting out the texels is difficult or impossible in real images. Instead, numeric quantities or statistics that describe a texture can be computed from the gray tones or colors themselves. This approach is less intuitive, but is computationally efficient and often works well. CS 484, Spring , Selim Aksoy 12
13 Statistical approaches Some statistical approaches for texture: Edge density and direction Co-occurrence matrices Local binary patterns Statistical moments Autocorrelation Markov random fields Autoregressive models Mathematical morphology Interest points Fourier power spectrum Gabor filters CS 484, Spring , Selim Aksoy 13
14 Edge density and direction Use an edge detector as the first step in texture analysis. The number of edge pixels in a fixed-size region tells us how busy that region is. The directions of the edges also help characterize the texture. CS 484, Spring , Selim Aksoy 14
15 Edge density and direction Edge-based texture measures: Edgeness per unit area F edgeness = { p gradient_magnitude(p) threshold } / N where N is the size of the unit area. Edge magnitude and direction histograms F magdir = ( H magnitude, H direction ) where these are the normalized histograms of gradient magnitudes and gradient directions, respectively. Two histograms can be compared by computing their L 1 distance. CS 484, Spring , Selim Aksoy 15
16 Co-occurrence matrices Co-occurrence, in general form, can be specified in a matrix of relative frequencies P(i, j; d, θ) with which two texture elements separated by distance d at orientation θ occur in the image, one with property i and the other with property j. In gray level co-occurrence, as a special case, texture elements are pixels and properties are gray levels. CS 484, Spring , Selim Aksoy 16
17 Co-occurrence matrices The spatial relationship can also be specified as a displacement vector (dr, dc) where dr is a displacement in rows and dc is a displacement in columns. For a particular displacement, the resulting square matrix can be normalized by dividing each entry by the number of elements used to compute that matrix. CS 484, Spring , Selim Aksoy 17
18 Co-occurrence matrices CS 484, Spring , Selim Aksoy 18
19 Co-occurrence matrices CS 484, Spring , Selim Aksoy 19
20 Co-occurrence matrices If a texture is coarse and the distance d used to compute the co-occurrence matrix is small compared to the sizes of the texture elements, pairs of pixels at separation d should usually have similar gray levels. This means that high values in the matrix P(i, j; d, θ) should be concentrated on or near its main diagonal. Conversely, for a fine texture, if d is comparable to the texture element size, then the gray levels of points separated by d should often be quite different, so that values in P(i, j; d, θ) should be spread out relatively uniformly. CS 484, Spring , Selim Aksoy 20
21 Co-occurrence matrices Similarly, if a texture is directional, i.e., coarser in one direction than another, the degree of spread of the values about the main diagonal in P(i, j; d, θ) should vary with the orientation θ. Thus texture directionality can be analyzed by comparing spread measures of P(i, j; d, θ) for various orientations. CS 484, Spring , Selim Aksoy 21
22 Co-occurrence matrices CS 484, Spring , Selim Aksoy 22
23 Co-occurrence matrices In order to use the information contained in cooccurrence matrices, Haralick et al. (SMC 1973) defined 14 statistical features that capture textural characteristics such as homogeneity, contrast, organized structure, and complexity. Zucker and Terzopoulos (CGIP 1980) suggested using a chi-square statistical test to select the values of d that have the most structure for a given class of images. CS 484, Spring , Selim Aksoy 23
24 Co-occurrence matrices CS 484, Spring , Selim Aksoy 24
25 Co-occurrence matrices Example building groups (first column), the contrast features for 0 and 67.5 degree orientations (second and third columns), and the chi-square features for 0 and 67.5 degree orientations (fourth and fifth columns). X-axes represent inter-pixel distances of 1 to 60. The features at a particular orientation exhibit a periodic structure as a function of distance if the neighborhood contains a regular arrangement of buildings along that direction. On the other hand, features are very similar for different orientations if there is no particular arrangement in the neighborhood. CS 484, Spring , Selim Aksoy 25
26 Local binary patterns For each pixel p, create an 8-bit number b 1 b 2 b 3 b 4 b 5 b 6 b 7 b 8, where b i = 0 if neighbor i has value less than or equal to p s value and 1 otherwise. Represent the texture in the image (or a region) by the histogram of these numbers CS 484, Spring , Selim Aksoy 26
27 Local binary patterns The fixed neighborhoods were later extended to multi-scale circularly symmetric neighbor sets. Texture primitives detected by the LBP: CS 484, Spring , Selim Aksoy 27
28 Autocorrelation The autocorrelation function of an image can be used to detect repetitive patterns of texture elements, and describe the fineness/coarseness of the texture. The autocorrelation function ρ(dr,dc) for displacement d=(dr,dc) is given by CS 484, Spring , Selim Aksoy 28
29 Autocorrelation Interpreting autocorrelation: Coarse texture function drops off slowly Fine texture function drops off rapidly Can drop differently for r and c Regular textures function will have peaks and valleys; peaks can repeat far away from [0,0] Random textures only peak at [0,0]; breadth of peak gives the size of the texture CS 484, Spring , Selim Aksoy 29
30 Fourier power spectrum The autocorrelation function is related to the power spectrum of the Fourier transform. The power spectrum contains texture information because prominent peaks in the spectrum give the principal direction of the texture patterns, location of the peaks gives the fundamental spatial period of the patterns. CS 484, Spring , Selim Aksoy 30
31 Fourier power spectrum The power spectrum, represented in polar coordinates, can be integrated over regions bounded by circular rings (for frequency content) and wedges (for orientation content). CS 484, Spring , Selim Aksoy 31
32 Fourier power spectrum CS 484, Spring , Selim Aksoy 32
33 Fourier power spectrum Example building groups (first column), Fourier spectrum of these images (second column), and the corresponding ring- and wedge-based features (third and fourth columns). X-axes represent the rings in the third column and the wedges in the fourth column plots. The peaks in the features correspond to the periodicity and directionality of the buildings, whereas no dominant peaks can be found when there is no regular building pattern. CS 484, Spring , Selim Aksoy 33
34 Gabor filters The Gabor representation has been shown to be optimal in the sense of minimizing the joint twodimensional uncertainty in space and frequency. These filters can be considered as orientation and scale tunable edge and line detectors. Fourier transform achieves localization in either spatial or frequency domain but the Gabor transform achieves simultaneous localization in both spatial and frequency domains. CS 484, Spring , Selim Aksoy 34
35 Gabor filters A 2D Gabor function g(x,y) and its Fourier transform G(u,v) can be written as where and. CS 484, Spring , Selim Aksoy 35
36 Gabor filters Let U l and U h denote the lower and upper center frequencies of interest, K be the number of orientations, and S be the number of scales, the filter parameters can be selected as where W = U h and m = 0, 1,, S-1. CS 484, Spring , Selim Aksoy 36
37 Gabor filters CS 484, Spring , Selim Aksoy 37
38 Gabor filters Filters at multiple scales and orientations. CS 484, Spring , Selim Aksoy 38
39 Gabor filters CS 484, Spring , Selim Aksoy 39
40 Gabor filters Gabor filter responses for an example image. CS 484, Spring , Selim Aksoy 40
41 Gabor filters Gabor filter responses for a satellite image. CS 484, Spring , Selim Aksoy 41
42 Gabor filters Gabor filter responses for a satellite image. CS 484, Spring , Selim Aksoy 42
43 Gabor filter responses for a satellite image. CS 484, Spring , Selim Aksoy 43
44 CS 484, Spring , Selim Aksoy 44
45 CS 484, Spring , Selim Aksoy 45
46 Gabor filters CS 484, Spring , Selim Aksoy 46
47 Texture synthesis Goal of texture analysis: compare textures and decide if they are similar. Goal of texture synthesis: construct large regions of texture from small example images. It is an important problem for rendering in computer graphics. Strategy: to think of a texture as a sample from some probability distribution and then to try and obtain other samples from that same distribution. CS 484, Spring , Selim Aksoy 47
48 Neighborhood window CS 484, Spring , Selim Aksoy 48
49 Varying window size Increasing window size CS 484, Spring , Selim Aksoy 49
50 Examples CS 484, Spring , Selim Aksoy 50
51 Examples CS 484, Spring , Selim Aksoy 51
52 Examples: political synthesis CS 484, Spring , Selim Aksoy 52
53 Examples: texture transfer + = + = CS 484, Spring , Selim Aksoy 53
54 Examples: combining images CS 484, Spring , Selim Aksoy 54
55 Examples: texture transfer CS 484, Spring , Selim Aksoy 55
56 Examples: image analogies CS 484, Spring , Selim Aksoy 56
57 Examples: image analogies CS 484, Spring , Selim Aksoy 57
Construction of a cube given with its centre and a sideline
Transformation of a plane of projection Construction of a cube given with its centre and a sideline Exercise. Given the center O and a sideline e of a cube, where e is a vertical line. Construct the projections
(c) 2004 F. Estrada & A. Jepson & D. Fleet Canny Edges Tutorial: Oct. 4, '03 Canny Edges Tutorial References: ffl imagetutorial.m ffl cannytutorial.m
Canny Edges Tutorial: Oct. 4, '03 Canny Edges Tutorial References: ffl imagetutorial.m ffl cannytutorial.m ffl ~jepson/pub/matlab/isetoolbox/tutorials ffl ~jepson/pub/matlab/utvistoolbox/tutorials ffl
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Nonparametric Tests
Nonparametric Tests Petra Petrovics Hypothesis Testing Parametric Tests Mean of a population Population proportion Population Standard Deviation Nonparametric Tests Test for Independence Analysis of Variance
Correlation & Linear Regression in SPSS
Petra Petrovics Correlation & Linear Regression in SPSS 4 th seminar Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Correlation
On The Number Of Slim Semimodular Lattices
On The Number Of Slim Semimodular Lattices Gábor Czédli, Tamás Dékány, László Ozsvárt, Nóra Szakács, Balázs Udvari Bolyai Institute, University of Szeged Conference on Universal Algebra and Lattice Theory
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Nonparametric Tests. Petra Petrovics.
Nonparametric Tests Petra Petrovics PhD Student Hypothesis Testing Parametric Tests Mean o a population Population proportion Population Standard Deviation Nonparametric Tests Test or Independence Analysis
Performance Modeling of Intelligent Car Parking Systems
Performance Modeling of Intelligent Car Parking Systems Károly Farkas Gábor Horváth András Mészáros Miklós Telek Technical University of Budapest, Hungary EPEW 2014, Florence, Italy Outline Intelligent
Cluster Analysis. Potyó László
Cluster Analysis Potyó László What is Cluster Analysis? Cluster: a collection of data objects Similar to one another within the same cluster Dissimilar to the objects in other clusters Cluster analysis
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Factor Analysis
Factor Analysis Factor analysis is a multiple statistical method, which analyzes the correlation relation between data, and it is for data reduction, dimension reduction and to explore the structure. Aim
Statistical Inference
Petra Petrovics Statistical Inference 1 st lecture Descriptive Statistics Inferential - it is concerned only with collecting and describing data Population - it is used when tentative conclusions about
Rezgésdiagnosztika. Diagnosztika 02 --- 1
Rezgésdiagnosztika Diagnosztika 02 --- 1 Diagnosztika 02 --- 2 A rezgéskép elemzésével kimutatható gépészeti problémák Minden gép, mely tartalmaz forgó részt (pl. motor, generátor, szivattyú, ventilátor,
Correlation & Linear Regression in SPSS
Correlation & Linear Regression in SPSS Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise 1 - Correlation File / Open
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Hypothesis Testing. Petra Petrovics.
Hypothesis Testing Petra Petrovics PhD Student Inference from the Sample to the Population Estimation Hypothesis Testing Estimation: how can we determine the value of an unknown parameter of a population
Választási modellek 3
Választási modellek 3 Prileszky István Doktori Iskola 2018 http://www.sze.hu/~prile Forrás: A Self Instructing Course in Mode Choice Modeling: Multinomial and Nested Logit Models Prepared For U.S. Department
Statistical Dependence
Statistical Dependence Petra Petrovics Statistical Dependence Deinition: Statistical dependence exists when the value o some variable is dependent upon or aected by the value o some other variable. Independent
Mapping Sequencing Reads to a Reference Genome
Mapping Sequencing Reads to a Reference Genome High Throughput Sequencing RN Example applications: Sequencing a genome (DN) Sequencing a transcriptome and gene expression studies (RN) ChIP (chromatin immunoprecipitation)
Computer Architecture
Computer Architecture Locality-aware programming 2016. április 27. Budapest Gábor Horváth associate professor BUTE Department of Telecommunications ghorvath@hit.bme.hu Számítógép Architektúrák Horváth
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Correlation & Linear. Petra Petrovics.
Correlation & Linear Regression in SPSS Petra Petrovics PhD Student Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise
THE CHARACTERISTICS OF SOUNDS ANALYSIS AND SYNTHESIS OF SOUNDS
THE CHARACTERISTICS OF SOUNDS ANALYSIS AND SYNTHESIS OF SOUNDS Study aid for learning of Communication Acoustics VIHIA 000 2017. szeptember 27., Budapest Fülöp Augusztinovicz professor BME Dept. of Networked
Supporting Information
Supporting Information Cell-free GFP simulations Cell-free simulations of degfp production were consistent with experimental measurements (Fig. S1). Dual emmission GFP was produced under a P70a promoter
FAMILY STRUCTURES THROUGH THE LIFE CYCLE
FAMILY STRUCTURES THROUGH THE LIFE CYCLE István Harcsa Judit Monostori A magyar társadalom 2012-ben: trendek és perspektívák EU összehasonlításban Budapest, 2012 november 22-23 Introduction Factors which
Klaszterezés, 2. rész
Klaszterezés, 2. rész Csima Judit BME, VIK, Számítástudományi és Információelméleti Tanszék 208. április 6. Csima Judit Klaszterezés, 2. rész / 29 Hierarchikus klaszterezés egymásba ágyazott klasztereket
Local fluctuations of critical Mandelbrot cascades. Konrad Kolesko
Local fluctuations of critical Mandelbrot cascades Konrad Kolesko joint with D. Buraczewski and P. Dyszewski Warwick, 18-22 May, 2015 Random measures µ µ 1 µ 2 For given random variables X 1, X 2 s.t.
Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz
Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz Kvantumkapuk, áramkörök 2016. március 3. A kvantummechanika posztulátumai (1-2) 1. Állapotleírás Zárt fizikai rendszer aktuális állapota
Supplementary materials to: Whole-mount single molecule FISH method for zebrafish embryo
Supplementary materials to: Whole-mount single molecule FISH method for zebrafish embryo Yuma Oka and Thomas N. Sato Supplementary Figure S1. Whole-mount smfish with and without the methanol pretreatment.
Ensemble Kalman Filters Part 1: The basics
Ensemble Kalman Filters Part 1: The basics Peter Jan van Leeuwen Data Assimilation Research Centre DARC University of Reading p.j.vanleeuwen@reading.ac.uk Model: 10 9 unknowns P[u(x1),u(x2),T(x3),.. Observations:
Szundikáló macska Sleeping kitty
Model: Peter Budai 999. Diagrams: Peter Budai 999.. Oda-visszahajtás átlósan. Fold and unfold diagonally. 2. Behajtunk középre. Fold to the center. 3. Oda-visszahajtások derékszögben. Fold and unfold at
Efficient symmetric key private authentication
Efficient symmetric key private authentication Cryptographic Protocols (EIT ICT MSc) Dr. Levente Buttyán Associate Professor BME Hálózati Rendszerek és Szolgáltatások Tanszék Lab of Cryptography and System
2. Local communities involved in landscape architecture in Óbuda
Év Tájépítésze pályázat - Wallner Krisztina 2. Közösségi tervezés Óbudán Óbuda jelmondata: Közösséget építünk, ennek megfelelően a formálódó helyi közösségeket bevonva fejlesztik a közterületeket. Békásmegyer-Ófaluban
Genome 373: Hidden Markov Models I. Doug Fowler
Genome 373: Hidden Markov Models I Doug Fowler Review From Gene Prediction I transcriptional start site G open reading frame transcriptional termination site promoter 5 untranslated region 3 untranslated
Utasítások. Üzembe helyezés
HASZNÁLATI ÚTMUTATÓ Üzembe helyezés Utasítások Windows XP / Vista / Windows 7 / Windows 8 rendszerben történő telepítéshez 1 Töltse le az AORUS makróalkalmazás telepítőjét az AORUS hivatalos webhelyéről.
Széchenyi István Egyetem www.sze.hu/~herno
Oldal: 1/6 A feladat során megismerkedünk a C# és a LabVIEW összekapcsolásának egy lehetőségével, pontosabban nagyon egyszerű C#- ban írt kódból fordítunk DLL-t, amit meghívunk LabVIEW-ból. Az eljárás
Dependency preservation
Adatbázis-kezelés. (4 előadás: Relácó felbontásai (dekomponálás)) 1 Getting lossless decomposition is necessary. But of course, we also want to keep dependencies, since losing a dependency means, that
Csima Judit április 9.
Osztályozókról még pár dolog Csima Judit BME, VIK, Számítástudományi és Információelméleti Tanszék 2018. április 9. Csima Judit Osztályozókról még pár dolog 1 / 19 SVM (support vector machine) ez is egy
Pletykaalapú gépi tanulás teljesen elosztott környezetben
Pletykaalapú gépi tanulás teljesen elosztott környezetben Hegedűs István Jelasity Márk témavezető Szegedi Tudományegyetem MTA-SZTE Mesterséges Intelligencia Kutatócsopot Motiváció Az adat adatközpontokban
Using the CW-Net in a user defined IP network
Using the CW-Net in a user defined IP network Data transmission and device control through IP platform CW-Net Basically, CableWorld's CW-Net operates in the 10.123.13.xxx IP address range. User Defined
Résbefúvó anemosztátok méréses vizsgálata érintõleges légvezetési rendszer alkalmazása esetén
Résbefúvó anemostátok méréses visgálata érintõleges légveetési rendser alkalmaása esetén Both Balás 1 Goda Róbert 2 Abstract The use of slot diffusers in tangential air supply systems is widespread not
Proxer 7 Manager szoftver felhasználói leírás
Proxer 7 Manager szoftver felhasználói leírás A program az induláskor elkezdi keresni az eszközöket. Ha van olyan eszköz, amely virtuális billentyűzetként van beállítva, akkor azokat is kijelzi. Azokkal
Szoftver-technológia II. Tervezési minták. Irodalom. Szoftver-technológia II.
Tervezési minták Irodalom Steven R. Schach: Object Oriented & Classical Software Engineering, McGRAW-HILL, 6th edition, 2005, chapter 8. E. Gamma, R. Helm, R. Johnson, J. Vlissides:Design patterns: Elements
16F628A megszakítás kezelése
16F628A megszakítás kezelése A 'megszakítás' azt jelenti, hogy a program normális, szekvenciális futása valamilyen külső hatás miatt átmenetileg felfüggesztődik, és a vezérlést egy külön rutin, a megszakításkezelő
Cashback 2015 Deposit Promotion teljes szabályzat
Cashback 2015 Deposit Promotion teljes szabályzat 1. Definitions 1. Definíciók: a) Account Client s trading account or any other accounts and/or registers maintained for Számla Az ügyfél kereskedési számlája
Can/be able to. Using Can in Present, Past, and Future. A Can jelen, múlt és jövő idejű használata
Can/ Can is one of the most commonly used modal verbs in English. It be used to express ability or opportunity, to request or offer permission, and to show possibility or impossibility. A az egyik leggyakrabban
INDEXSTRUKTÚRÁK III.
2MU05_Bitmap.pdf camü_ea INDEXSTRUKTÚRÁK III. Molina-Ullman-Widom: Adatbázisrendszerek megvalósítása Panem, 2001könyv 5.4. Bittérkép indexek fejezete alapján Oracle: Indexek a gyakorlatban Oracle Database
IES TM Evaluating Light Source Color Rendition
IES TM-30-15 Evaluating Light Source Color Rendition "Original" "CRI = 80" Desaturated "CRI = 80" Saturated More metrics Color Fidelity Color Discrimination Color Preference Metrics/Measures R f (IES TM-30-15)
STUDENT LOGBOOK. 1 week general practice course for the 6 th year medical students SEMMELWEIS EGYETEM. Name of the student:
STUDENT LOGBOOK 1 week general practice course for the 6 th year medical students Name of the student: Dates of the practice course: Name of the tutor: Address of the family practice: Tel: Please read
EN United in diversity EN A8-0206/419. Amendment
22.3.2019 A8-0206/419 419 Article 2 paragraph 4 point a point i (i) the identity of the road transport operator; (i) the identity of the road transport operator by means of its intra-community tax identification
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel Timea Farkas Click here if your download doesn"t start
A jövedelem alakulásának vizsgálata az észak-alföldi régióban az 1997-99. évi adatok alapján
A jövedelem alakulásának vizsgálata az észak-alföldi régióban az 1997-99. évi adatok alapján Rózsa Attila Debreceni Egyetem Agrártudományi Centrum, Agrárgazdasági és Vidékfejlesztési Intézet, Számviteli
Word and Polygon List for Obtuse Triangular Billiards II
Word and Polygon List for Obtuse Triangular Billiards II Richard Evan Schwartz August 19, 2008 Abstract This is the list of words and polygons we use for our paper. 1 Notation To compress our notation
First experiences with Gd fuel assemblies in. Tamás Parkó, Botond Beliczai AER Symposium 2009.09.21 25.
First experiences with Gd fuel assemblies in the Paks NPP Tams Parkó, Botond Beliczai AER Symposium 2009.09.21 25. Introduction From 2006 we increased the heat power of our units by 8% For reaching this
PETER PAZMANY CATHOLIC UNIVERSITY Consortium members SEMMELWEIS UNIVERSITY, DIALOG CAMPUS PUBLISHER
SEMMELWEIS UNIVERSITY PETER PAMANY CATLIC UNIVERSITY Development of Complex Curricula for Molecular Bionics and Infobionics Programs within a consortial* framework** Consortium leader PETER PAMANY CATLIC
FÖLDRAJZ ANGOL NYELVEN
Földrajz angol nyelven középszint 0821 ÉRETTSÉGI VIZSGA 2009. május 14. FÖLDRAJZ ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI ÉRETTSÉGI VIZSGA JAVÍTÁSI-ÉRTÉKELÉSI ÚTMUTATÓ OKTATÁSI ÉS KULTURÁLIS MINISZTÉRIUM Paper
i1400 Image Processing Guide A-61623_zh-tw
i1400 Image Processing Guide A-61623_zh-tw ................................................................. 1.............................................................. 1.........................................................
Az Open Data jogi háttere. Dr. Telek Eszter
Az Open Data jogi háttere Dr. Telek Eszter Egy kis ismétlés Open Data/Open Access/Open Knowledge gyökerei Open Source Software FLOSS (Free Libre Open Source Software) Szoftver esetében egyszerű alapok:
Az NMR és a bizonytalansági elv rejtélyes találkozása
Az NMR és a bizonytalansági elv rejtélyes találkozása ifj. Szántay Csaba MTA Kémiai Tudományok Osztálya 2012. február 21. a magspínek pulzus-gerjesztésének értelmezési paradigmája GLOBÁLISAN ELTERJEDT
Statisztikai hipotézisvizsgálatok. Paraméteres statisztikai próbák
Statisztikai hipotézisvizsgálatok Paraméteres statisztikai próbák 1. Magyarországon a lakosság élelmiszerre fordított kiadásainak 2000-ben átlagosan 140 ezer Ft/fő volt. Egy kérdőíves felmérés során Veszprém
Descriptive Statistics
Descriptive Statistics Petra Petrovics DESCRIPTIVE STATISTICS Definition: Descriptive statistics is concerned only with collecting and describing data Methods: - statistical tables and graphs - descriptive
A rosszindulatú daganatos halálozás változása 1975 és 2001 között Magyarországon
A rosszindulatú daganatos halálozás változása és között Eredeti közlemény Gaudi István 1,2, Kásler Miklós 2 1 MTA Számítástechnikai és Automatizálási Kutató Intézete, Budapest 2 Országos Onkológiai Intézet,
Phenotype. Genotype. It is like any other experiment! What is a bioinformatics experiment? Remember the Goal. Infectious Disease Paradigm
It is like any other experiment! What is a bioinformatics experiment? You need to know your data/input sources You need to understand your methods and their assumptions You need a plan to get from point
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Correlation & Regression
Correlation & Regression Types of dependence association between nominal data mixed between a nominal and a ratio data correlation among ratio data Correlation describes the strength of a relationship,
Discussion of The Blessings of Multiple Causes by Wang and Blei
Discussion of The Blessings of Multiple Causes by Wang and Blei Kosuke Imai Zhichao Jiang Harvard University JASA Theory and Methods Invited Papers Session Joint Statistical Meetings July 29, 2019 Imai
Eladni könnyedén? Oracle Sales Cloud. Horváth Tünde Principal Sales Consultant 2014. március 23.
Eladni könnyedén? Oracle Sales Cloud Horváth Tünde Principal Sales Consultant 2014. március 23. Oracle Confidential Internal/Restricted/Highly Restricted Safe Harbor Statement The following is intended
SQL/PSM kurzorok rész
SQL/PSM kurzorok --- 2.rész Tankönyv: Ullman-Widom: Adatbázisrendszerek Alapvetés Második, átdolgozott kiadás, Panem, 2009 9.3. Az SQL és a befogadó nyelv közötti felület (sormutatók) 9.4. SQL/PSM Sémában
Introduction to Statistics
Introduction to Statistics Petra Petrovics Statistics Statistics: is a mathematical science pertaining to the collection, analysis, interpretation or explanation, and presentation of data. Practical activity
Véges szavak általánosított részszó-bonyolultsága
Véges szavak általánosított részszó-bonyolultsága KÁSA Zoltán Sapientia Erdélyi Magyar Tudományegyetem Kolozsvár Marosvásárhely Csíkszereda Matematika-Informatika Tanszék, Marosvásárhely Budapest, 2010.
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY A feladatsor három részbol áll 1. A vizsgáztató társalgást kezdeményez a vizsgázóval. 2. A vizsgázó egy szituációs feladatban vesz részt a
TestLine - Angol teszt Minta feladatsor
Minta felaatsor venég Téma: Általános szintfelmérő Aláírás:... Dátum: 2016.05.29 08:18:49 Kérések száma: 25 kérés Kitöltési iő: 1:17:27 Nehézség: Összetett Pont egység: +6-2 Értékelés: Alaértelmezett értékelés
Sebastián Sáez Senior Trade Economist INTERNATIONAL TRADE DEPARTMENT WORLD BANK
Sebastián Sáez Senior Trade Economist INTERNATIONAL TRADE DEPARTMENT WORLD BANK Despite enormous challenges many developing countries are service exporters Besides traditional activities such as tourism;
Lecture 11: Genetic Algorithms
Lecture 11 1 Linear and Combinatorial Optimization Lecture 11: Genetic Algorithms Genetic Algorithms - idea Genetic Algorithms - implementation and examples Lecture 11 2 Genetic algorithms Algorithm is
Kvantum-informatika és kommunikáció 2015/2016 ősz. A kvantuminformatika jelölésrendszere szeptember 11.
Kvantum-informatika és kommunikáció 2015/2016 ősz A kvantuminformatika jelölésrendszere 2015. szeptember 11. Mi lehet kvantumbit? Kvantum eszközök (1) 15=5 3 Bacsárdi Képek forrása: IBM's László, Almaden
7 th Iron Smelting Symposium 2010, Holland
7 th Iron Smelting Symposium 2010, Holland Október 13-17 között került megrendezésre a Hollandiai Alphen aan den Rijn városában található Archeon Skanzenben a 7. Vasolvasztó Szimpózium. Az öt napos rendezvényen
Kabos Sándor. Térben autokorrelált adatrendszerek
Kabos Sándor Térben autokorrelált adatrendszerek elemzése Összefoglalás az előadás példákon szemlélteti a térben autokorrelált adatok blokkosításának és összefüggésvizsgálatának jellemző tulajdonságait.
USER MANUAL Guest user
USER MANUAL Guest user 1 Welcome in Kutatótér (Researchroom) Top menu 1. Click on it and the left side menu will pop up 2. With the slider you can make left side menu visible 3. Font side: enlarging font
Dense Matrix Algorithms (Chapter 8) Alexandre David B2-206
Dense Matrix Algorithms (Chapter 8) Alexandre David B2-206 Dense Matrix Algorithm Dense or full matrices: few known zeros. Other algorithms for sparse matrix. Square matrices for pedagogical purposes only
AZ ACM NEMZETKÖZI PROGRAMOZÓI VERSENYE
AZ ACM NEMZETKÖZI PROGRAMOZÓI VERSENYE Kuki Attila, kuki@math.klte.hu Kossuth Lajos Tudományegyetem, Információ Technológia Tanszék Abstract This paper is dedicated to the Scholastic Programming Contest
ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP
ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP CHILD S DATA / GYERMEK ADATAI PLEASE FILL IN THIS INFORMATION WITH DATA BASED ON OFFICIAL DOCUMENTS / KÉRJÜK, TÖLTSE KI A HIVATALOS DOKUMENTUMOKBAN SZEREPLŐ ADATOK
3. MINTAFELADATSOR KÖZÉPSZINT. Az írásbeli vizsga időtartama: 30 perc. III. Hallott szöveg értése
Oktatáskutató és Fejlesztő Intézet TÁMOP-3.1.1-11/1-2012-0001 XXI. századi közoktatás (fejlesztés, koordináció) II. szakasz ANGOL NYELV 3. MINTAFELADATSOR KÖZÉPSZINT Az írásbeli vizsga időtartama: 30 perc
FÖLDRAJZ ANGOL NYELVEN
Földrajz angol nyelven középszint 0802 ÉRETTSÉGI VIZSGA 2008. május 15. FÖLDRAJZ ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI ÉRETTSÉGI VIZSGA JAVÍTÁSI-ÉRTÉKELÉSI ÚTMUTATÓ OKTATÁSI ÉS KULTURÁLIS MINISZTÉRIUM Paper
Create & validate a signature
IOTA TUTORIAL 7 Create & validate a signature v.0.0 KNBJDBIRYCUGVWMSKPVA9KOOGKKIRCBYHLMUTLGGAV9LIIPZSBGIENVBQ9NBQWXOXQSJRIRBHYJ9LCTJLISGGBRFRTTWD ABBYUVKPYFDJWTFLICYQQWQVDPCAKNVMSQERSYDPSSXPCZLVKWYKYZMREAEYZOSPWEJLHHFPYGSNSUYRZXANDNQTTLLZA
RÉZKULTÚRA BUDAPESTEN
RÉZKULTÚRA BUDAPESTEN A rezet megmunkálhatósága és idôtállósága miatt évszázadok óta használjuk. Alkalmazása egyértelmûen megbízható és gazdaságos. Színe, diszkrét fénye, a belôle készült tárgyak eleganciája
A golyók felállítása a Pool-biliárd 8-as játékának felel meg. A golyók átmérıje 57.2 mm. 15 számozott és egy fehér golyó. Az elsı 7 egyszínő, 9-15-ig
A golyók elhelyezkedése a Snooker alaphelyzetet mutatja. A golyók átmérıje 52 mm, egyszínőek. 15 db piros, és 1-1 db fehér, fekete, rózsa, kék, barna, zöld, sárga. A garázsban állítjuk fel, ilyenkor az
Yacht Irodaház 1118 Budapest, Budaörsi út 75.
Hegedős Csaba Asset manager Mobil: +36 30 867 7679 E-mail: hegedus.csaba.1@cib.hu LEÍRÁS / PROPERTY HIGHLIGHTS A Yacht Irodaház 2008-ban épült "A" kategóriás irodaház közel 2000 m 2 minıségi irodaterülettel.
Számítógéppel irányított rendszerek elmélete. Gyakorlat - Mintavételezés, DT-LTI rendszermodellek
Számítógéppel irányított rendszerek elmélete Gyakorlat - Mintavételezés, DT-LTI rendszermodellek Hangos Katalin Villamosmérnöki és Információs Rendszerek Tanszék e-mail: hangos.katalin@virt.uni-pannon.hu
OLYMPICS! SUMMER CAMP
OLYMPICS! SUMMER CAMP YOUNG BUSINESS CAMP 3D DESIGN CAMP OLYMPICS SUMMER CAMP 20 24 JUNE AND 27 JUNE 1 JULY AGE: 6-14 Our ESB native-speaking teachers will provide a strong English learning content throughout
Kezdőlap > Termékek > Szabályozó rendszerek > EASYLAB és TCU-LON-II szabályozó rendszer LABCONTROL > Érzékelő rendszerek > Típus DS-TRD-01
Típus DS-TRD FOR EASYLAB FUME CUPBOARD CONTROLLERS Sash distance sensor for the variable, demand-based control of extract air flows in fume cupboards Sash distance measurement For fume cupboards with vertical
A logaritmikus legkisebb négyzetek módszerének karakterizációi
A logaritmikus legkisebb négyzetek módszerének karakterizációi Csató László laszlo.csato@uni-corvinus.hu MTA Számítástechnikai és Automatizálási Kutatóintézet (MTA SZTAKI) Operációkutatás és Döntési Rendszerek
GEOGRAPHICAL ECONOMICS B
GEOGRAPHICAL ECONOMICS B ELTE Faculty of Social Sciences, Department of Economics Geographical Economics "B" KRUGMAN (1991) MODEL: EXTENSIONS Authors: Gábor Békés, Sarolta Rózsás Supervised by Gábor
KN-CP50. MANUAL (p. 2) Digital compass. ANLEITUNG (s. 4) Digitaler Kompass. GEBRUIKSAANWIJZING (p. 10) Digitaal kompas
KN-CP50 MANUAL (p. ) Digital compass ANLEITUNG (s. 4) Digitaler Kompass MODE D EMPLOI (p. 7) Boussole numérique GEBRUIKSAANWIJZING (p. 0) Digitaal kompas MANUALE (p. ) Bussola digitale MANUAL DE USO (p.
Website review acci.hu
Website review acci.hu Generated on September 30 2016 21:54 PM The score is 37/100 SEO Content Title Acci.hu - Ingyenes apróhirdető Length : 30 Perfect, your title contains between 10 and 70 characters.
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében. Dicse Jenő üzletfejlesztési igazgató
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében Dicse Jenő üzletfejlesztési igazgató How to apply modern e-learning to improve the training of firefighters Jenő Dicse Director of
már mindenben úgy kell eljárnunk, mint bármilyen viaszveszejtéses öntés esetén. A kapott öntvény kidolgozásánál még mindig van lehetőségünk
Budapest Régiségei XLII-XLIII. 2009-2010. Vecsey Ádám Fémeszterga versus viaszesztergálás Bev e z e t é s A méhviaszt, mint alapanyagot nehéz besorolni a műtárgyalkotó anyagok különböző csoportjaiba, mert
Supplementary Table 1. Cystometric parameters in sham-operated wild type and Trpv4 -/- rats during saline infusion and
WT sham Trpv4 -/- sham Saline 10µM GSK1016709A P value Saline 10µM GSK1016709A P value Number 10 10 8 8 Intercontractile interval (sec) 143 (102 155) 98.4 (71.4 148) 0.01 96 (92 121) 109 (95 123) 0.3 Voided
FÖLDRAJZ ANGOL NYELVEN
Földrajz angol nyelven középszint 1112 ÉRETTSÉGI VIZSGA 2014. május 15. FÖLDRAJZ ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI ÉRETTSÉGI VIZSGA JAVÍTÁSI-ÉRTÉKELÉSI ÚTMUTATÓ EMBERI ERŐFORRÁSOK MINISZTÉRIUMA Paper
Alternating Permutations
Alternating Permutations Richard P. Stanley M.I.T. Definitions A sequence a 1, a 2,..., a k of distinct integers is alternating if a 1 > a 2 < a 3 > a 4 a 3
Ismeri Magyarországot?
instrukciók Instrukciók angolul Preparation: print out the worksheets You will need: a dictionary Time: 25-30 minutes With this worksheet, you will learn and share basic information about the location
ANGOL NYELVI SZINTFELMÉRŐ 2013 A CSOPORT. on of for from in by with up to at
ANGOL NYELVI SZINTFELMÉRŐ 2013 A CSOPORT A feladatok megoldására 45 perc áll rendelkezésedre, melyből körülbelül 10-15 percet érdemes a levélírási feladatra szánnod. Sok sikert! 1. Válaszd ki a helyes
Unit 10: In Context 55. In Context. What's the Exam Task? Mediation Task B 2: Translation of an informal letter from Hungarian to English.
Unit 10: In Context 55 UNIT 10 Mediation Task B 2 Hungarian into English In Context OVERVIEW 1. Hungarian and English in Context 2. Step By Step Exam Techniques Real World Link Students who have studied
PIACI HIRDETMÉNY / MARKET NOTICE
PIACI HIRDETMÉNY / MARKET NOTICE HUPX DAM Másnapi Aukció / HUPX DAM Day-Ahead Auction Iktatási szám / Notice #: Dátum / Of: 18/11/2014 HUPX-MN-DAM-2014-0023 Tárgy / Subject: Változások a HUPX másnapi piac
MATEMATIKA ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2018. május 8. MATEMATIKA ANGOL NYELVEN EMELT SZINTŰ ÍRÁSBELI VIZSGA 2018. május 8. 8:00 Időtartam: 300 perc Pótlapok száma Tisztázati Piszkozati EMBERI ERŐFORRÁSOK MINISZTÉRIUMA Matematika
Planetary Nebulae, PN PNe PN
2 2 e-mail: masaaki@oao.nao.ac.jp 719 0232 3037 5 Subaru Telescope, National Astronomical Observatory of Japan, 650 North A ohoku Place, Hilo, Hawaii 96720, U.S.A. e-mail: tajitsu@subaru.naoj.org 397 0101