(c) 2004 F. Estrada & A. Jepson & D. Fleet Canny Edges Tutorial: Oct. 4, '03 Canny Edges Tutorial References: ffl imagetutorial.m ffl cannytutorial.m
|
|
- Diána Ida Vörösné
- 5 évvel ezelőtt
- Látták:
Átírás
1 Canny Edges Tutorial: Oct. 4, '03 Canny Edges Tutorial References: ffl imagetutorial.m ffl cannytutorial.m ffl ~jepson/pub/matlab/isetoolbox/tutorials ffl ~jepson/pub/matlab/utvistoolbox/tutorials ffl Canny, J. 'A Computational Approach to Edge Detection', Pattern Analysis and Machine Intelligence, Vol. 8, No. 6, November, 1986, pp Canny Edges Tutorial 1
2 Canny Edge Detection steps The process of edge extraction is formed by the following (general) steps: - Convolution of the image with edge enhancing masks in the x and y directions. - Computation of image gradient (magnitude and direction) - Thresholding of the gradient image - Non-maximum edgel suppression Canny Edge Detection steps 2
3 Image Gradient The convolution of the image with derivative filters in the x and y directions yields the x and y components of the image gradient ri = [I x I y ] = A(x; y)e i( (x;y)). The amplitude and orientation of the gradient are computed directly from the image derivatives along x and y. image Gradient 3
4 Gradient magnitude The magnitudeq of the gradient at pixel p(x; y) is given by A(x; y) = I 2 + I 2, it gives an indication of the x y strength of a possible edge at p(x; y). The figure on the lower-right shows a section of the gradient magnitude image on the lower-left, with pixel brightness rescaled to better show gradient magnitude around the circle. Gradient magnitude 4
5 Gradient thresholding Once the gradient magnitude has been computed, a threshold is applied to remove all weak responses due to noise. The resulting binary image is where the actual search for edgels takes place. Gradient thresholding 5
6 Gradient orientation Besides the thresholded gradient magnitude map, we require an estimate of the gradient direction at each pixel, (x; y) = arctan(i y =I x ). The gradient direction is always perpendicular to the direction of an edge passing through p(x; y). The gradient orientation is only computed at image locations that passed the gradient magnitude threshold. Gradient orientation 6
7 Non-Maximal Suppression Real edges correspond to places where the gradient magnitude is maximal, other locations along the gradient direction, with non-zero but not maximal responses must be discarded. Non maximal suppression looks along the gradient direction, suppressing any edgel locations with nonmaximal response. Non-Maximal Suppression 7
8 The final edge image Edgels that remain after non-maximal suppression make up the final edge map. The final edge image 8
9 Choice of sigma and level of detail Smaller sigma values cause the derivative filters to respond to smaller features, but also make the filters more sensitive to noise. Conversely, larger sigma values decrease localization accuracy. The edges on the lower-left correspond to ff = 2, the edges on the lower right correspond to ff = 1. The value of ff determines the scale of the edges that are detected. Choice of sigma and level of detail 9
10 Choice of sigma and level of detail σ=1 σ=2 σ=4 σ=6 σ=20 Choice of sigma and level of detail 10
11 Other edge extraction operators Instead of using a Gaussian and its derivatives, we could use other standard filter masks such as those defined by Sobel or Roberts. Canny Sobel, [1 2 1; 0 0 0; 1 2 1] and its transpose Roberts, [1 0; 0 1] and its transpose Other edge extraction operators 11
12 Common issues with Canny edges - Threshold selection - False positives - False negatives - Double edges - How to determine edge saliency? Common issues with Canny edges 12
13 Threshold selection A small change in threshold can make a large difference in the resulting edgel map. Threshold selection 13
14 Determining edge saliency A very difficult open problem. Edge saliency is related to the likelihood that a given edgel belongs to an object boundary. - Can this be evaluated locally? - How about edges from shadows, illumination changes, and texture? - Canny enhancement: Hysteresis threshold - We can do a bit better with some clever filtering! Determining edge saliency 14
15 The Orientation Tensor The gradient orientation behaves in different ways depending on whether an edgel is located within a textured region or not. Gradient directions for a region containing lines Gradient directions for a region containing texture Notice that for edgels that lie along a line, the gradient orientation is very similar. Conversely, for edgels that arise from texture or noise, gradient directions look random. The Orientation Tensor 15
16 The Orientation Tensor The Orientation Tensor at each edgel is given by G(ff)Λ (t t 0 ), where t is a column vector with the tangent direction at each edgel (the direction perpendicular to the gradient at that edgel). The Orientation Tensor at edgel (x; y), then, is a combination of the terms t t 0 for edgels around (x; y), the contribution of each surrounding edgel is weighted The Orientation Tensor 16
17 by a Gaussian with standard deviation ff, centered at (x; y). The Orientation Tensor 17
18 The Orientation Tensor The Orientation Tensor at each edgel is represented with a 2x2 matrix, it encodes the combination of edgel directions in the vicinity of edgel (x; y). The trace (sum of the diagonal elements) of the Orientation Tensor is indicative of the density of edgels around a local neighborhood. Bench edgels Trace of the Orientation Tensor Notice the trace of the Orientation Tensor is large where there is a high density of edgels. The Orientation Tensor 18
19 The Orientation Tensor The 2 eigenvalues of the Orientation Tensor at each edgel are indicative of the degree of correlation between edgel directions in the local neighborhood. If there is a dominant direction for edgels in the neighborhood of (x; y), the Orientation Tensor at (x; y) will have one large eigenvalue, and one small eigenvalue. Conversely, when both eigenvalues have roughly the same magnitude, there is no preferred orientation. The above provides an indication of whether an edgel is likely to have originated from noise or image texture. The Orientation Tensor 19
20 The Orientation Tensor The normalized difference between the eigenvalues indicates how uniformly directed a region is (the region's directedness), the normalized average of the eigenvalues indicates how uniformly scattered the directions in a region are (the region's randomness). Directedness Randomness The Orientation Tensor 20
21 The Orientation Tensor We can combine both images into a colored plot that shows regions with a dominant direction in red, and regions with large randomness in green. The Orientation Tensor 21
22 The Orientation Tensor - We can use the orientation tensor as a rough indicator of whether a pixel is within a textured region or not - Have we solved the saliency problem? - How about texture that has a dominant orientation? - Still local! - Still an open problem, in general, we do the best job we can at edge extraction, and then turn the job over to more complex feature extraction algorithms (e.g. line and curve fitting), and perceptual grouping. The Orientation Tensor 22
Construction of a cube given with its centre and a sideline
Transformation of a plane of projection Construction of a cube given with its centre and a sideline Exercise. Given the center O and a sideline e of a cube, where e is a vertical line. Construct the projections
Correlation & Linear Regression in SPSS
Petra Petrovics Correlation & Linear Regression in SPSS 4 th seminar Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Correlation
Using the CW-Net in a user defined IP network
Using the CW-Net in a user defined IP network Data transmission and device control through IP platform CW-Net Basically, CableWorld's CW-Net operates in the 10.123.13.xxx IP address range. User Defined
Széchenyi István Egyetem www.sze.hu/~herno
Oldal: 1/6 A feladat során megismerkedünk a C# és a LabVIEW összekapcsolásának egy lehetőségével, pontosabban nagyon egyszerű C#- ban írt kódból fordítunk DLL-t, amit meghívunk LabVIEW-ból. Az eljárás
Rezgésdiagnosztika. Diagnosztika 02 --- 1
Rezgésdiagnosztika Diagnosztika 02 --- 1 Diagnosztika 02 --- 2 A rezgéskép elemzésével kimutatható gépészeti problémák Minden gép, mely tartalmaz forgó részt (pl. motor, generátor, szivattyú, ventilátor,
On The Number Of Slim Semimodular Lattices
On The Number Of Slim Semimodular Lattices Gábor Czédli, Tamás Dékány, László Ozsvárt, Nóra Szakács, Balázs Udvari Bolyai Institute, University of Szeged Conference on Universal Algebra and Lattice Theory
Cluster Analysis. Potyó László
Cluster Analysis Potyó László What is Cluster Analysis? Cluster: a collection of data objects Similar to one another within the same cluster Dissimilar to the objects in other clusters Cluster analysis
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Nonparametric Tests
Nonparametric Tests Petra Petrovics Hypothesis Testing Parametric Tests Mean of a population Population proportion Population Standard Deviation Nonparametric Tests Test for Independence Analysis of Variance
Statistical Inference
Petra Petrovics Statistical Inference 1 st lecture Descriptive Statistics Inferential - it is concerned only with collecting and describing data Population - it is used when tentative conclusions about
Texture Analysis. Selim Aksoy Department of Computer Engineering Bilkent University
Texture Analysis Selim Aksoy Department of Computer Engineering Bilkent University saksoy@cs.bilkent.edu.tr Texture An important approach to image description is to quantify its texture content. Texture
Szundikáló macska Sleeping kitty
Model: Peter Budai 999. Diagrams: Peter Budai 999.. Oda-visszahajtás átlósan. Fold and unfold diagonally. 2. Behajtunk középre. Fold to the center. 3. Oda-visszahajtások derékszögben. Fold and unfold at
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Hypothesis Testing. Petra Petrovics.
Hypothesis Testing Petra Petrovics PhD Student Inference from the Sample to the Population Estimation Hypothesis Testing Estimation: how can we determine the value of an unknown parameter of a population
Supplementary materials to: Whole-mount single molecule FISH method for zebrafish embryo
Supplementary materials to: Whole-mount single molecule FISH method for zebrafish embryo Yuma Oka and Thomas N. Sato Supplementary Figure S1. Whole-mount smfish with and without the methanol pretreatment.
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Correlation & Linear. Petra Petrovics.
Correlation & Linear Regression in SPSS Petra Petrovics PhD Student Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise
Mapping Sequencing Reads to a Reference Genome
Mapping Sequencing Reads to a Reference Genome High Throughput Sequencing RN Example applications: Sequencing a genome (DN) Sequencing a transcriptome and gene expression studies (RN) ChIP (chromatin immunoprecipitation)
i1400 Image Processing Guide A-61623_zh-tw
i1400 Image Processing Guide A-61623_zh-tw ................................................................. 1.............................................................. 1.........................................................
Dependency preservation
Adatbázis-kezelés. (4 előadás: Relácó felbontásai (dekomponálás)) 1 Getting lossless decomposition is necessary. But of course, we also want to keep dependencies, since losing a dependency means, that
Correlation & Linear Regression in SPSS
Correlation & Linear Regression in SPSS Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise 1 - Correlation File / Open
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel Timea Farkas Click here if your download doesn"t start
KN-CP50. MANUAL (p. 2) Digital compass. ANLEITUNG (s. 4) Digitaler Kompass. GEBRUIKSAANWIJZING (p. 10) Digitaal kompas
KN-CP50 MANUAL (p. ) Digital compass ANLEITUNG (s. 4) Digitaler Kompass MODE D EMPLOI (p. 7) Boussole numérique GEBRUIKSAANWIJZING (p. 0) Digitaal kompas MANUALE (p. ) Bussola digitale MANUAL DE USO (p.
Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz
Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz Kvantumkapuk, áramkörök 2016. március 3. A kvantummechanika posztulátumai (1-2) 1. Állapotleírás Zárt fizikai rendszer aktuális állapota
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Nonparametric Tests. Petra Petrovics.
Nonparametric Tests Petra Petrovics PhD Student Hypothesis Testing Parametric Tests Mean o a population Population proportion Population Standard Deviation Nonparametric Tests Test or Independence Analysis
Ültetési és öntözési javaslatok. Planting and watering instructions
Ültetési és öntözési javaslatok Planting and watering instructions 1 Önöntöző-rendszer Sub-irrigation 2 Kedves növénykedvelő A LECHUZA önöntöző rendszerrel növényeink természetüknél fogva gyönyörű virágokat
Contrast Restoration by Adaptive Countershading
Contrast Restoration by Adaptive Countershading Grzegorz Krawczyk, Karol Myszkowski, and Hans-Peter Seidel MPI Informatik, Saarbrücken, Germany Eurographics 2007, Sept. 7 th, Prague The Importance of Contrast
Supplementary Table 1. Cystometric parameters in sham-operated wild type and Trpv4 -/- rats during saline infusion and
WT sham Trpv4 -/- sham Saline 10µM GSK1016709A P value Saline 10µM GSK1016709A P value Number 10 10 8 8 Intercontractile interval (sec) 143 (102 155) 98.4 (71.4 148) 0.01 96 (92 121) 109 (95 123) 0.3 Voided
Create & validate a signature
IOTA TUTORIAL 7 Create & validate a signature v.0.0 KNBJDBIRYCUGVWMSKPVA9KOOGKKIRCBYHLMUTLGGAV9LIIPZSBGIENVBQ9NBQWXOXQSJRIRBHYJ9LCTJLISGGBRFRTTWD ABBYUVKPYFDJWTFLICYQQWQVDPCAKNVMSQERSYDPSSXPCZLVKWYKYZMREAEYZOSPWEJLHHFPYGSNSUYRZXANDNQTTLLZA
Phenotype. Genotype. It is like any other experiment! What is a bioinformatics experiment? Remember the Goal. Infectious Disease Paradigm
It is like any other experiment! What is a bioinformatics experiment? You need to know your data/input sources You need to understand your methods and their assumptions You need a plan to get from point
Computer Architecture
Computer Architecture Locality-aware programming 2016. április 27. Budapest Gábor Horváth associate professor BUTE Department of Telecommunications ghorvath@hit.bme.hu Számítógép Architektúrák Horváth
A jövedelem alakulásának vizsgálata az észak-alföldi régióban az 1997-99. évi adatok alapján
A jövedelem alakulásának vizsgálata az észak-alföldi régióban az 1997-99. évi adatok alapján Rózsa Attila Debreceni Egyetem Agrártudományi Centrum, Agrárgazdasági és Vidékfejlesztési Intézet, Számviteli
A BÜKKI KARSZTVÍZSZINT ÉSZLELŐ RENDSZER KERETÉBEN GYŰJTÖTT HIDROMETEOROLÓGIAI ADATOK ELEMZÉSE
KARSZTFEJLŐDÉS XIX. Szombathely, 2014. pp. 137-146. A BÜKKI KARSZTVÍZSZINT ÉSZLELŐ RENDSZER KERETÉBEN GYŰJTÖTT HIDROMETEOROLÓGIAI ADATOK ELEMZÉSE ANALYSIS OF HYDROMETEOROLIGYCAL DATA OF BÜKK WATER LEVEL
Supplementary Figure 1
Supplementary Figure 1 Plot of delta-afe of sequence variants detected between resistant and susceptible pool over the genome sequence of the WB42 line of B. vulgaris ssp. maritima. The delta-afe values
Performance Modeling of Intelligent Car Parking Systems
Performance Modeling of Intelligent Car Parking Systems Károly Farkas Gábor Horváth András Mészáros Miklós Telek Technical University of Budapest, Hungary EPEW 2014, Florence, Italy Outline Intelligent
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY A feladatsor három részbol áll 1. A vizsgáztató társalgást kezdeményez a vizsgázóval. 2. A vizsgázó egy szituációs feladatban vesz részt a
Lexington Public Schools 146 Maple Street Lexington, Massachusetts 02420
146 Maple Street Lexington, Massachusetts 02420 Surplus Printing Equipment For Sale Key Dates/Times: Item Date Time Location Release of Bid 10/23/2014 11:00 a.m. http://lps.lexingtonma.org (under Quick
Választási modellek 3
Választási modellek 3 Prileszky István Doktori Iskola 2018 http://www.sze.hu/~prile Forrás: A Self Instructing Course in Mode Choice Modeling: Multinomial and Nested Logit Models Prepared For U.S. Department
openbve járműkészítés Leírás a sound.cfg fájlhoz használható parancsokról
Leírás az openbve-vel kompatibilis sound.cfg fájl készítéséhez használható parancsokról 1. oldal openbve járműkészítés Leírás a sound.cfg fájlhoz használható parancsokról A leírás az openbve-hez készíthető
Statistical Dependence
Statistical Dependence Petra Petrovics Statistical Dependence Deinition: Statistical dependence exists when the value o some variable is dependent upon or aected by the value o some other variable. Independent
Eladni könnyedén? Oracle Sales Cloud. Horváth Tünde Principal Sales Consultant 2014. március 23.
Eladni könnyedén? Oracle Sales Cloud Horváth Tünde Principal Sales Consultant 2014. március 23. Oracle Confidential Internal/Restricted/Highly Restricted Safe Harbor Statement The following is intended
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Factor Analysis
Factor Analysis Factor analysis is a multiple statistical method, which analyzes the correlation relation between data, and it is for data reduction, dimension reduction and to explore the structure. Aim
General information for the participants of the GTG Budapest, 2017 meeting
General information for the participants of the GTG Budapest, 2017 meeting Currency is Hungarian Forint (HUF). 1 EUR 310 HUF, 1000 HUF 3.20 EUR. Climate is continental, which means cold and dry in February
2 level 3 innovation tiles. 3 level 2 innovation tiles. 3 level 1 innovation tiles. 2 tribe pawns of each color. 3 height 3 tribe pawns.
2 darab 3-as szintű találmány jelző Origin kártyaszövegek fordítása Vágd ki a az egyes kártyákhoz tartozó lapokat a vonalak és a színes terület mentén, majd csúsztasd be a kártyavédő fóliába úgy, hogy
Pletykaalapú gépi tanulás teljesen elosztott környezetben
Pletykaalapú gépi tanulás teljesen elosztott környezetben Hegedűs István Jelasity Márk témavezető Szegedi Tudományegyetem MTA-SZTE Mesterséges Intelligencia Kutatócsopot Motiváció Az adat adatközpontokban
Csima Judit április 9.
Osztályozókról még pár dolog Csima Judit BME, VIK, Számítástudományi és Információelméleti Tanszék 2018. április 9. Csima Judit Osztályozókról még pár dolog 1 / 19 SVM (support vector machine) ez is egy
Supporting Information
Supporting Information Cell-free GFP simulations Cell-free simulations of degfp production were consistent with experimental measurements (Fig. S1). Dual emmission GFP was produced under a P70a promoter
Tudományos Ismeretterjesztő Társulat
Sample letter number 5. International Culture Festival PO Box 34467 Harrogate HG 45 67F Sonnenbergstraße 11a CH-6005 Luzern Re: Festival May 19, 2009 Dear Ms Atkinson, We are two students from Switzerland
Ensemble Kalman Filters Part 1: The basics
Ensemble Kalman Filters Part 1: The basics Peter Jan van Leeuwen Data Assimilation Research Centre DARC University of Reading p.j.vanleeuwen@reading.ac.uk Model: 10 9 unknowns P[u(x1),u(x2),T(x3),.. Observations:
IES TM Evaluating Light Source Color Rendition
IES TM-30-15 Evaluating Light Source Color Rendition "Original" "CRI = 80" Desaturated "CRI = 80" Saturated More metrics Color Fidelity Color Discrimination Color Preference Metrics/Measures R f (IES TM-30-15)
Éldetektálás. Digitális képelemzés alapvető algoritmusai. Képi élek. Csetverikov Dmitrij. A Canny-éldetektor Az éldetektálás utófeldolgozása
Éldetektálás Digitális képelemzés alapvető algoritmusai 1 Alapvető képi sajátságok Csetverikov Dmitrij Eötvös Lóránd Egyetem, Budapest csetverikov@sztaki.hu http://vision.sztaki.hu Informatikai Kar Az
Az fmri alapjai BOLD fiziológia. Dr. Kincses Tamás Szegedi Tudományegyetem Neurológiai Klinika
Az fmri alapjai BOLD fiziológia Dr. Kincses Tamás Szegedi Tudományegyetem Neurológiai Klinika T2* Az obszervált transzverzális relaxáció (T2*) több különböző komponens összege Many physical effects result
Adattípusok. Max. 2GByte
Adattípusok Típus Méret Megjegyzés Konstans BIT 1 bit TRUE/FALSE SMALLINT 2 byte -123 INTEGER 4 byte -123 COUNTER 4 byte Automatikus 123 REAL 4 byte -12.34E-2 FLOAT 8 byte -12.34E-2 CURRENCY / MONEY 8
MATEMATIKA ANGOL NYELVEN MATHEMATICS
ÉRETTSÉGI VIZSGA 2005. május 10. MATEMATIKA ANGOL NYELVEN MATHEMATICS EMELT SZINTŰ ÍRÁSBELI VIZSGA HIGHER LEVEL WRITTEN EXAMINATION Az írásbeli vizsga időtartama: 240 perc Time allowed for the examination:
Adatbázisok 1. Rekurzió a Datalogban és SQL-99
Adatbázisok 1 Rekurzió a Datalogban és SQL-99 Expressive Power of Datalog Without recursion, Datalog can express all and only the queries of core relational algebra. The same as SQL select-from-where,
MATEMATIKA ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2016. október 18. MATEMATIKA ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2016. október 18. 8:00 I. Időtartam: 45 perc Pótlapok száma Tisztázati Piszkozati EMBERI ERŐFORRÁSOK MINISZTÉRIUMA
Dynamic freefly DIVE POOL LINES
Dynamic freefly 3.rész Part 3 DIVE POOL LINES A dynamic repülés három fajta mozgásból áll: Dynamic freeflying is composed of three types of movements: -Lines (vízszintes "szlalom") (horizontal "slalom")
OLYMPICS! SUMMER CAMP
OLYMPICS! SUMMER CAMP YOUNG BUSINESS CAMP 3D DESIGN CAMP OLYMPICS SUMMER CAMP 20 24 JUNE AND 27 JUNE 1 JULY AGE: 6-14 Our ESB native-speaking teachers will provide a strong English learning content throughout
EN United in diversity EN A8-0206/419. Amendment
22.3.2019 A8-0206/419 419 Article 2 paragraph 4 point a point i (i) the identity of the road transport operator; (i) the identity of the road transport operator by means of its intra-community tax identification
USER MANUAL Guest user
USER MANUAL Guest user 1 Welcome in Kutatótér (Researchroom) Top menu 1. Click on it and the left side menu will pop up 2. With the slider you can make left side menu visible 3. Font side: enlarging font
A rosszindulatú daganatos halálozás változása 1975 és 2001 között Magyarországon
A rosszindulatú daganatos halálozás változása és között Eredeti közlemény Gaudi István 1,2, Kásler Miklós 2 1 MTA Számítástechnikai és Automatizálási Kutató Intézete, Budapest 2 Országos Onkológiai Intézet,
2. Local communities involved in landscape architecture in Óbuda
Év Tájépítésze pályázat - Wallner Krisztina 2. Közösségi tervezés Óbudán Óbuda jelmondata: Közösséget építünk, ennek megfelelően a formálódó helyi közösségeket bevonva fejlesztik a közterületeket. Békásmegyer-Ófaluban
STUDENT LOGBOOK. 1 week general practice course for the 6 th year medical students SEMMELWEIS EGYETEM. Name of the student:
STUDENT LOGBOOK 1 week general practice course for the 6 th year medical students Name of the student: Dates of the practice course: Name of the tutor: Address of the family practice: Tel: Please read
Genome 373: Hidden Markov Models I. Doug Fowler
Genome 373: Hidden Markov Models I Doug Fowler Review From Gene Prediction I transcriptional start site G open reading frame transcriptional termination site promoter 5 untranslated region 3 untranslated
3. MINTAFELADATSOR KÖZÉPSZINT. Az írásbeli vizsga időtartama: 30 perc. III. Hallott szöveg értése
Oktatáskutató és Fejlesztő Intézet TÁMOP-3.1.1-11/1-2012-0001 XXI. századi közoktatás (fejlesztés, koordináció) II. szakasz ANGOL NYELV 3. MINTAFELADATSOR KÖZÉPSZINT Az írásbeli vizsga időtartama: 30 perc
ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP
ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP CHILD S DATA / GYERMEK ADATAI PLEASE FILL IN THIS INFORMATION WITH DATA BASED ON OFFICIAL DOCUMENTS / KÉRJÜK, TÖLTSE KI A HIVATALOS DOKUMENTUMOKBAN SZEREPLŐ ADATOK
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében. Dicse Jenő üzletfejlesztési igazgató
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében Dicse Jenő üzletfejlesztési igazgató How to apply modern e-learning to improve the training of firefighters Jenő Dicse Director of
SZARVASMARHÁK MENTESÍTÉSÉNEK KÖLTSÉG-HASZON ELEMZÉSE I. ÓZSVÁRI LÁSZLÓ dr. - BÍRÓ OSZKÁR dr. ÖSSZEFOGLALÁS
SZARVASMARHÁK MENTESÍTÉSÉNEK KÖLTSÉG-HASZON ELEMZÉSE I. ÓZSVÁRI LÁSZLÓ dr. - BÍRÓ OSZKÁR dr. ÖSSZEFOGLALÁS A politikai és gazdasági rendszerváltás gyors és sok vonatkozásban nem várt változásokat eredményezett
Relative Clauses Alárendelő mellékmondat
Relative Clauses Alárendelő mellékmondat We use relative clauses to give additional information about something without starting another sentence. By combining sentences with a relative clause, your text
Budapest By Vince Kiado, Klösz György
Budapest 1900 2000 By Vince Kiado, Klösz György Download Ebook : budapest 1900 2000 in PDF Format. also available for mobile reader If you are looking for a book Budapest 1900-2000 by Vince Kiado;Klosz
7 th Iron Smelting Symposium 2010, Holland
7 th Iron Smelting Symposium 2010, Holland Október 13-17 között került megrendezésre a Hollandiai Alphen aan den Rijn városában található Archeon Skanzenben a 7. Vasolvasztó Szimpózium. Az öt napos rendezvényen
Tudományos Ismeretterjesztő Társulat
Sample letter number 3. Russell Ltd. 57b Great Hawthorne Industrial Estate Hull East Yorkshire HU 19 5BV 14 Bebek u. Budapest H-1105 10 December, 2009 Ref.: complaint Dear Sir/Madam, After seeing your
MATEMATIKA ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2017. október 17. MATEMATIKA ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2017. október 17. 8:00 I. Időtartam: 57 perc Pótlapok száma Tisztázati Piszkozati EMBERI ERŐFORRÁSOK MINISZTÉRIUMA
(NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV
Kommunikációs rendszerek programozása (NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV (5. mérés) SIP telefonközpont készítése Trixbox-szal 1 Mérés helye: Széchenyi István Egyetem, L-1/7 laboratórium, 9026 Győr, Egyetem
Hogyan szűrjük a röntgensugarat?
Hogyan szűrjük a röntgensugarat? (A röntgencsőegység állandó szűrésének nemzetközi szabványáról) Porubszky Tamás OSSKI Munkahelyi Sugáregészségügyi Osztály E-mail: porubszky@osski.hu 1 IEC 60522 (IEC 522):
Efficient symmetric key private authentication
Efficient symmetric key private authentication Cryptographic Protocols (EIT ICT MSc) Dr. Levente Buttyán Associate Professor BME Hálózati Rendszerek és Szolgáltatások Tanszék Lab of Cryptography and System
A golyók felállítása a Pool-biliárd 8-as játékának felel meg. A golyók átmérıje 57.2 mm. 15 számozott és egy fehér golyó. Az elsı 7 egyszínő, 9-15-ig
A golyók elhelyezkedése a Snooker alaphelyzetet mutatja. A golyók átmérıje 52 mm, egyszínőek. 15 db piros, és 1-1 db fehér, fekete, rózsa, kék, barna, zöld, sárga. A garázsban állítjuk fel, ilyenkor az
Local fluctuations of critical Mandelbrot cascades. Konrad Kolesko
Local fluctuations of critical Mandelbrot cascades Konrad Kolesko joint with D. Buraczewski and P. Dyszewski Warwick, 18-22 May, 2015 Random measures µ µ 1 µ 2 For given random variables X 1, X 2 s.t.
}w!"#$%&'()+,-./012345<ya
Flexible Similarity Search of Seman c Vectors Using Fulltext Search Engines Michal Růžička, Vít Novotný, Petr Sojka; Jan Pomikálek, Radim Řehůřek Masaryk University, Faculty of Informa cs, Brno, Czech
Az Open Data jogi háttere. Dr. Telek Eszter
Az Open Data jogi háttere Dr. Telek Eszter Egy kis ismétlés Open Data/Open Access/Open Knowledge gyökerei Open Source Software FLOSS (Free Libre Open Source Software) Szoftver esetében egyszerű alapok:
Adattípusok. Max. 2GByte
Adattípusok Típus Méret Megjegyzés Konstans BIT 1 bit TRUE/FALSE TINIINT 1 byte 12 SMALLINT 2 byte -123 INTEGER 4 byte -123 COUNTER 4 byte Automatikus 123 REAL 4 byte -12.34E-2 FLOAT 8 byte -12.34E-2 CURRENCY
SQL/PSM kurzorok rész
SQL/PSM kurzorok --- 2.rész Tankönyv: Ullman-Widom: Adatbázisrendszerek Alapvetés Második, átdolgozott kiadás, Panem, 2009 9.3. Az SQL és a befogadó nyelv közötti felület (sormutatók) 9.4. SQL/PSM Sémában
16F628A megszakítás kezelése
16F628A megszakítás kezelése A 'megszakítás' azt jelenti, hogy a program normális, szekvenciális futása valamilyen külső hatás miatt átmenetileg felfüggesztődik, és a vezérlést egy külön rutin, a megszakításkezelő
COOPERATION IN THE CEREAL SECTOR OF THE SOUTH PLAINS REGIONS STRÉN, BERTALAN. Keywords: cooperation, competitiveness, cereal sector, region, market.
COOPERATION IN THE CEREAL SECTOR OF THE SOUTH PLAINS REGIONS STRÉN, BERTALAN Keywords: cooperation, competitiveness, cereal sector, region, market. Using a questionnaire, we determined the nature and strength
HASZNÁLATI ÚTMUTATÓ INOX RÚDMIXER. Modell: OHBIN-9805
HASZNÁLATI ÚTMUTATÓ INOX RÚDMIXER Modell: OHBIN-9805 Kérjük, olvassa el figyelmesen ezt a tájékoztatót a készülék üzembehelyezése és használata előtt és őrizze meg ezt az információt jövőbeli használatra.
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY A feladatsor három részből áll 1. A vizsgáztató társalgást kezdeményez a vizsgázóval. 2. A vizsgázó egy szituációs feladatban vesz részt a
BALÁZS HORVÁTH. Escalator
BALÁZS HORVÁTH Escalator per tromba in Do e pianorte / for trumpet in C and piano Original version for trumpet and orchestra was composed for the final round of the International Trumpet Competition, Debrecen,
Bird species status and trends reporting format for the period (Annex 2)
1. Species Information 1.1 Member State Hungary 1.2.2 Natura 2000 code A634-B 1.3 Species name Ardea purpurea purpurea 1.3.1 Sub-specific population East Europe, Black Sea & Mediterranean/Sub-Saharan Africa
Which letter(s) show(s) a. Melyik betű(k) mutat(nak) . 1 flexor muscle group? flexor izomcsoportot? . 2 extensor muscle group?
Melyik betű(k) mutat(nak)... 1 flexor izomcsoportot?... 2 extensor izomcsoportot? Which letter(s) show(s) a. 1 flexor muscle group?. 2 extensor muscle group? A B C D 3 Nevezze meg azokat a nyálmirigyeket,
Vitorláshal Angelfish
Model: Peter udai 996. Diagrams: Peter udai 998.. Oda-visszahajtás felezve. Fordítsd meg a papírt! Fold in half and unfold. Turn the paper over. 2. Oda-visszahajtás átlósan. Fold and unfold diagonally.
MATEMATIKA ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2014. május 6. MATEMATIKA ANGOL NYELVEN EMELT SZINTŰ ÍRÁSBELI VIZSGA 2014. május 6. 8:00 Az írásbeli vizsga időtartama: 240 perc Pótlapok száma Tisztázati Piszkozati EMBERI ERŐFORRÁSOK
TÉRGAZDÁLKODÁS - A TÉR MINT VÉGES KÖZÖSSÉGI ERŐFORRÁS INGATLAN NYILVÁNTARTÁS - KÜLFÖLDI PÉLDÁK H.NAGY RÓBERT, HUNAGI
TÉRGAZDÁLKODÁS - A TÉR MINT VÉGES KÖZÖSSÉGI ERŐFORRÁS INGATLAN NYILVÁNTARTÁS - KÜLFÖLDI PÉLDÁK H.NAGY RÓBERT, HUNAGI TÉRADAT PONTOS FRISS ELÉRHETŐ CÉL Elvárások FELHASZNÁLÓ Helytállóság Elégedettség ESZKÖZ
Descriptive Statistics
Descriptive Statistics Petra Petrovics DESCRIPTIVE STATISTICS Definition: Descriptive statistics is concerned only with collecting and describing data Methods: - statistical tables and graphs - descriptive
Klaszterezés, 2. rész
Klaszterezés, 2. rész Csima Judit BME, VIK, Számítástudományi és Információelméleti Tanszék 208. április 6. Csima Judit Klaszterezés, 2. rész / 29 Hierarchikus klaszterezés egymásba ágyazott klasztereket
Számítógéppel irányított rendszerek elmélete. Gyakorlat - Mintavételezés, DT-LTI rendszermodellek
Számítógéppel irányított rendszerek elmélete Gyakorlat - Mintavételezés, DT-LTI rendszermodellek Hangos Katalin Villamosmérnöki és Információs Rendszerek Tanszék e-mail: hangos.katalin@virt.uni-pannon.hu
GEOGRAPHICAL ECONOMICS B
GEOGRAPHICAL ECONOMICS B ELTE Faculty of Social Sciences, Department of Economics Geographical Economics "B" KRUGMAN (1991) MODEL: EXTENSIONS Authors: Gábor Békés, Sarolta Rózsás Supervised by Gábor
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Correlation & Regression
Correlation & Regression Types of dependence association between nominal data mixed between a nominal and a ratio data correlation among ratio data Correlation describes the strength of a relationship,
University of Bristol - Explore Bristol Research
Al-Salihi, S. A. A., Scott, T. A., Bailey, A. M., & Foster, G. D. (2017). Improved vectors for Agrobacterium mediated genetic manipulation of Hypholoma spp. and other homobasidiomycetes. Journal of Microbiological
KIEGÉSZÍTŽ FELADATOK. Készlet Bud. Kap. Pápa Sopr. Veszp. Kecsk. 310 4 6 8 10 5 Pécs 260 6 4 5 6 3 Szomb. 280 9 5 4 3 5 Igény 220 200 80 180 160
KIEGÉSZÍTŽ FELADATOK (Szállítási probléma) Árut kell elszállítani három telephelyr l (Kecskemét, Pécs, Szombathely) öt területi raktárba, melyek Budapesten, Kaposváron, Pápán, Sopronban és Veszprémben
First experiences with Gd fuel assemblies in. Tamás Parkó, Botond Beliczai AER Symposium 2009.09.21 25.
First experiences with Gd fuel assemblies in the Paks NPP Tams Parkó, Botond Beliczai AER Symposium 2009.09.21 25. Introduction From 2006 we increased the heat power of our units by 8% For reaching this
SOFI State of the Future Index
SOFI State of the Future Index http://www.millenniumproject.org/millennium/sofi.html BARTHA ZOLTÁN, SZITA KLÁRA MTA IX.O. SJTB JTAB ÜLÉS 2015.02.13. Főbb kérdések Mit takar a SOFI Módszertan Eredmények
Can/be able to. Using Can in Present, Past, and Future. A Can jelen, múlt és jövő idejű használata
Can/ Can is one of the most commonly used modal verbs in English. It be used to express ability or opportunity, to request or offer permission, and to show possibility or impossibility. A az egyik leggyakrabban
ó Ú ő ó ó ó ö ó ó ő ö ó ö ö ő ö ó ö ö ö ö ó ó ó ó ó ö ó ó ó ó Ú ö ö ó ó Ú ú ó ó ö ó Ű ő ó ó ó ő ó ó ó ó ö ó ó ó ö ő ö ó ó ó Ú ó ó ö ó ö ó ö ő ó ó ó ó Ú ö ö ő ő ó ó ö ö ó ö ó ó ó ö ö ő ö Ú ó ó ó ü ú ú ű