Regularization of an autoconvolution problem in ultrashort laser pulse characterization
|
|
- Artúr Horváth
- 5 évvel ezelőtt
- Látták:
Átírás
1 Regularization of an autoconvolution problem in ultrashort laser pulse characterization D. Gerth a,b, B. Hofmann b, S. Birkholz c, S. Koke c, G. Steinmeyer c a Johannes Kepler University, Linz, Austria b Chemnitz University of Technology, Germany c Max Born Institute, Berlin, Germany Doctoral Program Computational Mathematics Numerical Analysis and Symbolic Computation Shanghai, Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 1 / 37
2 Introduction SD-SPIDER method Mathematical Analysis Discretization Regularization Numerical results Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 2 / 37
3 Introduction Overview Introduction SD-SPIDER method Mathematical Analysis Discretization Regularization Numerical results Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 2 / 37
4 Introduction Motivation Why study ultra-short laser pulses? to create shorter, stronger pulses; to enhance optical systems; medicine, material processing, etc. Problem: measurements limited by electronics (order 1 12 s) Development of pulse durations: Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 3 / 37
5 Introduction Motivation Why study ultra-short laser pulses? to create shorter, stronger pulses; to enhance optical systems; medicine, material processing, etc. Problem: measurements limited by electronics (order 1 12 s) Development of pulse durations: Solution: sample pulse by itself Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 3 / 37
6 Introduction Laser pulse representation Time domain: electric field E(t), envelope A(t), intensity I(t) = A(t) 2 a) A(t) b) FT A(ω) φ(ω) E(t) Fourier domain: amplitude A(ω), phase ϕ(ω), spectrum I(ω) = A(ω) 2 Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 4 / 37
7 SD-SPIDER method Overview Introduction SD-SPIDER method Mathematical Analysis Discretization Regularization Numerical results Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 4 / 37
8 SD-SPIDER method SD-SPIDER= Self-Defraction Spectral Phase Interferometry for Direct Electric-field Reconstruction Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 5 / 37
9 SD-SPIDER method SD-SPIDER= Self-Defraction Spectral Phase Interferometry for Direct Electric-field Reconstruction introduced by the research group Solid State Light Sources led by Dr. Günter Steinmeyer as subdivision of division C Nonlinear Processes in Condensed Matter at Max-Born-Institute for Nonlinear Optics and Short Pulse Spectroscopy, Berlin, Germany Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 5 / 37
10 SD-SPIDER method SD-SPIDER= Self-Defraction Spectral Phase Interferometry for Direct Electric-field Reconstruction introduced by the research group Solid State Light Sources led by Dr. Günter Steinmeyer as subdivision of division C Nonlinear Processes in Condensed Matter at Max-Born-Institute for Nonlinear Optics and Short Pulse Spectroscopy, Berlin, Germany theory presented at Conference on Lasers and Electro-Optics, 21 Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 5 / 37
11 SD-SPIDER method SD-SPIDER= Self-Defraction Spectral Phase Interferometry for Direct Electric-field Reconstruction introduced by the research group Solid State Light Sources led by Dr. Günter Steinmeyer as subdivision of division C Nonlinear Processes in Condensed Matter at Max-Born-Institute for Nonlinear Optics and Short Pulse Spectroscopy, Berlin, Germany theory presented at Conference on Lasers and Electro-Optics, 21 reasons for introduction: applicable for ultraviolet radiation, good signal strength because it uses third-order optical effects Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 5 / 37
12 SD-SPIDER method basics of nonlinear optics Polarization P caused by an electric field Ẽ, P (t) = ɛ [χ (1) Ẽ(t) + χ (2) Ẽ 2 (t) + χ (3) Ẽ 3 (t) +... ] may act as source of electromagnetic radiation: ( E) + n2 c 2 2 t E = µ 2 t P NL (E) Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 6 / 37
13 SD-SPIDER method basics of nonlinear optics Polarization P caused by an electric field Ẽ, P (t) = ɛ [χ (1) Ẽ(t) + χ (2) Ẽ 2 (t) + χ (3) Ẽ 3 (t) +... ] may act as source of electromagnetic radiation: ( E) + n2 c 2 2 t E = µ 2 t P NL (E) third-order term dominant: χ (3) -medium Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 6 / 37
14 SD-SPIDER method basics of nonlinear optics Polarization P caused by an electric field Ẽ, P (t) = ɛ [χ (1) Ẽ(t) + χ (2) Ẽ 2 (t) + χ (3) Ẽ 3 (t) +... ] may act as source of electromagnetic radiation: ( E) + n2 c 2 2 t E = µ 2 t P NL (E) third-order term dominant: χ (3) -medium Refraction index n and Kerr-effect: n(ω) = n + n 2 E(ω) 2, (each frequency is refracted slightly differently) Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 6 / 37
15 SD-SPIDER method χ (3) -media allow a four-wave mixing process Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 7 / 37
16 SD-SPIDER method Principle Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 8 / 37
17 SD-SPIDER method k-vector-diagram: k - k cw k cw X (3) k (-) SD k p k p k p (+) k SD k cw kcw k -k p k(ω SD, ω p, ω cw ) = k cw (ω cw ) + k p (ω p ) + k p (ω SD + ω cw ω p ) k SD (ω SD, ω cw, ω p ). Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 9 / 37
18 SD-SPIDER method k-vector-diagram: k - k cw k cw X (3) k (-) SD k p k p k p (+) k SD k cw kcw k -k p k(ω SD, ω p, ω cw ) = k cw (ω cw ) + k p (ω p ) + k p (ω SD + ω cw ω p ) k SD (ω SD, ω cw, ω p ). energy conservation ω p + ω p = ω SD + ω cw still holds Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 9 / 37
19 SD-SPIDER method The autoconvolution effect pulses considered as plane waves: cw p 2 p 1 Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 1 / 37
20 SD-SPIDER method The autoconvolution effect pulses considered as plane waves: cw p 2 p 1 interference pattern creates refractive index grating (Kerr-effect) Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 1 / 37
21 SD-SPIDER method The autoconvolution effect pulses considered as plane waves: cw p 2 p 1 interference pattern creates refractive index grating (Kerr-effect) a wave p 1 of each frequency creates an interference pattern with cw-wave Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 1 / 37
22 SD-SPIDER method The autoconvolution effect pulses considered as plane waves: cw p 2 p 1 interference pattern creates refractive index grating (Kerr-effect) a wave p 1 of each frequency creates an interference pattern with cw-wave at each pattern, photons p 2 of each frequency are refracted Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 1 / 37
23 SD-SPIDER method The autoconvolution effect pulses considered as plane waves: cw p 2 p 1 interference pattern creates refractive index grating (Kerr-effect) a wave p 1 of each frequency creates an interference pattern with cw-wave at each pattern, photons p 2 of each frequency are refracted SD-signal is sum of all combinations E p (ω p )E p (ω SD + ω cw ω p )E cw Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 1 / 37
24 SD-SPIDER method Equation in physical formulation E SD (ω SD ) = ω SD +ω cw K(ω SD, ω p )E p (ω p )E p (ω SD + ω cw ω p )dω p supp E p = [ω l p, ω u p ], supp E SD = [2ω l p ω cw, 2ω u p ω cw ], Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 11 / 37
25 SD-SPIDER method Equation in physical formulation E SD (ω SD ) = ω SD +ω cw K(ω SD, ω p )E p (ω p )E p (ω SD + ω cw ω p )dω p supp E p = [ω l p, ω u p ], supp E SD = [2ω l p ω cw, 2ω u p ω cw ], with kernel K(ω SD, ω p ) = µ cl 2 ω SD K continuous, complex valued n(ω SD ) χ(3) (ω SD, ω cw, ω p, ω SD + ω cw ω p ) E cw e i( k ξ ξ+ k ηη+ k ζ L 2 ) sinc( k ζ L 2 ) Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 11 / 37
26 SD-SPIDER method Equation in physical formulation E SD (ω SD ) = ω SD +ω cw K(ω SD, ω p )E p (ω p )E p (ω SD + ω cw ω p )dω p supp E p = [ω l p, ω u p ], supp E SD = [2ω l p ω cw, 2ω u p ω cw ], with kernel K(ω SD, ω p ) = µ cl 2 ω SD K continuous, complex valued unknown, so far neglected n(ω SD ) χ(3) (ω SD, ω cw, ω p, ω SD + ω cw ω p ) E cw e i( k ξ ξ+ k ηη+ k ζ L 2 ) sinc( k ζ L 2 ) Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 11 / 37
27 SD-SPIDER method mathematical formulation after transformation and renaming: s y(s) = F [x](s) = k(s, t)x(t)x(s t)dt y = F (x) t 1, s 2 Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 12 / 37
28 SD-SPIDER method mathematical formulation after transformation and renaming: y(s) = F [x](s) = s k(s, t)x(t)x(s t)dt y = F (x) t 1, s 2 x L 2 C [, 1], y L2 C [, 2], k L2 C ([, 2] [, 1]) Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 12 / 37
29 SD-SPIDER method mathematical formulation after transformation and renaming: y(s) = F [x](s) = s k(s, t)x(t)x(s t)dt y = F (x) t 1, s 2 x L 2 C [, 1], y L2 C [, 2], k L2 C ([, 2] [, 1]) fundamental pulse: x(t) = A(t)e iϕ(t) measured SD-pulse: y(s) = B(s)e iψ(s) available Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 12 / 37
30 SD-SPIDER method mathematical formulation after transformation and renaming: y(s) = F [x](s) = s k(s, t)x(t)x(s t)dt y = F (x) t 1, s 2 x L 2 C [, 1], y L2 C [, 2], k L2 C ([, 2] [, 1]) fundamental pulse: x(t) = A(t)e iϕ(t) measured SD-pulse: y(s) = B(s)e iψ(s) available, possibly available Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 12 / 37
31 SD-SPIDER method mathematical formulation after transformation and renaming: y(s) = F [x](s) = s k(s, t)x(t)x(s t)dt y = F (x) t 1, s 2 x L 2 C [, 1], y L2 C [, 2], k L2 C ([, 2] [, 1]) fundamental pulse: x(t) = A(t)e iϕ(t) measured SD-pulse: y(s) = B(s)e iψ(s) available, possibly available, unknown ϕ(t) = ϕ + t GD(τ)dτ Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 12 / 37
32 SD-SPIDER method Does B(s) provide important information? 4 Phase I 4 Phase II frequency (THz) frequency (THz) 5 convolved phase I 5 convolved phase II frequency (THz) frequency (THz) 1 convolved absolute values I 1 convolved absolute values II frequency (THz) frequency (THz) Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 13 / 37
33 SD-SPIDER method Does B(s) provide important information? 4 Phase I 4 Phase II frequency (THz) frequency (THz) 5 convolved phase I 5 convolved phase II frequency (THz) frequency (THz) 1 convolved absolute values I 1 convolved absolute values II frequency (THz) frequency (THz) Yes, it does! Thus also B(s) available as measurement. Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 13 / 37
34 SD-SPIDER method measurements (indicated by δ) close to correct data, but not exact A δ A, B δ B, ψ δ ψ as δ Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 14 / 37
35 SD-SPIDER method measurements (indicated by δ) close to correct data, but not exact A δ A, B δ B, ψ δ ψ as δ no information about size of error δ available Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 14 / 37
36 SD-SPIDER method measurements (indicated by δ) close to correct data, but not exact A δ A, B δ B, ψ δ ψ as δ no information about size of error δ available Statement of the problem: given A δ, B δ, ψ δ and k(s, t), find ϕ such that B δ (s)e iψδ (s) = s k(s, t)a δ (t)e iϕ(t) A δ (s t)e iϕ(s t) dt Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 14 / 37
37 Mathematical Analysis Overview Introduction SD-SPIDER method Mathematical Analysis Discretization Regularization Numerical results Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 14 / 37
38 Mathematical Analysis Ill-posedness F x = y, F : L 2 [, 1] L 2 [, 2] An operator F is called ill-posed, if it violates at least one of Hadamard s conditions: (a) for each given data y there exists a solution x (b) this solution is unique (c) the solution depends continuously on the data Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 15 / 37
39 Mathematical Analysis Ill-posedness F x = y, F : L 2 [, 1] L 2 [, 2] An operator F is called ill-posed, if it violates at least one of Hadamard s conditions: (a) for each given data y there exists a solution x (b) this solution is unique (c) the solution depends continuously on the data (a) violated because F (x) C C [, 2] x L 2 C [, 1] Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 15 / 37
40 Mathematical Analysis Injectivity for k(s, t) 1 and k(s, t) = k(s): F (x 1 ) = F (x 2 ) has two solutions x 1 = x 2 and x 1 = x 2 by Titchmarsh s theorem Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 16 / 37
41 Mathematical Analysis Injectivity for k(s, t) 1 and k(s, t) = k(s): F (x 1 ) = F (x 2 ) has two solutions x 1 = x 2 and x 1 = x 2 by Titchmarsh s theorem for k(s, t) again x 1 = x 2 or x 1 = x 2, additional solutions are an open problem. Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 16 / 37
42 Mathematical Analysis Injectivity for k(s, t) 1 and k(s, t) = k(s): F (x 1 ) = F (x 2 ) has two solutions x 1 = x 2 and x 1 = x 2 by Titchmarsh s theorem for k(s, t) again x 1 = x 2 or x 1 = x 2, additional solutions are an open problem. (b) is violated too! Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 16 / 37
43 Mathematical Analysis Injectivity for k(s, t) 1 and k(s, t) = k(s): F (x 1 ) = F (x 2 ) has two solutions x 1 = x 2 and x 1 = x 2 by Titchmarsh s theorem for k(s, t) again x 1 = x 2 or x 1 = x 2, additional solutions are an open problem. (b) is violated too! but since x 1 = Ae iϕ, x 1 = x 2 means x 2 = Ae i(ϕ π) and both solutions are equivalent for our problem. Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 16 / 37
44 Mathematical Analysis Injectivity for k(s, t) 1 and k(s, t) = k(s): F (x 1 ) = F (x 2 ) has two solutions x 1 = x 2 and x 1 = x 2 by Titchmarsh s theorem for k(s, t) again x 1 = x 2 or x 1 = x 2, additional solutions are an open problem. (b) is violated too! but since x 1 = Ae iϕ, x 1 = x 2 means x 2 = Ae i(ϕ π) and both solutions are equivalent for our problem. because of periodicity, ϕ ϕ + 2π Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 16 / 37
45 Mathematical Analysis (local) ill-posedness for the autoconvolution operator, compactness can not be proven in general nonlinear operator requires local analysis Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 17 / 37
46 Mathematical Analysis (local) ill-posedness for the autoconvolution operator, compactness can not be proven in general nonlinear operator requires local analysis Definition We define an operator F, F : X Y to be locally ill-posed in x X if, for arbitrarily small ρ > there exists a sequence {x n } B ρ (x ) X satisfying the condition F(x n ) F(x ) in Y as n, but x n x in X. Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 17 / 37
47 Mathematical Analysis (local) ill-posedness for the autoconvolution operator, compactness can not be proven in general nonlinear operator requires local analysis Definition We define an operator F, F : X Y to be locally ill-posed in x X if, for arbitrarily small ρ > there exists a sequence {x n } B ρ (x ) X satisfying the condition F(x n ) F(x ) in Y as n, but x n x in X. Theorem (Gorenflo & Hofmann 94, adapted in Gerth 11) The autoconvolution operator F is everywhere locally ill-posed. (c) is violated too! Regularization is necessary. Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 17 / 37
48 Mathematical Analysis Fréchet-derivative The Fréchet-derivative of F in a point x is given by s [F (x )h](s) = (k(s, t) + k(s, s t))x (s t)h(t)dt Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 18 / 37
49 Mathematical Analysis Fréchet-derivative The Fréchet-derivative of F in a point x is given by s [F (x )h](s) = (k(s, t) + k(s, s t))x (s t)h(t)dt although F is in general non-compact, F is always compact! Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 18 / 37
50 Discretization Overview Introduction SD-SPIDER method Mathematical Analysis Discretization Regularization Numerical results Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 18 / 37
51 Discretization equation: y(s) = s k(s, t)x(s t)x(t)dt supp x = [t l, t u ], supp y = [2t l t cw, 2t u t cw ] Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 19 / 37
52 Discretization equation: y(s) = s k(s, t)x(s t)x(t)dt supp x = [t l, t u ], supp y = [2t l t cw, 2t u t cw ] discretization using rectangular rule y(s m ) = N k(s m, t j )x(s m + t cw t j )x(t j ) t j=1 with t = tu t l N 1, t j = t l + (j 1) t, s m = 2t j + (m 1) t y m := y(s m ), x n := x(t n ), k m,n := k(s m, t n ) Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 19 / 37
53 Discretization in matrix-form y = F (x)x, with Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 2 / 37
54 Discretization in matrix-form y = F (x)x, with y/ t = F x/ t = k 1,1 x 1... k 2,1 x 2 k 2,2 x k N 1,1 x N 1 k N 1,2 x N 2... k N 1,N 1 x 1 k N,1 x N k N,2 x N 1... k N,N 1 x 2 k N,N x 1 k N+1,1 x N... k N+1,N 1 x 3 k N+1,N 1 x k 2N 2,N 1 x N k 2N 2,N x N 1... k 2N 1,N x N x 1 x 2. x N 1 x N Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 2 / 37
55 Discretization in matrix-form y = F (x)x, with y/ t = F x/ t = k 1,1 x 1... k 2,1 x 2 k 2,2 x k N 1,1 x N 1 k N 1,2 x N 2... k N 1,N 1 x 1 k N,1 x N k N,2 x N 1... k N,N 1 x 2 k N,N x 1 k N+1,1 x N... k N+1,N 1 x 3 k N+1,N 1 x k 2N 2,N 1 x N k 2N 2,N x N 1... k 2N 1,N x N Decomposition, with as element-by-element multiplication: F = K X x 1 x 2. x N 1 x N Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 2 / 37
56 Discretization analogously: Fréchet-derivative N [F (x )h] m = (k(s m, t j )+k(s m, s m +t cw t j ))x (s m +t cw t j )h(t j ) t j=1 Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 21 / 37
57 Discretization analogously: Fréchet-derivative N [F (x )h] m = (k(s m, t j )+k(s m, s m +t cw t j ))x (s m +t cw t j )h(t j ) t j=1 resulting matrix F (x ) = (K + K ) X Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 21 / 37
58 Discretization analogously: Fréchet-derivative [F (x )h] m = N (k(s m, t j )+k(s m, s m +t cw t j ))x (s m +t cw t j )h(t j ) t j=1 resulting matrix F (x ) = (K + K ) X advantage: time-consuming calculation of the matrices K and K has to be performed only once for each measurement setup Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 21 / 37
59 Regularization Overview Introduction SD-SPIDER method Mathematical Analysis Discretization Regularization Numerical results Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 21 / 37
60 Regularization A Levenberg-Marquardt-Type approach we let the complete pulse x be unknown, whereas y is given Iteration rule: 1 x δ (l+1) := xδ (l) (F +γ (x δ (l) ) F (x δ (l) L) ) + αl F (x δ (l) ) (y δ F (x δ (l) ) for l =,..., l, aimed at minimizing y δ F (x (l) ) F (x (l) )(x x (l) ) 2 + α L(x x (l) ) 2, L(x) approximating the second derivative of x Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 22 / 37
61 Regularization A Levenberg-Marquardt-Type approach we let the complete pulse x be unknown, whereas y is given Iteration rule: x δ (l+1) := xδ (l) +γ (F (x δ (l) ) F (x δ (l) ) + αl L) 1 F (x δ (l) ) (y δ F (x δ (l) ) for l =,..., l, aimed at minimizing y δ F (x (l) ) F (x (l) )(x x (l) ) 2 + α L(x x (l) ) 2, L(x) approximating the second derivative of x Questions: how to choose x? how to choose l? how to choose α? Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 22 / 37
62 Regularization Choice of x = A e iϕ obviously, A := A δ first idea for phase: ϕ (t) x 1 28 Spectr. Pow. Dens. ( x(t) ) original pulse starting phase reconstructed pulse phase (arg(x(t))) Frequency (THz) (δ =, α = ) Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 23 / 37
63 Regularization idea: calculate good guess. Observe B δ (s)e iψδ (s) = s k(s, t) A δ (t)a δ (s t)e i(ϕ(t)+ϕ(s t)+φ kernel) dt set ϕ (t) = 1 2 (P s t(ψ(s))) φ kernel (s, t) for s fixed Spectr. Pow. Dens. ( x(t) ) 1.2 x original pulse starting phase reconstructed pulse phase (arg(x(t))) Frequency (THz) Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 24 / 37
64 Regularization problem for slightly changed fundamental phase phase (arg(x(t))) Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 25 / 37
65 Regularization best result with kernel correction Spectr. Pow. Dens. ( x(t) ) 2.5 x original pulse starting phase reconstructed pulse phase (arg(x(t))) Frequency (THz) Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 26 / 37
66 Regularization best result with kernel correction Spectr. Pow. Dens. ( x(t) ) 2.5 x original pulse starting phase reconstructed pulse phase (arg(x(t))) Frequency (THz) set starting phase to constant zero Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 26 / 37
67 Regularization When to stop the iteration? An example iteration: (l) F (x δ (l) ) yδ x δ (l) Aδ e e e e e e e e e e e-4.22 Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 27 / 37
68 Regularization When to stop the iteration? An example iteration: (l) F (x δ (l) ) yδ x δ (l) Aδ e e e e e e e e e e e-4.22 choose l such that x δ (l) Aδ is minimal Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 27 / 37
69 Regularization Choice of α no a-priori information y y δ < δ available, thus a-posteriori methods necessary Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 28 / 37
70 Regularization Choice of α no a-priori information y y δ < δ available, thus a-posteriori methods necessary calculate solutions for various α, e.g. α n = α q n, < q < 1, n =,..., n max and take best solution Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 28 / 37
71 Regularization Choice of α no a-priori information y y δ < δ available, thus a-posteriori methods necessary calculate solutions for various α, e.g. α n = α q n, < q < 1, n =,..., n max and take best solution L-curve not applicable, quasioptimality ( x αi+1 x αi min) failed Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 28 / 37
72 Regularization Choice of α no a-priori information y y δ < δ available, thus a-posteriori methods necessary calculate solutions for various α, e.g. α n = α q n, < q < 1, n =,..., n max and take best solution L-curve not applicable, quasioptimality ( x αi+1 x αi min) failed instead, make use of A δ again: choose α such that x δ α Aδ = min n x δ α n A δ Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 28 / 37
73 Numerical results Overview Introduction SD-SPIDER method Mathematical Analysis Discretization Regularization Numerical results Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 28 / 37
74 Numerical results A very smooth fundamental pulse 1.4 x 1 7 absolute values 6 phase frequency (THz) frequency (THz) Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 29 / 37
75 Numerical results SD-pulse, 5% relative noise added 2.5 x 114 absolute values 12 phase frequency (THz) frequency (THz) Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 3 / 37
76 Numerical results reconstruction, α = x absolute values original reconstructed 6 5 phase original reconstructed frequency (THz) frequency (THz) Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 31 / 37
77 Numerical results A more oscillating pulse 1.4 x 1 7 absolute values 8 phase frequency (THz) frequency (THz) Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 32 / 37
78 Numerical results noise-free SD-pulse 12 x 113 absolute values 1 phase frequency (THz) frequency (THz) Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 33 / 37
79 Numerical results reconstruction, α = x 1 7 absolute values 1.2 original reconstructed 8 6 phase original reconstructed frequency (THz) frequency (THz) Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 34 / 37
80 Numerical results reconstruction, 1% relative noise in data 1.4 x 1 7 absolute values 1.2 original reconstructed 8 6 phase original reconstructed frequency (THz) frequency (THz) Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 35 / 37
81 Numerical results Real data situation unfortunately, no results available. Main reasons: measurements without magnitudes unknown factor in model error in the model frequency domains of x and y do not match Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 36 / 37
82 Numerical results D. Gerth, B. Hofmann, S. Birkholz, S. Koke, and G. Steinmeyer Regularization of an autoconvolution problem in ultrashort laser pulse characterization, submitted D. Gerth, Regularization of an autoconvolution problem occurring in measurements of ultra-short laser pulses, Diploma thesis, Chemnitz University of Technology, Chemnitz, 211, R. Gorenflo, B. Hofmann, On autoconvolution and regularization, Inverse Problems 1 (1994), pp S. Koke, S. Birkholz, J. Bethge, C. Grebing, G. Steinmeyer, Self-diffraction SPIDER, Conference on Laser and Electro Optics (CLEO), San Jose, CA, 28. Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 37 / 37
83 Numerical results D. Gerth, B. Hofmann, S. Birkholz, S. Koke, and G. Steinmeyer Regularization of an autoconvolution problem in ultrashort laser pulse characterization, submitted D. Gerth, Regularization of an autoconvolution problem occurring in measurements of ultra-short laser pulses, Diploma thesis, Chemnitz University of Technology, Chemnitz, 211, R. Gorenflo, B. Hofmann, On autoconvolution and regularization, Inverse Problems 1 (1994), pp S. Koke, S. Birkholz, J. Bethge, C. Grebing, G. Steinmeyer, Self-diffraction SPIDER, Conference on Laser and Electro Optics (CLEO), San Jose, CA, 28. Thank you for your attention! Are there any questions? Gerth, Hofmann, Birkholz, Koke, Steinmeyer JKU/TUC/MBI 37 / 37
Ensemble Kalman Filters Part 1: The basics
Ensemble Kalman Filters Part 1: The basics Peter Jan van Leeuwen Data Assimilation Research Centre DARC University of Reading p.j.vanleeuwen@reading.ac.uk Model: 10 9 unknowns P[u(x1),u(x2),T(x3),.. Observations:
On The Number Of Slim Semimodular Lattices
On The Number Of Slim Semimodular Lattices Gábor Czédli, Tamás Dékány, László Ozsvárt, Nóra Szakács, Balázs Udvari Bolyai Institute, University of Szeged Conference on Universal Algebra and Lattice Theory
Statistical Inference
Petra Petrovics Statistical Inference 1 st lecture Descriptive Statistics Inferential - it is concerned only with collecting and describing data Population - it is used when tentative conclusions about
Phenotype. Genotype. It is like any other experiment! What is a bioinformatics experiment? Remember the Goal. Infectious Disease Paradigm
It is like any other experiment! What is a bioinformatics experiment? You need to know your data/input sources You need to understand your methods and their assumptions You need a plan to get from point
THE CHARACTERISTICS OF SOUNDS ANALYSIS AND SYNTHESIS OF SOUNDS
THE CHARACTERISTICS OF SOUNDS ANALYSIS AND SYNTHESIS OF SOUNDS Study aid for learning of Communication Acoustics VIHIA 000 2017. szeptember 27., Budapest Fülöp Augusztinovicz professor BME Dept. of Networked
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2008. május 26. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2008. május 26. 8:00 Az írásbeli vizsga időtartama: 180 perc Pótlapok száma Tisztázati Piszkozati OKTATÁSI
Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz
Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz Kvantumkapuk, áramkörök 2016. március 3. A kvantummechanika posztulátumai (1-2) 1. Állapotleírás Zárt fizikai rendszer aktuális állapota
Számítógéppel irányított rendszerek elmélete. Gyakorlat - Mintavételezés, DT-LTI rendszermodellek
Számítógéppel irányított rendszerek elmélete Gyakorlat - Mintavételezés, DT-LTI rendszermodellek Hangos Katalin Villamosmérnöki és Információs Rendszerek Tanszék e-mail: hangos.katalin@virt.uni-pannon.hu
Construction of a cube given with its centre and a sideline
Transformation of a plane of projection Construction of a cube given with its centre and a sideline Exercise. Given the center O and a sideline e of a cube, where e is a vertical line. Construct the projections
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel Timea Farkas Click here if your download doesn"t start
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Hypothesis Testing. Petra Petrovics.
Hypothesis Testing Petra Petrovics PhD Student Inference from the Sample to the Population Estimation Hypothesis Testing Estimation: how can we determine the value of an unknown parameter of a population
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Correlation & Linear. Petra Petrovics.
Correlation & Linear Regression in SPSS Petra Petrovics PhD Student Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise
STUDENT LOGBOOK. 1 week general practice course for the 6 th year medical students SEMMELWEIS EGYETEM. Name of the student:
STUDENT LOGBOOK 1 week general practice course for the 6 th year medical students Name of the student: Dates of the practice course: Name of the tutor: Address of the family practice: Tel: Please read
Correlation & Linear Regression in SPSS
Correlation & Linear Regression in SPSS Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise 1 - Correlation File / Open
Kvantum-informatika és kommunikáció 2015/2016 ősz. A kvantuminformatika jelölésrendszere szeptember 11.
Kvantum-informatika és kommunikáció 2015/2016 ősz A kvantuminformatika jelölésrendszere 2015. szeptember 11. Mi lehet kvantumbit? Kvantum eszközök (1) 15=5 3 Bacsárdi Képek forrása: IBM's László, Almaden
Correlation & Linear Regression in SPSS
Petra Petrovics Correlation & Linear Regression in SPSS 4 th seminar Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Correlation
Supporting Information
Supporting Information Cell-free GFP simulations Cell-free simulations of degfp production were consistent with experimental measurements (Fig. S1). Dual emmission GFP was produced under a P70a promoter
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Factor Analysis
Factor Analysis Factor analysis is a multiple statistical method, which analyzes the correlation relation between data, and it is for data reduction, dimension reduction and to explore the structure. Aim
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 200. május 4. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 200. május 4. 8:00 Az írásbeli vizsga időtartama: 80 perc Pótlapok száma Tisztázati Piszkozati OKTATÁSI
Unification of functional renormalization group equations
Unification of functional renormalization group equations István Nándori MTA-DE Részecsefiziai Kutatócsoport, MTA-Atomi, Debrecen MTA-DE Részecsefiziai Kutatócsoport és a ATOMKI Rács-QCD Lendület Kutatócsoport
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2011. május 13. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2011. május 13. 8:00 Az írásbeli vizsga időtartama: 180 perc Pótlapok száma Tisztázati Piszkozati NEMZETI
Széchenyi István Egyetem www.sze.hu/~herno
Oldal: 1/6 A feladat során megismerkedünk a C# és a LabVIEW összekapcsolásának egy lehetőségével, pontosabban nagyon egyszerű C#- ban írt kódból fordítunk DLL-t, amit meghívunk LabVIEW-ból. Az eljárás
Az NMR és a bizonytalansági elv rejtélyes találkozása
Az NMR és a bizonytalansági elv rejtélyes találkozása ifj. Szántay Csaba MTA Kémiai Tudományok Osztálya 2012. február 21. a magspínek pulzus-gerjesztésének értelmezési paradigmája GLOBÁLISAN ELTERJEDT
Local fluctuations of critical Mandelbrot cascades. Konrad Kolesko
Local fluctuations of critical Mandelbrot cascades Konrad Kolesko joint with D. Buraczewski and P. Dyszewski Warwick, 18-22 May, 2015 Random measures µ µ 1 µ 2 For given random variables X 1, X 2 s.t.
A évi fizikai Nobel-díj
A 2012. évi fizikai Nobel-díj "for ground-breaking experimental methods that enable measuring and manipulation of individual quantum systems" Serge Haroche David Wineland Ecole Normale Superieure, Párizs
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében. Dicse Jenő üzletfejlesztési igazgató
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében Dicse Jenő üzletfejlesztési igazgató How to apply modern e-learning to improve the training of firefighters Jenő Dicse Director of
EN United in diversity EN A8-0206/419. Amendment
22.3.2019 A8-0206/419 419 Article 2 paragraph 4 point a point i (i) the identity of the road transport operator; (i) the identity of the road transport operator by means of its intra-community tax identification
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN FOUNDATIONS IN ELECTRONICS
ÉRETTSÉGI VIZSGA 2007. május 25. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN FOUNDATIONS IN ELECTRONICS 2007. május 25. 8:00 KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA STANDARD-LEVEL WRITTEN EXAM Az írásbeli vizsga időtartama:
Cloud computing. Cloud computing. Dr. Bakonyi Péter.
Cloud computing Cloud computing Dr. Bakonyi Péter. 1/24/2011 1/24/2011 Cloud computing 2 Cloud definició A cloud vagy felhő egy platform vagy infrastruktúra Az alkalmazások és szolgáltatások végrehajtására
3. MINTAFELADATSOR KÖZÉPSZINT. Az írásbeli vizsga időtartama: 30 perc. III. Hallott szöveg értése
Oktatáskutató és Fejlesztő Intézet TÁMOP-3.1.1-11/1-2012-0001 XXI. századi közoktatás (fejlesztés, koordináció) II. szakasz ANGOL NYELV 3. MINTAFELADATSOR KÖZÉPSZINT Az írásbeli vizsga időtartama: 30 perc
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2013. május 23. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2013. május 23. 8:00 Az írásbeli vizsga időtartama: 180 perc Pótlapok száma Tisztázati Piszkozati EMBERI
Performance Modeling of Intelligent Car Parking Systems
Performance Modeling of Intelligent Car Parking Systems Károly Farkas Gábor Horváth András Mészáros Miklós Telek Technical University of Budapest, Hungary EPEW 2014, Florence, Italy Outline Intelligent
Utasítások. Üzembe helyezés
HASZNÁLATI ÚTMUTATÓ Üzembe helyezés Utasítások Windows XP / Vista / Windows 7 / Windows 8 rendszerben történő telepítéshez 1 Töltse le az AORUS makróalkalmazás telepítőjét az AORUS hivatalos webhelyéről.
Using the CW-Net in a user defined IP network
Using the CW-Net in a user defined IP network Data transmission and device control through IP platform CW-Net Basically, CableWorld's CW-Net operates in the 10.123.13.xxx IP address range. User Defined
KELER KSZF Zrt. bankgarancia-befogadási kondíciói. Hatályos: 2014. július 8.
KELER KSZF Zrt. bankgarancia-befogadási kondíciói Hatályos: 2014. július 8. A KELER KSZF a nem-pénzügyi klíringtagjaitól, és az energiapiaci alklíringtagjaitól a KELER KSZF Általános Üzletszabályzata szerinti
Professional competence, autonomy and their effects
ENIRDELM 2014, Vantaa Professional competence, autonomy and their effects Mária Szabó szabo.maria@ofi.hu www.of.hu The aim and the planned activities at this workshop Aim: To take a European survey on
A logaritmikus legkisebb négyzetek módszerének karakterizációi
A logaritmikus legkisebb négyzetek módszerének karakterizációi Csató László laszlo.csato@uni-corvinus.hu MTA Számítástechnikai és Automatizálási Kutatóintézet (MTA SZTAKI) Operációkutatás és Döntési Rendszerek
Csima Judit április 9.
Osztályozókról még pár dolog Csima Judit BME, VIK, Számítástudományi és Információelméleti Tanszék 2018. április 9. Csima Judit Osztályozókról még pár dolog 1 / 19 SVM (support vector machine) ez is egy
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Nonparametric Tests
Nonparametric Tests Petra Petrovics Hypothesis Testing Parametric Tests Mean of a population Population proportion Population Standard Deviation Nonparametric Tests Test for Independence Analysis of Variance
Rezgésdiagnosztika. Diagnosztika 02 --- 1
Rezgésdiagnosztika Diagnosztika 02 --- 1 Diagnosztika 02 --- 2 A rezgéskép elemzésével kimutatható gépészeti problémák Minden gép, mely tartalmaz forgó részt (pl. motor, generátor, szivattyú, ventilátor,
7 th Iron Smelting Symposium 2010, Holland
7 th Iron Smelting Symposium 2010, Holland Október 13-17 között került megrendezésre a Hollandiai Alphen aan den Rijn városában található Archeon Skanzenben a 7. Vasolvasztó Szimpózium. Az öt napos rendezvényen
NYOMÁSOS ÖNTÉS KÖZBEN ÉBREDŐ NYOMÁSVISZONYOK MÉRÉTECHNOLÓGIAI TERVEZÉSE DEVELOPMENT OF CAVITY PRESSURE MEASUREMENT FOR HIGH PRESURE DIE CASTING
Anyagmérnöki Tudományok, 39/1 (2016) pp. 82 86. NYOMÁSOS ÖNTÉS KÖZBEN ÉBREDŐ NYOMÁSVISZONYOK MÉRÉTECHNOLÓGIAI TERVEZÉSE DEVELOPMENT OF CAVITY PRESSURE MEASUREMENT FOR HIGH PRESURE DIE CASTING LEDNICZKY
Dependency preservation
Adatbázis-kezelés. (4 előadás: Relácó felbontásai (dekomponálás)) 1 Getting lossless decomposition is necessary. But of course, we also want to keep dependencies, since losing a dependency means, that
Cloud computing Dr. Bakonyi Péter.
Cloud computing Dr. Bakonyi Péter. 1/24/2011 Cloud computing 1/24/2011 Cloud computing 2 Cloud definició A cloud vagy felhő egy platform vagy infrastruktúra Az alkalmazások és szolgáltatások végrehajtására
Cluster Analysis. Potyó László
Cluster Analysis Potyó László What is Cluster Analysis? Cluster: a collection of data objects Similar to one another within the same cluster Dissimilar to the objects in other clusters Cluster analysis
Computer Architecture
Computer Architecture Locality-aware programming 2016. április 27. Budapest Gábor Horváth associate professor BUTE Department of Telecommunications ghorvath@hit.bme.hu Számítógép Architektúrák Horváth
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2012. május 25. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2012. május 25. 8:00 Az írásbeli vizsga időtartama: 180 perc Pótlapok száma Tisztázati Piszkozati NEMZETI
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2015. május 19. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2015. május 19. 8:00 Az írásbeli vizsga időtartama: 180 perc Pótlapok száma Tisztázati Piszkozati EMBERI
ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP
ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP CHILD S DATA / GYERMEK ADATAI PLEASE FILL IN THIS INFORMATION WITH DATA BASED ON OFFICIAL DOCUMENTS / KÉRJÜK, TÖLTSE KI A HIVATALOS DOKUMENTUMOKBAN SZEREPLŐ ADATOK
Genome 373: Hidden Markov Models I. Doug Fowler
Genome 373: Hidden Markov Models I Doug Fowler Review From Gene Prediction I transcriptional start site G open reading frame transcriptional termination site promoter 5 untranslated region 3 untranslated
IBM Brings Quantum Computing to the Cloud
IBM Brings Quantum Computing to the Cloud https://www.youtube.com/watch?v=dz2dcilzabm&feature=y outu.be 2016.05.05. 1 Ismétlés The problem Each unitary transform having eigenvector has eigenvalues in the
Supplementary Table 1. Cystometric parameters in sham-operated wild type and Trpv4 -/- rats during saline infusion and
WT sham Trpv4 -/- sham Saline 10µM GSK1016709A P value Saline 10µM GSK1016709A P value Number 10 10 8 8 Intercontractile interval (sec) 143 (102 155) 98.4 (71.4 148) 0.01 96 (92 121) 109 (95 123) 0.3 Voided
First experiences with Gd fuel assemblies in. Tamás Parkó, Botond Beliczai AER Symposium 2009.09.21 25.
First experiences with Gd fuel assemblies in the Paks NPP Tams Parkó, Botond Beliczai AER Symposium 2009.09.21 25. Introduction From 2006 we increased the heat power of our units by 8% For reaching this
Tudományos Ismeretterjesztő Társulat
Sample letter number 5. International Culture Festival PO Box 34467 Harrogate HG 45 67F Sonnenbergstraße 11a CH-6005 Luzern Re: Festival May 19, 2009 Dear Ms Atkinson, We are two students from Switzerland
FOSS4G-CEE Prágra, 2012 május. Márta Gergely Sándor Csaba
FOSS4G-CEE Prágra, 2012 május Márta Gergely Sándor Csaba Reklám helye 2009 óta Intergraph szoftverek felől jöttünk FOSS4G felé megyünk Békés egymás mellett élés több helyen: Geoshop.hu Terkep.torokbalint.hu
USER MANUAL Guest user
USER MANUAL Guest user 1 Welcome in Kutatótér (Researchroom) Top menu 1. Click on it and the left side menu will pop up 2. With the slider you can make left side menu visible 3. Font side: enlarging font
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY A feladatsor három részbol áll 1. A vizsgáztató társalgást kezdeményez a vizsgázóval. 2. A vizsgázó egy szituációs feladatban vesz részt a
Tudományos Ismeretterjesztő Társulat
Sample letter number 3. Russell Ltd. 57b Great Hawthorne Industrial Estate Hull East Yorkshire HU 19 5BV 14 Bebek u. Budapest H-1105 10 December, 2009 Ref.: complaint Dear Sir/Madam, After seeing your
Intézményi IKI Gazdasági Nyelvi Vizsga
Intézményi IKI Gazdasági Nyelvi Vizsga Név:... Születési hely:... Születési dátum (év/hó/nap):... Nyelv: Angol Fok: Alapfok 1. Feladat: Olvasáskészséget mérő feladat 20 pont Olvassa el a szöveget és válaszoljon
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Nonparametric Tests. Petra Petrovics.
Nonparametric Tests Petra Petrovics PhD Student Hypothesis Testing Parametric Tests Mean o a population Population proportion Population Standard Deviation Nonparametric Tests Test or Independence Analysis
Az Open Data jogi háttere. Dr. Telek Eszter
Az Open Data jogi háttere Dr. Telek Eszter Egy kis ismétlés Open Data/Open Access/Open Knowledge gyökerei Open Source Software FLOSS (Free Libre Open Source Software) Szoftver esetében egyszerű alapok:
Searching in an Unsorted Database
Searching in an Unsorted Database "Man - a being in search of meaning." Plato History of data base searching v1 2018.04.20. 2 History of data base searching v2 2018.04.20. 3 History of data base searching
General information for the participants of the GTG Budapest, 2017 meeting
General information for the participants of the GTG Budapest, 2017 meeting Currency is Hungarian Forint (HUF). 1 EUR 310 HUF, 1000 HUF 3.20 EUR. Climate is continental, which means cold and dry in February
Számítógéppel irányított rendszerek elmélete. A rendszer- és irányításelmélet legfontosabb részterületei. Hangos Katalin. Budapest
CCS-10 p. 1/1 Számítógéppel irányított rendszerek elmélete A rendszer- és irányításelmélet legfontosabb részterületei Hangos Katalin Villamosmérnöki és Információs Rendszerek Tanszék Folyamatirányítási
Bevezetés a kvantuminformatikába. kommunikációba 2015 tavasz. Első lépések a kvantuminformatikában február 19.
Bevezetés a kvantuminformatikába és kommunikációba 2015 tavasz Első lépések a kvantuminformatikában 2015. február 19. Mi lehet kvantumbit? Kvantum eszközök (1) 15=5 3 Bacsárdi Képek forrása: IBM's László,
The problem. Each unitary transform having eigenvector has eigenvalues in the form of. Phase ratio:
Ismétlés The problem Each unitary transform having eigenvector has eigenvalues in the form of. Phase ratio: How to initialize? Quantum Phase Estimator Prob. amplitudes 2017.04.27. 5 Brutális! A H kapuk
- eqµah ³. -ry³eblbmebjkargar³
: : krmgsmnyrsmöasemxum eyig TaMgGs;Kña CanisSitmkBIsaklviTüayl½yebolR)aysaxaextþesomrab kmbugsiksa RsavRCavGMBI RbFanbT kargpivdæskáanubletscrn_enaxumkmbg;xøamg smrab;sarnabba b;fñak; bribaøab½rt CMnaj
Nonrelativistic, non-newtonian gravity
Nonrelativistic, non-newtonian gravity Dieter Van den Bleeken Bog azic i University based on arxiv:1512.03799 and work in progress with C ag ın Yunus IPM Tehran 27th May 2016 Nonrelativistic, non-newtonian
Contact us Toll free (800) fax (800)
Table of Contents Thank you for purchasing our product, your business is greatly appreciated. If you have any questions, comments, or concerns with the product you received please contact the factory.
ACO burkolható fedlapok. ACO műszaki katalógus ACO Burkolható fedlapok UNIFACE PAVING SOLID
ACO burkolható fedlapok ACO burkolható fedlapok ACO műszaki katalógus ACO Burkolható fedlapok UNIFACE PAVING SOLID ACO gully Tartalom Általános információk 3 page ACO Uniface ACO UNIFACE burkolható fedlap
Effect of the different parameters to the surface roughness in freeform surface milling
19 November 0, Budapest Effect of the different parameters to the surface roughness in freeform surface milling Balázs MIKÓ Óbuda University 1 Abstract Effect of the different parameters to the surface
Eladni könnyedén? Oracle Sales Cloud. Horváth Tünde Principal Sales Consultant 2014. március 23.
Eladni könnyedén? Oracle Sales Cloud Horváth Tünde Principal Sales Consultant 2014. március 23. Oracle Confidential Internal/Restricted/Highly Restricted Safe Harbor Statement The following is intended
Statistical Dependence
Statistical Dependence Petra Petrovics Statistical Dependence Deinition: Statistical dependence exists when the value o some variable is dependent upon or aected by the value o some other variable. Independent
Mapping Sequencing Reads to a Reference Genome
Mapping Sequencing Reads to a Reference Genome High Throughput Sequencing RN Example applications: Sequencing a genome (DN) Sequencing a transcriptome and gene expression studies (RN) ChIP (chromatin immunoprecipitation)
VALÓS HULLÁMFRONT ELŐÁLLÍTÁSA A SZÁMÍTÓGÉPES ÉS A DIGITÁLIS HOLOGRÁFIÁBAN PhD tézisfüzet
VALÓS HULLÁMFRONT ELŐÁLLÍTÁSA A SZÁMÍTÓGÉPES ÉS A DIGITÁLIS HOLOGRÁFIÁBAN PhD tézisfüzet PAPP ZSOLT Budapesti Műszaki és Gazdaságtudományi Egyetem Fizika Tanszék 2003 1 Bevezetés A lézerek megjelenését
16F628A megszakítás kezelése
16F628A megszakítás kezelése A 'megszakítás' azt jelenti, hogy a program normális, szekvenciális futása valamilyen külső hatás miatt átmenetileg felfüggesztődik, és a vezérlést egy külön rutin, a megszakításkezelő
Cashback 2015 Deposit Promotion teljes szabályzat
Cashback 2015 Deposit Promotion teljes szabályzat 1. Definitions 1. Definíciók: a) Account Client s trading account or any other accounts and/or registers maintained for Számla Az ügyfél kereskedési számlája
Create & validate a signature
IOTA TUTORIAL 7 Create & validate a signature v.0.0 KNBJDBIRYCUGVWMSKPVA9KOOGKKIRCBYHLMUTLGGAV9LIIPZSBGIENVBQ9NBQWXOXQSJRIRBHYJ9LCTJLISGGBRFRTTWD ABBYUVKPYFDJWTFLICYQQWQVDPCAKNVMSQERSYDPSSXPCZLVKWYKYZMREAEYZOSPWEJLHHFPYGSNSUYRZXANDNQTTLLZA
Néhány folyóiratkereső rendszer felsorolása és példa segítségével vázlatos bemutatása Sasvári Péter
Néhány folyóiratkereső rendszer felsorolása és példa segítségével vázlatos bemutatása Sasvári Péter DOI: http://doi.org/10.13140/rg.2.2.28994.22721 A tudományos közlemények írása minden szakma művelésének
Tulajdonságalapú tesztelés
Tulajdonságalapú tesztelés QuickCheck A QuickCheck Haskell programok automatikus, tulajdonságalapú tesztelésére használható. Programspecifikáció: program által teljesítendő tulajdonságok Nagy számú, a
Bevezetés a kvantum-informatikába és kommunikációba 2016/2017 tavasz
Bevezetés a kvantum-informatikába és kommunikációba 2016/2017 tavasz Kvantumkapuk, áramkörök 2017. február 23. A kvantummechanika Posztulátumai, avagy, ahogy az apró dolgok működnek 1. Posztulátum: kvantum
Klaszterezés, 2. rész
Klaszterezés, 2. rész Csima Judit BME, VIK, Számítástudományi és Információelméleti Tanszék 208. április 6. Csima Judit Klaszterezés, 2. rész / 29 Hierarchikus klaszterezés egymásba ágyazott klasztereket
TRENDnetVIEW Pro szoftvert. ŸGyors telepítési útmutató (1)
TRENDnetVIEW Pro szoftvert ŸGyors telepítési útmutató (1) TRENDnetVIEW Pro/05.29.2014 Tartalomjegyzék TRENDnetVIEW Pro Management Software követelmények... 13 TRENDnetVIEW Pro Telepítése... 14 Videokamerák
(c) 2004 F. Estrada & A. Jepson & D. Fleet Canny Edges Tutorial: Oct. 4, '03 Canny Edges Tutorial References: ffl imagetutorial.m ffl cannytutorial.m
Canny Edges Tutorial: Oct. 4, '03 Canny Edges Tutorial References: ffl imagetutorial.m ffl cannytutorial.m ffl ~jepson/pub/matlab/isetoolbox/tutorials ffl ~jepson/pub/matlab/utvistoolbox/tutorials ffl
FÖLDRAJZ ANGOL NYELVEN
Földrajz angol nyelven középszint 0821 ÉRETTSÉGI VIZSGA 2009. május 14. FÖLDRAJZ ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI ÉRETTSÉGI VIZSGA JAVÍTÁSI-ÉRTÉKELÉSI ÚTMUTATÓ OKTATÁSI ÉS KULTURÁLIS MINISZTÉRIUM Paper
Implementation of water quality monitoring
Joint Ipoly/Ipel Catchment Management HUSK/1101/2.1.1/0153 Implementation of water quality monitoring Dr. Adrienne Clement clement@vkkt.bme.hu Budapest University of Technology and Economics Department
NEUTRÍNÓ DETEKTOROK. A SzUPER -KAMIOKANDE példája
NEUTRÍNÓ DETEKTOROK A SzUPER -KAMIOKANDE példája Kamiokande = Kamioka bánya Nucleon Decay Experiment = nukleon bomlás kísérlet 1 TÉMAKÖRÖK A Szuper-Kamiokande mérőberendezés A Nap-neutrínó rejtély Legújabb
A rosszindulatú daganatos halálozás változása 1975 és 2001 között Magyarországon
A rosszindulatú daganatos halálozás változása és között Eredeti közlemény Gaudi István 1,2, Kásler Miklós 2 1 MTA Számítástechnikai és Automatizálási Kutató Intézete, Budapest 2 Országos Onkológiai Intézet,
THS710A, THS720A, THS730A & THS720P TekScope Reference
THS710A, THS720A, THS730A & THS720P TekScope Reference 070-9741-01 Getting Started 1 Connect probes or leads. 2 Choose SCOPE 3 or METER mode. Press AUTORANGE. Copyright Tektronix, Inc. Printed in U.S.A.
3. MINTAFELADATSOR EMELT SZINT. Az írásbeli vizsga időtartama: 30 perc. III. Hallott szöveg értése
Oktatáskutató és Fejlesztő Intézet TÁMOP-3.1.1-11/1-2012-0001 XXI. századi közoktatás (fejlesztés, koordináció) II. szakasz ANGOL NYELV 3. MINTAFELADATSOR EMELT SZINT Az írásbeli vizsga időtartama: 30
Skills Development at the National University of Public Service
Skills Development at the National University of Public Service Presented by Ágnes Jenei National University of Public Service Faculty of Public Administration Public Ethics and Communication 13. 12. 2013
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY A feladatsor három részből áll 1. A vizsgáztató társalgást kezdeményez a vizsgázóval. 2. A vizsgázó egy szituációs feladatban vesz részt a
Az egészségügyi munkaerő toborzása és megtartása Európában
Az egészségügyi munkaerő toborzása és megtartása Európában Vezetői összefoglaló Európai Egészségügyi Menedzsment Társaság. április Fogyasztó-, Egészség-, Élelmiszerügyi és Mezőgazdasági Végrehajtó Ügynökség
FÖLDRAJZ ANGOL NYELVEN
Földrajz angol nyelven középszint 1311 ÉRETTSÉGI VIZSGA 2013. május 15. FÖLDRAJZ ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI ÉRETTSÉGI VIZSGA JAVÍTÁSI-ÉRTÉKELÉSI ÚTMUTATÓ EMBERI ERŐFORRÁSOK MINISZTÉRIUMA Paper
Minden amerikanisztika szakos vegye fel az az alábbi elıadásokat (a
Frissítve: aug 29. Tanszéki honlap: http://elteal.ieas-szeged.hu/ Tájékoztató elsıéves BA angol/amerikanisztika és angol/amerikanisztika minor szakos diákoknak az ıszi félévrıl Elıadások: Minden angol
(NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV
Kommunikációs rendszerek programozása (NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV (5. mérés) SIP telefonközpont készítése Trixbox-szal 1 Mérés helye: Széchenyi István Egyetem, L-1/7 laboratórium, 9026 Győr, Egyetem
KÉPI INFORMÁCIÓK KEZELHETŐSÉGE. Forczek Erzsébet SZTE ÁOK Orvosi Informatikai Intézet. Összefoglaló
KÉPI INFORMÁCIÓK KEZELHETŐSÉGE Forczek Erzsébet SZTE ÁOK Orvosi Informatikai Intézet Összefoglaló Tanórákon és az önálló tanulás részeként is, az informatika világában a rendelkezésünkre álló óriási mennyiségű
FÖLDRAJZ ANGOL NYELVEN
Földrajz angol nyelven középszint 1411 ÉRETTSÉGI VIZSGA 2015. május 14. FÖLDRAJZ ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI ÉRETTSÉGI VIZSGA JAVÍTÁSI-ÉRTÉKELÉSI ÚTMUTATÓ EMBERI ERŐFORRÁSOK MINISZTÉRIUMA Paper
KN-CP50. MANUAL (p. 2) Digital compass. ANLEITUNG (s. 4) Digitaler Kompass. GEBRUIKSAANWIJZING (p. 10) Digitaal kompas
KN-CP50 MANUAL (p. ) Digital compass ANLEITUNG (s. 4) Digitaler Kompass MODE D EMPLOI (p. 7) Boussole numérique GEBRUIKSAANWIJZING (p. 0) Digitaal kompas MANUALE (p. ) Bussola digitale MANUAL DE USO (p.
IES TM Evaluating Light Source Color Rendition
IES TM-30-15 Evaluating Light Source Color Rendition "Original" "CRI = 80" Desaturated "CRI = 80" Saturated More metrics Color Fidelity Color Discrimination Color Preference Metrics/Measures R f (IES TM-30-15)