Ph.D. értekezés tézisei. A c-típusú citokrómok biogenezisében résztvevő fehérjék. szerepe és génjeik szabályozása Sinorhizobium meliloti-ban

Save this PDF as:

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "Ph.D. értekezés tézisei. A c-típusú citokrómok biogenezisében résztvevő fehérjék. szerepe és génjeik szabályozása Sinorhizobium meliloti-ban"


1 Ph.D. értekezés tézisei A c-típusú citokrómok biogenezisében résztvevő fehérjék szerepe és génjeik szabályozása Sinorhizobium meliloti-ban Készítette: Cinege Gyöngyi Témavezető: Dr. Dusha Ilona MTA Szegedi Biológiai Központ Genetikai Intézet Szegedi Tudományegyetem 2004

2 Bevezetés A Sinorhizobium meliloti talajbaktériumok a lucernával szimbiótikus kölcsönhatást alakítanak ki, melynek során a lucerna gyökerein létrejött gümőkben a bakteroidok a légköri nitrogént ammóniává redukálják. A nitrogénkötéshez szükséges nagymennyiségű energiát egy szimbiózis-specifikus légzési elektrontranszport lánc biztosítja, melynek nagy oxigén-affinitású terminális oxidáza c-típusú citokrómokat tartalmaz. A c-típusú citokrómok minden élő szervezetben fontos szerepet töltenek be. Legjelentősebb funkciójuk mindenütt a légzési elektrontranszport folyamatokban van. S. meliloti baktériumokkal végzett kísérletek kimutatták, hogy a c-típusú citokrómok biogenezisében hibás mutánsok nem képesek a légköri nitrogén megkötésére. A c-típusú citokrómok két alegységből állnak: a hem prosztetikus csoportból és a citokróm apoproteinből. E két alegység kovalensen kapcsolódik egymáshoz. A kovalens összekapcsolást a citokróm c hem liáz komplex (CCHL) alegységei, a CycH, CycJ, CycK és CycL fehérjék végzik a membrán periplazmatikus oldalán. A CycH fehérje funkciója az, hogy a citokróm biogenezis során az apoproteint megfelelő konformációban tartsa, a CycJ, CycK és CycL fehérjék pedig a 2

3 hem csoportot továbbítják a periplazmában, és hozzájárulnak a hemnek az apoproteinre való kapcsolásához. A Cyc fehérjék funkciója azonban még nem teljesen ismert. Jelenleg számos laboratóriumban, különböző baktérium fajokon végeznek kutatásokat azért, hogy a Cyc fehérjék pontos szerepe ismertté váljon. Célkitűzések Munkánk célja az volt, hogy a S. meliloti nitrogénkötő baktériumban a Cyc fehérjéknek a c-típusú citokrómok biogenezisében betöltött funkcióját megismerjük a szimbiózisra jellemző mikroaerob körülmények között. Megvizsgáltuk továbbá a Cyc fehérjéket kódoló operon transzkripciós szabályozásának változását az oxigénszint csökkenésének hatására. A következő kérdésekre kerestünk választ: 1. Milyen hatással van a Cyc fehérjék hiánya a hem bioszintézisre? 2. Mi a magyarázata a két cych mutáns törzsben (AT342 és PP2982) található Tn5 inszerció különböző hatásának? 3

4 3. Mekkora az a minimális N-terminális CycH fehérje szakasz, mely biztosítja az alacsony protoporfirin IX (PPIX) szint megőrzését? 4. Milyen funkciókat lát el a CycH fehérje C-terminális periplazmatikus szakasza a c-típusú citokrómok biogenezisében? 5. Mivel egyes c-típusú citokrómok csupán szimbiótikus körülmények között szintetizálódnak, vizsgáltuk, hogy megnövekszik-e a cychjkl operon kifejeződése mikroaerob körülmények között? 6. Melyek azok a fehérjék, amelyek szerepet játszanak a cychjkl operon mikroaerob indukciójában? Alkalmazott módszerek # Molekuláris biológiai módszerek: DNS, RNS és fehérje izolálás, elektroforézis, Southern-analízis, Northern-analízis, polimeráz láncreakció, klónozás, szekvencia analízis, homológ rekombináció. # Mikrobiológiai módszerek: konjugáció, transzformáció, fág transzdukció. 4

5 # Biokémiai módszerek: β-galaktozidáz aktívitás meghatározás, c- típusú citokrómok kimutatása, protoporfirin IX kimutatása, respirációs nitrát reduktáz aktivitás kimutatása. # Medicago sativa növények laboratoriumi körülmények közti termesztése, baktériumokkal való inokulálása. Eredmények és következtetések A cychjkl génekben mutációt hordozó S. meliloti baktériumokkal végzett kísérleteink során kiderült, hogy a Cyc fehérjék hiánya nemcsak nitrogénkötésben (Fix - ) és nitrát redukcióban (Rnr - ) hibás fenotípust okoz, hanem a hem bioszintézis utolsó lépéseit is befolyásolja. A cyc mutánsokban (a PP2982 cych mutáns törzs kivételével) a vad típushoz képest felhalmozódott a hem közvetlen prekurzora, a PPIX. Ennek oka valószínűleg az, hogy a Cyc fehérjék hiányában nem alakulhat ki a hem és az apoprotein közti kovalens kötés. Komplementációs kísérletek segítségével megállapítottuk, hogy a munkánk során vizsgált két cych mutánsban az eltérő PPIX fenotípus nem magyarázható a transzpozon beépülésének esetleges poláris hatásával. A különbséget a két mutánsban az idézte elő, hogy bennük a CycH fehérjének különböző hosszúságú szakaszai 5

6 szintetizálódtak, amely a PP2982 törzsben elegendő volt az alacsony PPIX szint megőrzéséhez. Megállapítottuk, hogy az aktív peptid az N-terminális 96 aminósavból áll, és magában foglalja a CycH fehérje első transzmembrán doménjét a citoplazmatikus hurokkal. Eredményeinket irodalmi adatokkal összevetve az N- terminális 96 aminósavból álló CycH fehérje szakasznak három lehetséges szerepét feltételeztük. Egyrészt e fehérje szakasz a CycJ, CycK és CycL fehérjékkel együtt elegendő lehet instabil c- típusú citokrómok biogeneziséhez, így a PPIX felhasználódáshoz. Egy másik lehetséges funkció a hem csoport periplazmába történő transzportja. Amennyiben a hem szállítás zavartalan, nem halmozódik fel a PPIX. A harmadik feltételezett funkció szerint a CycH fehérjének ez a szakasza kölcsönhatásba léphet a PPIX-ből hemet szintetizáló ferrokelatáz enzimmel, és elősegítheti annak működését. A CycH fehérje C-terminális periplazmatikus szakaszát vizsgálva három tetratrikopeptid (TPR) domént azonosítottunk. A TPR domének funkciója irodalmi adatok alapján ismert, fehérjefehérje interakciókban játszanak szerepet. Kísérleteink során olyan konstrukciókat készítettünk, melyekből egyenként eltávolítottuk a cych gén TPR doméneket kódoló szakaszait. Ezekkel 6

7 komplementációs kísérleteket végeztünk és kimutattuk, hogy a TPR domének nélkülözhetetlenek a CycH fehérje funkciójának a betöltéséhez. Hiányukban sem a Fix +, sem a Rnr + fenotípus nem állítható helyre. Azt feltételezzük, hogy a CycH fehérje esetében a TPR domének a fehérjének az apoproteinnel és/vagy a citokróm c hem liáz komplex többi egységével való kapcsolatát biztosítják. További munkánk során abból indultunk ki, hogy a szimbiózis-specifikus légzési elektrontranszport lánc nagy oxigénaffinitású terminális oxidázát kódoló fixnoqp operon mikroaerob körülmények között fejeződik ki. A keletkezett termékek között a FixO és FixP fehérje c-típusú citokróm apoprotein. Megvizsgáltuk, hogy a cychjkl operon transzkripciója is oxigén kontrol alatt áll-e. Megállapítottuk, hogy mikroaerob környezetben a cychjkl operon kifejeződése megnövekedett, tehát feltételezhetően szimbiótikus körülmények között a Cyc fehérjék nagyobb mennyiségben képződnek. A továbbiakban megvizsgáltuk, hogy a S. meliloti-ban ismert, oxigénszintet érzékelő és e jelet továbbító fehérjéknek van-e szerepe a cyc operon mikroaerob indukciójában. Eredményeink alapján kizártuk a FixL, FixJ valamint FixK fehérjék szerepét e folyamatban. Harmadik jelöltünk az ActS/R kétkomponensű 7

8 jelátvivő rendszer volt. Eredményeink szerint az ActR fehérje mikroaerob környezetben és intenzív nitrogénkötés folyamata alatt szerepet játszik a cyc operon kifejeződésének indukciójában. 8

9 Közlemények jegyzéke A dolgozat készítéséhez felhasznált tudományos publikáció Cinege G, Kereszt A, Kertész S, Balogh G, Dusha I (2004) The roles of different regions of the CycH protein in c-type cytochrome biogenesis in Sinorhizobium meliloti. Mol Genet Genomics 271: A dolgozat készítésekor nem használt tudományos publikáció Oláh B, Kiss E, Györgypál Z, Borzi J, Cinege G, Csanádi G, Batut J, Kondorosi A, Dusha I (2001) Mutation in the ntrr gene, a member of the vap gene family increases the symbiotic efficiency of Sinorhizobium meliloti. Mol Plant-Microbe Interact 15: Társszerzői lemondó nyilatkozat Alulírott nyilatkozom, hogy a Jelölt téziseit ismerem, a tézisekben foglalt tudományos eredményeket tudományos fokozat megszerzéséhez nem használtam fel, s tudomásul veszem, hogy azokat ilyen célból a jövőben sem használhatom fel. Szeged, április 10 Dr. Dusha Ilona.. 9

10 Egyéb közlemények Poszterek 1. Bodogai M, Cinege G, Dusha I (2003) The regulatory cascade of nif-fix genes is under the control of ntrr in Sinorhizobium meliloti. V. Magyar Genetikai Kongresszus, Siófok. 2. Cinege G, Kereszt A, Balogh G, Dusha I (2002) Regulation of cychjkl operon and its role in c-type cytochrome biogenesis. 5 th European Nitrogen Fixation Conference, Norwich, United Kingdom. 3. Cinege G, Kereszt A, Balogh G, Dusha I (2002) Egy citokróm c hem liáz doménjeinek szerepe a c-típusú citokrómok biogenezisében. A Magyar Biokémiai Egyesület Munkaértekezlete, Keszthely. 4. Cinege G, Kereszt A, Dusha I (1999) c-típusú citokrómok biogenezisében résztvevő gének szerepe és regulációja. A Magyar Biokémiai Egyesület Munkaértekezlete, Sopron. Előadások 1. Cinege G, Kereszt A, Balogh G, Dusha I (2003) A CycH fehérje doménjeinek szerepe a c-típusú citokrómok biogenezisében. V. Magyar Genetikai Kongresszus, Siófok. 2. Cinege G, Kereszt A, Borzi J, Balogh G, Dusha I (2002) Egy citokróm c hem liáz doménjeinek szerepe a c-típusú citokrómok biogenezisében. Straub-Napok, MTA Szegedi Biológiai Központ. 3. Cinege G, Kereszt A, Borzi J, Dusha I (2000) c-típusú citokrómok biogenezisében résztvevő gének szerepe és regulációja 10

11 Sinorhizobium meliloti-ban. Straub-Napok, MTA Szegedi Biológiai Központ. 4. Cinege G, Dusha I (1999) Oxygen dependent regulation of cyc genes in Sinorhizobium meliloti. Closing Simposium of the International Training Course organised by the UNESCO, ICRO and the Biological Research Center of the Hungarian Academy of Sciences, Szeged. 11

A c-típusú citokrómok biogenezisében résztvevő fehérjék. szerepe és génjeik szabályozása Sinorhizobium. meliloti-ban.

A c-típusú citokrómok biogenezisében résztvevő fehérjék. szerepe és génjeik szabályozása Sinorhizobium. meliloti-ban. A c-típusú citokrómok biogenezisében résztvevő fehérjék szerepe és génjeik szabályozása Sinorhizobium meliloti-ban Ph.D. értekezés Cinege Gyöngyi Témavezető: Dr. Dusha Ilona MTA Szegedi Biológiai Központ


Szimbiotikus nitrogénkötés

Szimbiotikus nitrogénkötés Szimbiotikus nitrogénkötés Nitrogén körforgalom, kémiai és biológiai nitrogénkötés - szabadonélő, asszociatív és szimbiotikus nitrogénkötés. Növény-baktérium kapcsolatok: az agrobaktériumok és a rhizobiumok


A növény inváziójában szerepet játszó bakteriális gének

A növény inváziójában szerepet játszó bakteriális gének A növény inváziójában szerepet játszó bakteriális gének merisztéma korai szimbiotikus zóna késői szimbiotikus zóna öregedési zóna gyökér keresztmetszet NODULÁCIÓ növényi jel Rhizobium meliloti rhizobium


Egy új, a szimbiotikus gümőfejlődésben szerepet játszó ubiquitin ligáz funkcionális jellemzése

Egy új, a szimbiotikus gümőfejlődésben szerepet játszó ubiquitin ligáz funkcionális jellemzése Zárójelentés 76843 sz. pályázat 2009 2012 Egy új, a szimbiotikus gümőfejlődésben szerepet játszó ubiquitin ligáz funkcionális jellemzése A tervezett munka a kutatócsoportunkban korábban genetikai térképezésen


Ph.D. értekezés tézisei. Dürgő Hajnalka. Témavezető: Dr. Medzihradszky-Fölkl Katalin. Biológia Doktori Iskola. MTA SZBK Biokémiai Intézet SZTE TTIK

Ph.D. értekezés tézisei. Dürgő Hajnalka. Témavezető: Dr. Medzihradszky-Fölkl Katalin. Biológia Doktori Iskola. MTA SZBK Biokémiai Intézet SZTE TTIK Gümő-specifikus NCR peptidek azonosítása, vad és mutáns Medicago truncatula gyökérgümők összehasonlító fehérjeanalízise, és az NCR247 lehetséges bakteriális interakciós partnereinek felderítése Ph.D. értekezés


Fehérje expressziós rendszerek. Gyógyszerészi Biotechnológia

Fehérje expressziós rendszerek. Gyógyszerészi Biotechnológia Fehérje expressziós rendszerek Gyógyszerészi Biotechnológia Expressziós rendszerek Cél: rekombináns fehérjék előállítása nagy tisztaságban és nagy mennyiségben kísérleti ill. gyakorlati (therapia) felhasználásokra


TDK lehetőségek az MTA TTK Enzimológiai Intézetben

TDK lehetőségek az MTA TTK Enzimológiai Intézetben TDK lehetőségek az MTA TTK Enzimológiai Intézetben Vértessy G. Beáta egyetemi tanár TDK mind 1-3 helyezettek OTDK Pro Scientia különdíj 1 második díj Diákjaink Eredményei Zsűri különdíj 2 első díj OTDK


A fotoszintézis molekuláris biofizikája (Vass Imre, 2000) 39

A fotoszintézis molekuláris biofizikája (Vass Imre, 2000) 39 A fotoszintézis molekuláris biofizikája (Vass Imre, 2000) 39 6. A citokróm b 6 f komplex A két fotokémiai rendszer közötti elektrontranszportot a citokróm b 6 f komplex közvetíti. Funkciója a kétszeresen


A TATA-kötő fehérje asszociált faktor 3 (TAF3) p53-mal való kölcsönhatásának funkcionális vizsgálata

A TATA-kötő fehérje asszociált faktor 3 (TAF3) p53-mal való kölcsönhatásának funkcionális vizsgálata Ph.D. ÉRTEKEZÉS TÉZISEI A TATA-kötő fehérje asszociált faktor 3 (TAF3) p53-mal való kölcsönhatásának funkcionális vizsgálata Buzás-Bereczki Orsolya Témavezetők: Dr. Bálint Éva Dr. Boros Imre Miklós Biológia


Escherichia coli aminosav-transzporterek vizsgálata

Escherichia coli aminosav-transzporterek vizsgálata Doktori (Ph.D) értekezés tézisei Escherichia coli aminosav-transzporterek vizsgálata Készítette: Szvetnik Attila Témavezetı: Dr. Kálmán Miklós egyetemi docens Biológia Doktori Iskola Szegedi Tudományegyetem


BEVEZETÉS. A magasabbrendű növényeknek egész életciklusuk folyamán flexibilisen

BEVEZETÉS. A magasabbrendű növényeknek egész életciklusuk folyamán flexibilisen BEVEZETÉS A magasabbrendű növényeknek egész életciklusuk folyamán flexibilisen adaptálódniuk kell mind a külső környezetből, mind a szervezetükből érkező ingerekhez. Ezeket a hatásokat az egyes sejtek


Energiatermelés a sejtekben, katabolizmus. Az energiaközvetítő molekula: ATP

Energiatermelés a sejtekben, katabolizmus. Az energiaközvetítő molekula: ATP Energiatermelés a sejtekben, katabolizmus Az energiaközvetítő molekula: ATP Elektrontranszfer, a fontosabb elektronszállító molekulák NAD: nikotinamid adenin-dinukleotid FAD: flavin adenin-dinukleotid


TÉMAKÖRÖK. Ősi RNS világ BEVEZETÉS. RNS-ek tradicionális szerepben



A C. elegans TRA-1/GLI/Ci szex-determinációs faktor célgénjeinek meghatározása és analízise. Doktori értekezés tézisei.

A C. elegans TRA-1/GLI/Ci szex-determinációs faktor célgénjeinek meghatározása és analízise. Doktori értekezés tézisei. A C. elegans TRA-1/GLI/Ci szex-determinációs faktor célgénjeinek meghatározása és analízise Doktori értekezés tézisei Hargitai Balázs Eötvös Loránd Tudományegyetem Természettudományi Kar Biológia Doktori


A doktori értekezés tézisei. A növényi NRP fehérjék lehetséges szerepe a hiszton defoszforiláció szabályozásában, és a hőstressz válaszban.

A doktori értekezés tézisei. A növényi NRP fehérjék lehetséges szerepe a hiszton defoszforiláció szabályozásában, és a hőstressz válaszban. A doktori értekezés tézisei A növényi NRP fehérjék lehetséges szerepe a hiszton defoszforiláció szabályozásában, és a hőstressz válaszban. Bíró Judit Témavezető: Dr. Fehér Attila Magyar Tudományos Akadémia



NITROGÉNKÖTŐ ENDOSZIMBIÓZISOK 1 NITROGÉNKÖTŐ ENDOSZIMBIÓZISOK 1 Frankia baktériumfajok (Actinomycetales) filamentumok v. fonalak, (Streptomyces rokonok) növények: Alnus (Alnus glutinosa lásd a képet) Casuarina mediterrán fajok Eleagnus


NiFe hidrogenázok és fotoszintetikus rendszer kifejeződését szabályozó szignál transzdukciós mechanizmusok Thiocapsa roseopersicina-ban

NiFe hidrogenázok és fotoszintetikus rendszer kifejeződését szabályozó szignál transzdukciós mechanizmusok Thiocapsa roseopersicina-ban NiFe hidrogenázok és fotoszintetikus rendszer kifejeződését szabályozó szignál transzdukciós mechanizmusok Thiocapsa roseopersicina-ban Ph.D. tézisek Kovács Ákos Tibor Témavezetők: Dr. Rákhely Gábor Prof.


Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Azonosító szám: TÁMOP-4.1.2-08/1/A-2009-0011 Az orvosi


A szamóca érése során izolált Spiral és Spermidin-szintáz gén jellemzése. Kiss Erzsébet Kovács László

A szamóca érése során izolált Spiral és Spermidin-szintáz gén jellemzése. Kiss Erzsébet Kovács László A szamóca érése során izolált Spiral és Spermidin-szintáz gén jellemzése Kiss Erzsébet Kovács László Bevezetés Nagy gazdasági gi jelentıségük k miatt a gyümölcs lcsök, termések fejlıdésének mechanizmusát


Receptorok és szignalizációs mechanizmusok

Receptorok és szignalizációs mechanizmusok Molekuláris sejtbiológia: Receptorok és szignalizációs mechanizmusok Dr. habil Kőhidai László Semmelweis Egyetem Genetikai, Sejt- és Immunbiológiai Intézet Sejtek szignalizációs kapcsolatai Sejtek szignalizációs


12/4/2014. Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció. 1952 Hershey & Chase 1953!!!

12/4/2014. Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció. 1952 Hershey & Chase 1953!!! Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció 1859 1865 1869 1952 Hershey & Chase 1953!!! 1879 1903 1951 1950 1944 1928 1911 1 1. DNS szerkezete Mi az örökítő anyag? Friedrich Miescher


PÉCSI TUDOMÁNYEGYETEM. A kapszuláris poliszacharid bioszintézis és a 16-3 bakteriofág receptor Sinorhizobium meliloti 41 baktériumban

PÉCSI TUDOMÁNYEGYETEM. A kapszuláris poliszacharid bioszintézis és a 16-3 bakteriofág receptor Sinorhizobium meliloti 41 baktériumban PÉCSI TUDOMÁNYEGYETEM Biológia Doktori Iskola A kapszuláris poliszacharid bioszintézis és a 16-3 bakteriofág receptor Sinorhizobium meliloti 41 baktériumban Ph.D. értekezés tézisei Pálvölgyi Adrienn Témavezető:


NÖVÉNYÉLETTAN. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP /1/A

NÖVÉNYÉLETTAN. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP /1/A NÖVÉNYÉLETTAN Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 Gibberellinek és citokininek Előadás áttekintése 1. Gibberellinek: a növénymagasság és csírázás hormonjai 2. A gibberellinek


Búza tartalékfehérjék mozgásának követése a transzgénikus rizs endospermium sejtjeiben

Búza tartalékfehérjék mozgásának követése a transzgénikus rizs endospermium sejtjeiben TÉMA ÉRTÉKELÉS TÁMOP-4.2.1/B-09/1/KMR-2010-0003 (minden téma külön lapra) 2010. június 1. 2012. május 31. 1. Az elemi téma megnevezése Búza tartalékfehérjék mozgásának követése a transzgénikus rizs endospermium


Egy Polycomb Response Element (PRE) in situ vizsgálata Drosophila melanogaster-ben génkonverzió segítségével. Kozma Gabriella

Egy Polycomb Response Element (PRE) in situ vizsgálata Drosophila melanogaster-ben génkonverzió segítségével. Kozma Gabriella Egy Polycomb Response Element (PRE) in situ vizsgálata Drosophila melanogaster-ben génkonverzió segítségével Kozma Gabriella Ph.D. tézisek Témavezető: Dr. Sipos László Genetikai Intézet MTA Szegedi Biológiai


A preventív vakcináció lényege :

A preventív vakcináció lényege : Vakcináció Célja: antigénspecifkus immunválasz kiváltása a szervezetben A vakcina egy olyan készítmény, amely fokozza az immunitást egy adott betegséggel szemben (aktiválja az immunrendszert). A preventív


A légzési lánc és az oxidatív foszforiláció

A légzési lánc és az oxidatív foszforiláció A légzési lánc és az oxidatív foszforiláció Csala Miklós Semmelweis Egyetem Orvosi Vegytani, Molekuláris Biológiai és Patobiokémiai Intézet intermembrán tér Fe-S FMN NADH mátrix I. komplex: NADH-KoQ reduktáz


RNS-ek. 1. Az ősi RNS Világ: - az élet hajnalán. 2. Egy már ismert RNS Világ: - a fehérjeszintézis ben résztvevő RNS-ek

RNS-ek. 1. Az ősi RNS Világ: - az élet hajnalán. 2. Egy már ismert RNS Világ: - a fehérjeszintézis ben résztvevő RNS-ek RNS-ek RNS-ek 1. Az ősi RNS Világ: - az élet hajnalán 2. Egy már ismert RNS Világ: - a fehérjeszintézis ben résztvevő RNS-ek 3. Egy újonnan felfedezett RNS Világ: - szabályozó RNS-ek 4. Transzkripció Ősi


A mutáns fenotípushoz szorosan kapcsolt markerek (1N1R és U212D) segítségével BAC (Bacterial Artifical Chromosome) klónokat azonosítottunk egy másik

A mutáns fenotípushoz szorosan kapcsolt markerek (1N1R és U212D) segítségével BAC (Bacterial Artifical Chromosome) klónokat azonosítottunk egy másik A szimbiotikus gümő kialakulásában résztvevő két gén azonosítása Medicago truncatulaból térképezésen alapuló génizolálással c. OTKA pályázat (T046645) zárójelentése A pályázat célja a Sinorhizobium meliloti


Molekuláris genetikai vizsgáló. módszerek az immundefektusok. diagnosztikájában

Molekuláris genetikai vizsgáló. módszerek az immundefektusok. diagnosztikájában Molekuláris genetikai vizsgáló módszerek az immundefektusok diagnosztikájában Primer immundefektusok A primer immundeficiencia ritka, veleszületett, monogénes öröklődésű immunhiányos állapot. Családi halmozódást


Algaközösségek ökológiai, morfológiai és genetikai diverzitásának összehasonlítása szentély jellegű és emberi használatnak kitett élőhelykomplexekben

Algaközösségek ökológiai, morfológiai és genetikai diverzitásának összehasonlítása szentély jellegű és emberi használatnak kitett élőhelykomplexekben Algaközösségek ökológiai, morfológiai és genetikai diverzitásának összehasonlítása szentély jellegű és emberi használatnak kitett élőhelykomplexekben Duleba Mónika Környezettudományi Doktori Iskola I.





Klónozás: tökéletesen egyforma szervezetek csoportjának előállítása, vagyis több genetikailag azonos egyed létrehozása.

Klónozás: tökéletesen egyforma szervezetek csoportjának előállítása, vagyis több genetikailag azonos egyed létrehozása. Növények klónozása Klónozás Klónozás: tökéletesen egyforma szervezetek csoportjának előállítása, vagyis több genetikailag azonos egyed létrehozása. Görög szó: klon, jelentése: gally, hajtás, vessző. Ami


Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek

Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek Hidroxikarbonsavak α-hidroxi karbonsavak -Glikolsav (kézkrémek) - Tejsav (tejtermékek, izomláz, fogszuvasodás) - Citromsav (citrusfélékben,


Plant RBR proteins are phosphorylated in cell cycle-phase dependent manner and the B

Plant RBR proteins are phosphorylated in cell cycle-phase dependent manner and the B Plant RBR proteins are phosphorylated in cell cycle-phase dependent manner and the B regulatory subunit containing OsPP2A holoenzyme mediates the dephosphorylation of OsRBR1 Doktori (Ph.D.) értekezés tézisei



RÉSZLETES SZAKMAI BESZÁMOLÓ RÉSZLETES SZAKMAI BESZÁMOLÓ 1. A Renox (Nox4)-deficiens egérmodell létrehozása Az OTKA pályázat keretében végzett kutatások egyik legfontosabb eredménye, hogy sikerült létrehozni egy Nox4 (Renox)-deficiens


A glükóz reszintézise.

A glükóz reszintézise. A glükóz reszintézise. A glükóz reszintézise. A reszintézis nem egyszerű megfordítása a glikolízisnek. A glikolízis 3 irrevezibilis lépése más úton játszódik le. Ennek oka egyrészt energetikai, másrészt


Genetikai panel kialakítása a hazai tejhasznú szarvasmarha állományok hasznos élettartamának növelésére

Genetikai panel kialakítása a hazai tejhasznú szarvasmarha állományok hasznos élettartamának növelésére Genetikai panel kialakítása a hazai tejhasznú szarvasmarha állományok hasznos élettartamának növelésére Dr. Czeglédi Levente Dr. Béri Béla Kutatás-fejlesztés támogatása a megújuló energiaforrások és agrár








A bioenergetika a biokémiai folyamatok során lezajló energiaváltozásokkal foglalkozik.

A bioenergetika a biokémiai folyamatok során lezajló energiaváltozásokkal foglalkozik. Modul cím: MEDICINÁLIS ALAPISMERETEK BIOKÉMIA BIOENERGETIKA I. 1. kulcsszó cím: Energia A termodinamika első főtétele kimondja, hogy a különböző energiafajták átalakulhatnak egymásba ez az energia megmaradásának


Genetika 3 ea. Bevezetés

Genetika 3 ea. Bevezetés Genetika 3 ea. Mendel törvényeinek a kiegészítése: Egygénes öröklődés Többtényezős öröklődés Bevezetés Mendel által vizsgált tulajdonságok: diszkrétek, két különböző fenotípus Humán tulajdonságok nagy


Evolúcióelmélet és az evolúció mechanizmusai

Evolúcióelmélet és az evolúció mechanizmusai Evolúcióelmélet és az evolúció mechanizmusai Az élet Darwini szemlélete Melyek az evolúció bizonyítékai a világban? EVOLÚCIÓ: VÁLTOZATOSSÁG Mutáció Horizontális géntranszfer Genetikai rekombináció Rekombináció


A MITOKONDRIÁLIS CITOKRÓM C POSZTTRANSZLÁCIÓS ÉRÉSE. Doktori (Ph.D.) értekezés tézisei. Tenger Katalin

A MITOKONDRIÁLIS CITOKRÓM C POSZTTRANSZLÁCIÓS ÉRÉSE. Doktori (Ph.D.) értekezés tézisei. Tenger Katalin A MITOKONDRIÁLIS CITOKRÓM C POSZTTRANSZLÁCIÓS ÉRÉSE Doktori (Ph.D.) értekezés tézisei Tenger Katalin Témavezető: Dr. Zimányi László Konzulens: Dr. Rákhely Gábor Biológia Doktori Iskola Szegedi Tudományegyetem


Zárójelentés. Gabonafélék stresszadaptációját befolyásoló jelátviteli folyamatok tanulmányozása. (K75584 sz. OTKA pályázat)

Zárójelentés. Gabonafélék stresszadaptációját befolyásoló jelátviteli folyamatok tanulmányozása. (K75584 sz. OTKA pályázat) Zárójelentés Gabonafélék stresszadaptációját befolyásoló jelátviteli folyamatok tanulmányozása (K75584 sz. OTKA pályázat) A tervezett kísérletek célja, hogy jobban megértsük a növények változó környezetre


A C1 orf 124/Spartan szerepe a DNS-hiba tolerancia útvonalban

A C1 orf 124/Spartan szerepe a DNS-hiba tolerancia útvonalban Ph.D. tézisek A C1 orf 124/Spartan szerepe a DNS-hiba tolerancia útvonalban Írta: Juhász Szilvia Témavezető: Dr. Haracska Lajos Magyar Tudományos Akadémia Szegedi Biológiai Kutatóközpont Genetikai Intézet


NÖVÉNYGENETIKA. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP /1/A

NÖVÉNYGENETIKA. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP /1/A NÖVÉNYGENETIKA Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 A NÖVÉNYI TÁPANYAG TRANSZPORTEREK az előadás áttekintése A tápionok útja a növényben Növényi tápionok passzív és


Kőolaj- és élelmiszeripari hulladékok biodegradációja

Kőolaj- és élelmiszeripari hulladékok biodegradációja Kőolaj- és élelmiszeripari hulladékok biodegradációja Kis Ágnes 1,2, Laczi Krisztián, Tengölics Roland 1, Zsíros Szilvia 1, Kovács L. Kornél 1,2, Rákhely Gábor 1,2, Perei Katalin 1 1 Szegedi Tudományegyetem,





2. Ismert térszerkezetű transzmembrán fehérjék adatbázisa: a PDBTM adatbázis. 3. A transzmembrán fehérje topológiai adatbázis, a TOPDB szerver

2. Ismert térszerkezetű transzmembrán fehérjék adatbázisa: a PDBTM adatbázis. 3. A transzmembrán fehérje topológiai adatbázis, a TOPDB szerver A 2005 és 2007 között megvalósított project célja transzmembrán fehérjék vizsgálata és az ehhez szükséges eljárások kifejlesztése volt. Ez utóbbi magába foglalta új adatbázisok és szerkezet becslő módszerek



BIOLÓGIA HÁZIVERSENY 1. FORDULÓ BIOKÉMIA, GENETIKA BIOKÉMIA, GENETIKA BIOKÉMIA, GENETIKA 1. Nukleinsavak keresztrejtvény (12+1 p) 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 1. A nukleinsavak a.-ok összekapcsolódásával kialakuló polimerek. 2. Purinvázas szerves bázis, amely az


Natív antigének felismerése. B sejt receptorok, immunglobulinok

Natív antigének felismerése. B sejt receptorok, immunglobulinok Natív antigének felismerése B sejt receptorok, immunglobulinok B és T sejt receptorok A B és T sejt receptorok is az immunglobulin fehérje család tagjai A TCR nem ismeri fel az antigéneket, kizárólag az


OTKA ZÁRÓJELENTÉS. A p53 géncsalád tagjai daganat szupresszióban betöltött, transzkripcionális és keresztregulációs

OTKA ZÁRÓJELENTÉS. A p53 géncsalád tagjai daganat szupresszióban betöltött, transzkripcionális és keresztregulációs OTKA ZÁRÓJELENTÉS A p53 géncsalád tagjai daganat szupresszióban betöltött, transzkripcionális és keresztregulációs funkcióinak elemzése (Analysis of the transcriptional activaton and cross-regulatoryfunctions


DNS replikáció. DNS RNS Polipeptid Amino terminus. Karboxi terminus. Templát szál

DNS replikáció. DNS RNS Polipeptid Amino terminus. Karboxi terminus. Templát szál DNS replikáció DNS RNS Polipeptid Amino terminus Templát szál Karboxi terminus Szuper-csavarodott prokarióta cirkuláris DNS Hisztonok komplexe DNS hisztonokra történő felcsvarodása Hiszton-kötött negatív


Genetikai kölcsönhatások rendszerbiológiája

Genetikai kölcsönhatások rendszerbiológiája Genetikai kölcsönhatások rendszerbiológiája Papp Balázs MTA Szegedi Biológiai Kutatóközpont Biokémiai Intézet Szintetikus és Rendszerbiológiai Egység Mikrobiális rendszerbiológia főbb


A Nimród fehérje- és géncsalád szerepe a mikroorganizmusok felismerésében és bekebelezésében

A Nimród fehérje- és géncsalád szerepe a mikroorganizmusok felismerésében és bekebelezésében A Nimród fehérje- és géncsalád szerepe a mikroorganizmusok felismerésében és bekebelezésében PhD tézisfüzet Szerző: Zsámboki János Témavezető: Dr. Kurucz Éva Biológia doktori iskola MTA Szegedi Biológiai


Biológiai módszerek alkalmazása környezeti hatások okozta terhelések kimutatására

Biológiai módszerek alkalmazása környezeti hatások okozta terhelések kimutatására Szalma Katalin Biológiai módszerek alkalmazása környezeti hatások okozta terhelések kimutatására Témavezető: Dr. Turai István, OSSKI Budapest, 2010. október 4. Az ionizáló sugárzás sejt kölcsönhatása Antone


Bakteriális identifikáció 16S rrns gén szekvencia alapján

Bakteriális identifikáció 16S rrns gén szekvencia alapján Bakteriális identifikáció 16S rrns gén szekvencia alapján MOHR ANITA SIPOS RITA, SZÁNTÓ-EGÉSZ RÉKA, MICSINAI ADRIENN 2100 Gödöllő, Szent-Györgyi Albert út 4., TÖRZS AZONOSÍTÁS


Bevezetés. Célkitűzések

Bevezetés. Célkitűzések DOKTORI ÉRTEKEZÉS TÉZISEI A Drosophila melanogaster p53 sumoilációjának molekuláris biológiai és genetikai vizsgálata Pardi Norbert Témavezető: Dr. Boros Imre Egyetemi tanár Biológia Doktori Iskola Szegedi


Farmakológus szakasszisztens Farmakológus szakasszisztens 2/34

Farmakológus szakasszisztens Farmakológus szakasszisztens 2/34 -06 Farmakológus szakasszisztens feladatok A 0/007 (II. 7.) SzMM rendelettel módosított /006 (II. 7.) OM rendelet Országos Képzési Jegyzékről és az Országos Képzési Jegyzékbe történő felvétel és törlés


Növényvédelmi Tudományos Napok 2015

Növényvédelmi Tudományos Napok 2015 Növényvédelmi Tudományos Napok 05 Budapest 6. NÖVÉNYVÉDELMI TUDOMÁNYOS NAPOK Szerkesztők HORVÁTH JÓZSEF HALTRICH ATTILA MOLNÁR JÁNOS Budapest 05. február 7-8. ii Szerkesztőbizottság Kiss Levente Horváth


A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin.

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin. Myoglobin Fehérje-szerkezetek! MGLSDGEWQLVLNVWGKVEADIPGGQEVLIRLFK GPETLEKFDKFKLKSEDEMKASE DLKKGATVLTALGGILKKKGEAEIKPLAQSA TKKIPVKYLEFISECIIQVLQSK PGDFGADAQGAMNKALELFRKDMASNYKELGFQG Fuxreiter Mónika! Debreceni


Tudománytörténeti visszatekintés

Tudománytörténeti visszatekintés GENETIKA I. AZ ÖRÖKLŐDÉS TÖRVÉNYSZERŰSÉGEI Minek köszönhető a biológiai sokféleség? Hogyan történik a tulajdonságok átörökítése? Tudománytörténeti visszatekintés 1. Keveredés alapú öröklődés: (1761-1766,


A vas homeosztázis, oxidatív mutagenezis és az antibiotikum rezisztencia evolúciójának kapcsolata

A vas homeosztázis, oxidatív mutagenezis és az antibiotikum rezisztencia evolúciójának kapcsolata Ph.D. értekezés tézisei A vas homeosztázis, oxidatív mutagenezis és az antibiotikum rezisztencia evolúciójának kapcsolata Méhi Orsolya Katinka Témavezető: Dr. Pál Csaba, tudományos főmunkatárs Biológia



ADATBÁNYÁSZAT I. ÉS OMICS Az élettudományi-klinikai felsőoktatás gyakorlatorientált és hallgatóbarát korszerűsítése a vidéki képzőhelyek nemzetközi versenyképességének erősítésére TÁMOP-4.1.1.C-13/1/KONV-2014-0001 ADATBÁNYÁSZAT


BIOLÓGIAI PRODUKCIÓ. Az ökológiai rendszerekben végbemenő szervesanyag-termelés. A növények >fotoszintézissel történő szervesanyagelőállítása

BIOLÓGIAI PRODUKCIÓ. Az ökológiai rendszerekben végbemenő szervesanyag-termelés. A növények >fotoszintézissel történő szervesanyagelőállítása BIOLÓGIAI PRODUKCIÓ Az ökológiai rendszerekben végbemenő szervesanyag-termelés. A növények >fotoszintézissel történő szervesanyagelőállítása az elsődleges v. primer produkció; A fogyasztók és a lebontók



A BIOTECHNOLÓGIA ALKALMAZÁSI LEHETŐSÉGEI A GYÓGYSZERKUTATÁSBAN Az élettudományi-klinikai felsőoktatás gyakorlatorientált és hallgatóbarát korszerűsítése a vidéki képzőhelyek nemzetközi versenyképességének erősítésére TÁMOP-4.1.1.C-13/1/KONV-2014-0001 A BIOTECHNOLÓGIA


NÖVÉNYÉLETTAN. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010

NÖVÉNYÉLETTAN. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 NÖVÉNYÉLETTAN Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 Sejtfal szintézis és megnyúlás Környezeti tényezők hatása a növények növekedésére és fejlődésére Előadás áttekintése


A búza (Triticum aestivum L.) glutamin szintetáz enzim viselkedése abiotikus stresszfolyamatok (a szárazság- és az alumíniumstressz) során

A búza (Triticum aestivum L.) glutamin szintetáz enzim viselkedése abiotikus stresszfolyamatok (a szárazság- és az alumíniumstressz) során Doktori (PhD) értekezés tézisei A búza (Triticum aestivum L.) glutamin szintetáz enzim viselkedése abiotikus stresszfolyamatok (a szárazság- és az alumíniumstressz) során Készítette: Nagy Zoltán Témavezető:


MITOCHONDRIUM. Molekuláris sejtbiológia: Dr. habil. Kőhidai László egytemi docens Semmelweis Egyetem, Genetikai, Sejt- és Immunbiológiai Intézet

MITOCHONDRIUM. Molekuláris sejtbiológia: Dr. habil. Kőhidai László egytemi docens Semmelweis Egyetem, Genetikai, Sejt- és Immunbiológiai Intézet Molekuláris sejtbiológia: MITOCHONDRIUM külső membrán belső membrán lemezek / crista matrix Dr. habil. Kőhidai László egytemi docens Semmelweis Egyetem, Genetikai, Sejt- és Immunbiológiai Intézet Tudomány-történet


Az energiatermelõ folyamatok evolúciója

Az energiatermelõ folyamatok evolúciója Az energiatermelõ folyamatok evolúciója A sejtek struktúrája, funkciója és evolúciója nagyrészt energia igényükkel magyarázható. Alábbiakban azt tárgyaljuk, hogy biológiai evolúció során milyen sorrendben


Genetika. Tartárgyi adatlap: tantárgy adatai

Genetika. Tartárgyi adatlap: tantárgy adatai Genetika Előadás a I. éves Génsebészet szakos hallgatók számára Tartárgyi adatlap: tantárgy adatai 2.1. Tantárgy címe Genetika 2.2. Előadás felelőse Dr. Mara Gyöngyvér, docens 2.3. Egyéb oktatási tevékenységek


Papp Henriett Ph.D hallgató. Tanulmányok: Biológus MSc

Papp Henriett Ph.D hallgató. Tanulmányok: Biológus MSc Ph.D hallgató Tanulmányok: 2013-2015. Biológus MSc Molekuláris-, immun- és mikrobiológia szakirány (nappali) Szegedi Tudományegyetem Természettudományi és Informatikai Kar


Bioinformatika 2 10.el

Bioinformatika 2 10.el 10.el őadás Prof. Poppe László BME Szerves Kémia és Technológia Tsz. Bioinformatika proteomika Előadás és gyakorlat 2009. 04. 24. Genomikavs. proteomika A genomika módszereivel nem a tényleges fehérjéket


Biomassza alapú bioalkohol előállítási technológia fejlesztése metagenomikai eljárással

Biomassza alapú bioalkohol előállítási technológia fejlesztése metagenomikai eljárással Biomassza alapú bioalkohol előállítási technológia fejlesztése metagenomikai eljárással Kovács Zoltán ügyvezető DEKUT Debreceni Kutatásfejlesztési Közhasznú Nonprofit Kft. Problémadefiníció Első generációs


Szerkesztette: Vizkievicz András

Szerkesztette: Vizkievicz András A mitokondrium Szerkesztette: Vizkievicz András Eukarióta sejtekben a lebontó folyamatok biológiai oxidáció - nagy része külön sejtszervecskékben, a mitokondriumokban zajlik. A mitokondriumokban folyik


Tipizálási módszerek alkalmazása methicillin-rezisztens Staphylococcus aureus (MRSA) törzsek molekuláris epidemiológiai vizsgálatai során

Tipizálási módszerek alkalmazása methicillin-rezisztens Staphylococcus aureus (MRSA) törzsek molekuláris epidemiológiai vizsgálatai során Tipizálási módszerek alkalmazása methicillin-rezisztens Staphylococcus aureus (MRSA) törzsek molekuláris epidemiológiai vizsgálatai során Ungvári Erika, Tóth Ákos Magyar Infektológiai és Klinikai Mikrobiológiai


Silhavy Dániel. A növényi génexpresszió RNS-szintű minőségbiztosítási rendszereinek molekuláris biológiája. című Doktori Értekezésének bírálata.

Silhavy Dániel. A növényi génexpresszió RNS-szintű minőségbiztosítási rendszereinek molekuláris biológiája. című Doktori Értekezésének bírálata. Silhavy Dániel A növényi génexpresszió RNS-szintű minőségbiztosítási rendszereinek molekuláris biológiája című Doktori Értekezésének bírálata. Bíráló: Dr. Szabados László, MTA doktora MTA Szegedi Biológiai



A 16-3 FÁG SZABÁLYOZÓ RÉGIÓI: REPRESSZOROK ÉS OPERÁTOROK SZENT ISTVÁN EGYETEM A 16-3 FÁG SZABÁLYOZÓ RÉGIÓI: REPRESSZOROK ÉS OPERÁTOROK Doktori értekezés tézisei Csiszovszki Zsolt Gödöllő 2003 A doktori iskola Megnevezése: Biológiatudományi Doktori Iskola Tudományága:


Johann Gregor Mendel Az olmüci (Olomouc) és bécsi egyetem diákja Brünni ágostonrendi apát (nem szovjet tudós) Tudatos és nagyon alapos kutat

Johann Gregor Mendel Az olmüci (Olomouc) és bécsi egyetem diákja Brünni ágostonrendi apát (nem szovjet tudós) Tudatos és nagyon alapos kutat 10.2.2010 genmisk1 1 Áttekintés Mendel és a mendeli törvények Mendel előtt és körül A genetika törvényeinek újbóli felfedezése és a kromoszómák Watson és Crick a molekuláris biológoa központi dogmája 10.2.2010


Fehérje szintézis 2. TRANSZLÁCIÓ Molekuláris biológia kurzus 7. hét. Kun Lídia Genetikai, Sejt- és immunbiológiai Intézet

Fehérje szintézis 2. TRANSZLÁCIÓ Molekuláris biológia kurzus 7. hét. Kun Lídia Genetikai, Sejt- és immunbiológiai Intézet Fehérje szintézis 2. TRANSZLÁCIÓ Molekuláris biológia kurzus 7. hét Kun Lídia Genetikai, Sejt- és immunbiológiai Intézet Gén mrns Fehérje Transzkripció Transzláció A transzkriptum : mrns Hogyan mutatható





Immunológiai módszerek a klinikai kutatásban

Immunológiai módszerek a klinikai kutatásban Immunológiai módszerek a klinikai kutatásban 3. előadás Az immunrendszer molekuláris elemei: antigén, ellenanyag, Ig osztályok Az antigén meghatározása Detre László: antitest generátor - Régi meghatározás:


Humán genom variációk single nucleotide polymorphism (SNP)

Humán genom variációk single nucleotide polymorphism (SNP) Humán genom variációk single nucleotide polymorphism (SNP) A genom ~ 97 %-a két különböző egyedben teljesen azonos ~ 1% különbség: SNP miatt ~2% különbség: kópiaszámbeli eltérés, deléciók miatt 11-12 millió


Poligénes v. kantitatív öröklődés

Poligénes v. kantitatív öröklődés 1. Öröklődés komplexebb sajátosságai 2. Öröklődés molekuláris alapja Poligénes v. kantitatív öröklődés Azok a tulajdonságokat amelyek mértékegységgel nem, vagy csak nehezen mérhetők, kialakulásuk kevéssé


1. Az élő szervezetek felépítése és az életfolyamatok 17

1. Az élő szervezetek felépítése és az életfolyamatok 17 Élődi Pál BIOKÉMIA vomo; Akadémiai Kiadó, Budapest 1980 Tartalom Bevezetés 1. Az élő szervezetek felépítése és az életfolyamatok 17 Mi jellemző az élőre? 17. Biogén elemek 20. Biomolekulák 23. A víz 26.



POSZTTRANSZLÁCIÓS MÓDOSÍTÁSOK: GLIKOZILÁLÁSOK POSZTTRANSZLÁCIÓS MÓDOSÍTÁSOK: GLIKOZILÁLÁSOK Dr. Pécs Miklós Budapesti Műszaki és Gazdaságtudományi Egyetem, Alkalmazott Biotechnológia és Élelmiszertudomány Tanszék 1 Glikozilálás A rekombináns fehérjék


Az IPD3 gén genetikai térképezése és szerepének vizsgálata a szimbiotikus kapcsolatok kialakításában Medicago truncatula-ban.

Az IPD3 gén genetikai térképezése és szerepének vizsgálata a szimbiotikus kapcsolatok kialakításában Medicago truncatula-ban. Az IPD3 gén genetikai térképezése és szerepének vizsgálata a szimbiotikus kapcsolatok kialakításában Medicago truncatula-ban Doktori értekezés Horváth Beatrix Eötvös Loránd Tudományegyetem, Természettudományi


Bokor Judit PhD. Szerz, cím, megjelenés helye, Szerz, cím, megjelenés helye, 2008. Szerz, cím, megjelenés. helye, PUBLIKÁCIÓ. Könyv, idegen nyelv

Bokor Judit PhD. Szerz, cím, megjelenés helye, Szerz, cím, megjelenés helye, 2008. Szerz, cím, megjelenés. helye, PUBLIKÁCIÓ. Könyv, idegen nyelv Bokor Judit PhD PUBLIKÁCIÓ Könyv, idegen nyelv Szerz, cím, megjelenés helye, 2006 Szerz, cím, megjelenés helye, 2007 Szerz, cím, megjelenés helye, 2008 Szerz, cím, megjelenés helye, 2009 Könyv, magyar



TUDOMÁNYOS ÉS SZAKMAI ÖNÉLETRAJZ TUDOMÁNYOS ÉS SZAKMAI ÖNÉLETRAJZ 1. Személyes adatok: Név: Menyhárd Attila Cím otthon: H-9024 Győr, Vécsey u. 14 I/1 Cím munkahely: ELTE Állam- és Jogtudományi Kar, Polgári Jogi Tanszék; H-1364 Budapest,


Mire költi a szervezet energiáját?

Mire költi a szervezet energiáját? Glükóz lebontás Lebontó folyamatok A szénhidrátok és zsírok lebontása során széndioxid és víz keletkezése közben energia keletkezik (a széndioxidot kilélegezzük, a vizet pedig szervezetünkben felhasználjuk).


Bakteriofág és bakteriális represszor vizsgálata in vivo és in vitro módszerekkel

Bakteriofág és bakteriális represszor vizsgálata in vivo és in vitro módszerekkel SZENT ISTVÁN EGYETEM Bakteriofág és bakteriális represszor vizsgálata in vivo és in vitro módszerekkel Doktori értekezés tézisei Ferenczi Szilamér Imre Gödöllő 2008 A doktori iskola megnevezése: Biológia





Dr. Máthéné Dr. Szigeti Zsuzsanna és munkatársai

Dr. Máthéné Dr. Szigeti Zsuzsanna és munkatársai Kar: TTK Tantárgy: CITOGENETIKA Kód: AOMBCGE3 ECTS Kredit: 3 A tantárgyat oktató intézet: TTK Mikrobiális Biotechnológiai és Sejtbiológiai Tanszék A tantárgy felvételére ajánlott félév: 3. Melyik félévben


A humán tripszinogén 4 expressziója és eloszlási mintázata az emberi agyban

A humán tripszinogén 4 expressziója és eloszlási mintázata az emberi agyban A humán tripszinogén 4 expressziója és eloszlási mintázata az emberi agyban Doktori (PhD) értekezés Siklódi Erika Rozália Biológia Doktori Iskola Iskolavezető: Prof. Erdei Anna, tanszékvezető egyetemi


Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Azonosító szám: TÁMOP-4.1.2-08/1/A-2009-0011 Az orvosi


Születési hely, idő: Keszthely, 1945. október 20.

Születési hely, idő: Keszthely, 1945. október 20. Dr. Nováky Erzsébet egyetemi tanár Budapesti Corvinus Egyetem Gazdaságföldrajz és Jövőkutatás Tanszék 1093 Budapest, Fővám tér 8. Tel. +36-1-482-5319 és +36-1-482-5325


A DmUsp5 dezubikvitiláz fiziológiai funkciójának meghatározása Drosophila melanogasterben. Kovács Levente

A DmUsp5 dezubikvitiláz fiziológiai funkciójának meghatározása Drosophila melanogasterben. Kovács Levente A DmUsp5 dezubikvitiláz fiziológiai funkciójának meghatározása Drosophila melanogasterben Doktori értekezés tézisei Kovács Levente Témavezető: Dr. Deák Péter, tanszékvezető, egyetemi docens SZTE TTIK Biológia


RNS-ek. 1. Az ősi RNS Világ: - az élet hajnalán. 2. Egy már ismert RNS Világ: - a fehérjeszintézis ben résztvevő RNS-ek

RNS-ek. 1. Az ősi RNS Világ: - az élet hajnalán. 2. Egy már ismert RNS Világ: - a fehérjeszintézis ben résztvevő RNS-ek RNS-ek RNS-ek 1. Az ősi RNS Világ: - az élet hajnalán 2. Egy már ismert RNS Világ: - a fehérjeszintézis ben résztvevő RNS-ek 3. Egy újonnan felfedezett RNS Világ: - szabályozó RNS-ek 4. Transzkripció 5.


Flagellin alapú filamentáris nanoszerkezetek létrehozása

Flagellin alapú filamentáris nanoszerkezetek létrehozása Flagellin alapú filamentáris nanoszerkezetek létrehozása Vonderviszt Ferenc PE MÜKKI Bio-Nanorendszerek Laboratórium MTA Enzimológiai Intézete MTA MFA Bakteriális flagellumok Flagelláris filamentum: ~10
