Bizonytalan Genotipizálás
|
|
- Kristóf Hegedűs
- 6 évvel ezelőtt
- Látták:
Átírás
1 Bizonytalan Genotipizálás Felkészülés A mérés során bizonytalan genotipizálási adatok osztályozását fogjuk vizsgálni. A mérésre fel kell készülni. A szükséges ismeretek megtalálhatók azt útmutató második felében, valamint a Neurális Hálózatok (Altrichter-Horváth-Pataki-Strausz-Valyon) c. könyv adik és edik oldalán (MLP és PCA). Valamint segít a felkészülésben, ha megismerkednek a Matlab használatával, szintaxisával. Mindenképpen nyissa meg az adat fájlt Excel-ben, hogy láthassa felépítését, valamint tartalmának jellegét! A mérésre házi feladattal kell készülni, és a mérés elején a kiadott melléklet alapján teszünk fel ellenörzı kérdéseket egy beugró ZH keretében (10 perc). A mérés háttere: A genotipizálási mérés során egyszerre sok egyed DNS-én tudjuk megvizsgálni az egyes helyeken levı allélokat. Elıször a begyőjtött mintákból kivonjuk a DNS-t, majd a számunkra érdekes területekrıl (A single nucleotide polymorphism -SNP-k azaz az egynukleotidos polimorfizmusok 150 bázispárnyi környezetérıl) másolatokat szaporítunk polimeráz láncreakcióval (PCR). A vad és mutáns allélokhoz tartozó DNS láncokat különbözı színő fluoreszcens festékkel festjük meg. Ezután a mintákat egy olyan sziliciumlapra helyezzük, amelyen a komplementer DNS láncok helyezkednek el. A szaporított minták ezekhez kötıdve bizonyos hullámhosszok alatt fluoreszkálnak. Ekkor készítünk a két színcsatorna alatt egy-egy felvételt, majd a késıbbiekben részletezett képfeldolgozási eljárással megfigyeljük az egyes pontok fényességét, valamint a pontok további jellemzıit is rögzítjük. Ezután az egy SNP-hez tartozó mintákat összegyőjtjük, és egy diagrammon ábrázoljuk. A diagramm X tengelye a minta színaránya. Ha a pont teljesen kék, akkor jobbra, ha teljesen zöld akkor pedig balra kerül. Az Y tengely pedig a pontok összegzett intenzitása. -1-
2 A mintapontok naív klaszterezése adja meg a genotípust, de ez nem felel meg teljesen a valós genotípusnak, a mérés megbízhatatlansága miatt. Egy jelentısen drágább módszerrel történı validáció során pontosan megállapíthatjuk az egyedek genotípusát. A validációt felhasználva szeretnénk megállapítani hogy milyen paraméterek mellett valószínő hogy a mérés hibás genotípust fog az egyedhez hozzárendelni. A megoldások minıségét az ROC (receiver operating characteristics) görbével tudjuk szemléletesen ábrázolni. A görbe a megoldás érzékenységét veti össze a specifikusságával. Ellenırzı kérdések: Mi az a PCA? Milyen tengelyek szerepelnek az ROC görbén? Mire használjuk a mérés kezdeti fázisában a PCR-t? Milyen jellegü zavart okozhatnak a rendkívül zajos paraméterek egy MLP tanításában ha kevés tanító pontunk van és nagy az adatdimenzió? Házi Feladat: Készítsen Matlab környezethez egy függvényt amely képes kiszámítani egy ROC görbe alatti területet! A mérés menete: A mérés során a Matlab neural network és statistics toolbox-ait (errıl a mérésvezetı rövid ismertetést ad igény szerint a mérés elején) fogjuk használni. Érdemes már otthon is, ha van lehetısége rá, megismerkedni a neural network toolbox-al. Az adatmátrix egy sora egy adott bemeneti minta. Az elıkészített adatok letölthetık a tárgy honlapjáról a BIR_1meres_data.csv állományból -2-
3 ( a megértést segíti a segédletben adott paramétermagyarázat. Töltse le, és ismerkedjen meg az adatokkal! A mérés során jegyzıkönyvet kell készíteni. A jegyzıkönyv lényegre törı, világos kell legyen. Minden feladnál tartalmaznia kell a feladat megfogalmazását, a megoldás menetének fıbb részleteit, az eredményeket és az eredmények értékelését. 1. feladat A. Importálja az adat fájlt, és válassza külön a késıbbi bemeneti és célváltozákat a segédletben megadott információk alapján! A célváltozó legyen a Clustering_error_bool, míg a bemeneti változók legyenek a tıle jobbra levı oszlopok értékei. A matlab/file menu/import paranccsal lehet betolteni (next next finish). Ügyeljen arra, hogy a Matlab importálásnál szétválasztja a csv fájlt numerikus és szöveges részekre! B. Vizsgálja meg PCA-val a bemeneti adatok legnagyobb sajátértékeit! Figyelje meg hogy mennyi sajátvektorral tudja a jól (>99%) kifeszíteni a mintahalmaz varianciáját! Használja a princomp() függvényt! Használja a help princomp parancsot, ha elakad az adatok értelmezésében! [COEFF,SCORE,latent] = princomp(x) C. Dimenzióredukció: transzformálja az az adatait az 1-5 legnagyobb variancát megırzı sajátvektorok terébe, valamint a 3 legjobb és két véletlenszerően választott sajátvektor terébe! 2. feladat A. Vizsgálja meg meg a két kitüntetett sajátvektor definiálta biplotban a változókat és az adatokat a három legjobb sajátvektor terében! (természetesen azért csak három mert ennél több dimenziót nehézkes lenne vizualizálni) Lát-e valamilyen szeparációt a pontok között? Ha igen, készítsen róla képernyımentést. biplot(coeffs(:,1:3),'scores',score(:,1:3)) 3. feladat A. Tanítson egy bináris kimenető osztályozó perceptront (az nntool eszközzel) az ismert validáció alapján (Clustering_error_bool) a legjobb PCA származtatott értékeket felhasználva! Értékelje a kapott hálózat eredményét! Ne felejtse transzponálni az adatait, hogy a bemeneti minták oszlopokban helyezkedjenek el. -3-
4 B. Tanítson egy egy rejtett rétegő, maximálisan bemenetek száma neuronnal rendelkezı MLP-t a hiba predikciójára az ismert validáció (klaszterezési hiba), valamint az elızıekben kiválasztott paraméterek alapján. Ez lesz a visszautasítási modellje, amelyet tovább kell vizsgálnia. Készítsen MLP-t a teljes bemeneti adathalmazzal, valamint az 1-5 legjobb származtattot PCA paraméterrel és a 3 legjobb és 2 véletlenszerően választott paraméterrel is! 4. feladat A. Vizsgálja az elızı feladatban elkészített modellek specifikusságának és érzékenységének alakulását egy elutasítási küszöb paraméter segítségével! Ábrázolja az ROC görbét a roc és a plotroc függvények segítségével! [tpr,fpr,thresholds] = roc(targets,outputs) B. Számolja ki a görbe alatti területeket és értékelje az egyes modellek teljesítményét a házi feladatként elkészített ROC görbe alatti területet kiszámoló függvénye segítségével! 5. feladat Válassza ki a szerinte legjobban teljesítı modellt (választását indokolja) és számítsa ki a hibamodell költségét az alábbi költségmátrix alapján, valamint rajzoljon fel súlyozott hasznossági görbét is a mátrix alapján! Ehhez írjon egy függvényt amely az alábbi módon súlyozza a hibát: -4-
5 Költségmátrix: Taqman/RawRead AA (0) AG (1) GG (-1) Eldobási költség AA (Sum-SumAA)/Sum = AG (Sum-SumAG)/Sum=0.658 GG (Sum-SumGG)/Sum = A mátrix 3x3 as része azt adja meg, hogy milyen költséget rendelünk ahhoz, hogy egy genotípust hibásan adunk meg. Látható, hogy egy klasztert tévedni 1-be kerül, míg két klaszterrel arébb sorolni a mintát jóval drágább (AA helyett GG). A mátrix utólsó oszlopa pedig az eldobás költségét adja meg, amely értelemszerően alacsonyabb, mint a hibás válasz adása, és ára attól függ, hogy hány darab olyan mintánk volt az egész mérésben. Értelemszerően a ritkább halmazba tartozó mérés eldobása drágább. 6. feladat (Bónusz feladat) Vizsgálja meg az Asztma es a genotipus (Taqman) korrelaciojat! -5-
6 1. Introduction to genotyping. The distinct stages of the genotyping measurement are followed by complex post processing. First we apply digital image processing algorithms to the raw image information to produce real parameter values, which are then clustered to produce the nominal results of the measurement. The genomic SNP Core Facility laboratory at the Department of Genetics Celland Immunobiology of the Semmelweis University also has to face the same problems as mentioned before. Beside commercial measurements the laboratory investigates the genetic backgrounds of various diseases such as asthma and allergy. In the course of their work, the researchers want to explore the genetic causes of the diseases, therefore it is essential to define the SNPs associated with the illness. 2. Terminology 2.1. Genome The genome contains the entire hereditary information of living organisms, which in most cases is coded by DNA. The expression was created by merging the words gene and chromosome by Hans Winkler, botanics Professor of the University of Hamburg in DNA is a nucleic acid with the shape of a double spiral that is created by the connections of four nucleotide base pairs; adenine (abbreviated A), cytosine (C), guanine (G) and thymine (T). The spiral is held together by the complementary bases on each strand. Adenine and thymine and are connected by double hydrogen bonds, while cytosine and guanine are connected by triple hydrogen bonds. DNA strands in the genome are organized into chromosomes, and are present in the human body in the form of two homologous chromosomes, forming a chromosome pair. In human cells there are 23 pairs of chromosomes, each member of the pairs originates from one of the parents. The corresponding loci of the homologous chromosome pairs are called alleles, thus the human chromosomes are usually biallelic. The phenotype is any observable characteristic or trait of an organism; such as its morphology, biochemical or physical properties or behavior Genotype The genotype is the genetic trait that cannot be directly observed. It is the specific genetic sequence of a cell, and organism, or an individual, i.e. the specific allele make up of the individual. Genotyping is the process of determining the genotype of an individual by the use of biological assays. It provides measurement of the genetic variation between members of a species Single nucleotide polymorphisms Single nucleotide polymorphisms (SNP, pronounced snip ) are the most common type of genetic variation. A SNP is a single base pair mutation at a specific locus, usually -6-
7 consisting of two alleles (where the rare allele frequency is 1%). SNPs are often found to be the biomarkers of many human diseases and are becoming of particular interest in pharmacogenetics. A SNP is a DNA sequence variation occurring when a single nucleotide A, T, C, or G in the genome (or other shared sequence) differs between members of a species (or between paired chromosomes in an individual). For example, two sequenced DNA fragments from different individuals, AAGCCTA to AAGCTTA, contain a difference in a single nucleotide. In this case we say that there are two alleles : C and T. Almost all common SNPs have only two alleles. Within a population, SNPs can be assigned a minor allele frequency the lowest allele frequency at a locus that is observed in a particular population. This is simply the lesser of the two allele frequencies for single-nucleotide polymorphisms. There are variations between human populations, so a SNP allele that is common in one geographical or ethnic group may be much rarer in another. Variations in the DNA sequences of humans can affect how humans develop diseases and respond to pathogens, chemicals, drugs, vaccines, and other agents. SNPs are also thought to be key enablers in realizing the concept of personalized medicine. However, their greatest importance in biomedical research is for comparing regions of the genome between cohorts (such as with matched cohorts with and without a disease 2.4. Genotyping methods and the biochemistry of genotyping Beckman Coulter s GenomeLab SNPstream Genotyping System The GenomeLab SNPstream Genotyping System utilizes a proprietary method called SNP Identification Technology for the detection of single nucleotide polymorphisms (SNPs). SNP Identification Technology is a non-radioactive, single-base primer extension method that can be performed in a variety of formats. It relies upon the ability of DNA polymerase to incorporate dye labeled terminators to distinguish genotypes Probe/Tag Technology The SNP Identification Technology method is informative because it provides direct determination of the variant nucleotides. SNP Identification Technology also provides significant research accuracy to genotyping because it incorporates after PCR a two-tiered detection utilizing base-specific extension by polymerase followed by hybridization-capture. This two-tiered detection step ensures accurate and highly discriminant analysis. The hybridization capture step utilizes a tag-probe approach. The SNP Identification Technology primer is a single strand DNA containing a template specific sequence appended to a 5 non-template specific sequence. Tag refers to the sequence attached to the SNP Identification Technology primer that is captured by specific probe bound to glass surface. The probe refers to a unique DNA sequence attached to the glass surface of every well in a 384 tag-array plate that specifically hybridizes to one tag. The probes bound covalently to the glass surface enable the interrogation of up to 12-plexed or 48-plexed nucleic acid reaction products. The SNP reaction product into which the tag -7-
8 has been incorporated will hybridize to the corresponding probe bound covalently to the glass surface SNP Assay SNP biochemistry for the GenomeLab SNPstream Genotyping System involves the following steps, as shown schematically after multiplex PCR amplification, amplicons containing the SNP of interest (step 1), unincorporated nucleotides and primers are removed enzymatically (step 2). In step 3, extension mix and a pool of tagged SNPware primers are added to the treated PCR. SNPware primers hybridize to specific amplicons in the multiplex reaction, one base 3' to the SNP sites. The tagged primers are extended in a two-dye system, by incorporation of a fluorescent labeled chain terminating acyclonucleotide. Two-color detection allows determination of the genotype by comparing signals from the two fluorescent dyes. SNP Identification technology for SNPStream The extended SNPware primers are then specifically hybridized to unique probes arrayed in each well. The arrayed probes capture the extended products (step 4) and allow for the detection of each SNP allele signal (step 5). Stringent washes remove free dyeterminators and DNA not hybridized to specific probes Control spots -8-
9 Two self-extending control oligonucleotides are included in each extension master mix and are extended with either the blue or green dye-labeled terminator during the primer extension thermal cycling. The array of capture oligonucleotides attached to the glass surface in each well of a 384-well plate includes three positive controls and one negative control. The XY control spot is a heterozygous control which has a mixture of two capture probes that allow hybridization of both blue and green control oligonucleotides. The XX control spot has a capture probe that allows hybridization of the blue control oligonucleotide. The YY control spot has a capture probe that allows hybridization of the green control oligonucleotide. Control spots and spot layout for 48plex plates 3. Image processing overview and image based quality parameters 3.1 Noise patterns Calculating the intensity is not merely enough to obtain reliable genotyping data from the scanned images, since many artifacts and errors can distort the scanned image, such as those shown below Noisy images Specs of dust on the plate Marks left by residual chemicals from the PCR reaction -9-
10 Banding caused by improper wiping of a plate before scanning (very rare but can be severe) The scanner is not centered above the well, so some spots may be partially missing as well as the measurements from the whole well being false Image Processing Overview -10-
11 First, we read the corresponding 16 bit raw images for each w ell: We normalize these images to 8 bits for better visibility by the operator, and because most OpenCV image processing functions only accept 8 bit images as inputs. We also slightly expand the image in all four directions, by a few pixels, to aid in the recognition and recovery of images where the scanner head isnt centered on the well. An optional median smoothing filter can be applied, this removes a great deal of unwanted noise w hile leaving the features of the image intact Grid template Next, we use a template matching algorithm for finding suitable candidate positions for our spot grid. The spot grid is a simple 48 or 12 spot grid, depending on the type of plate being analyzed. The difference betw een the grid and the input image in each pixel spot is then calc ulated, and the result stored in an image. -11-
12 The template matching results constitute a parameter space, of where the grid is most likely to be a match. Low values (darker colors) mean less squared difference from the grid template. Therefore we will select the low est local minima on the images as candidates for grid alignment. For each grid candidate position, we check for the control spots. Each w ell should have at least tw o control spots, the combined control spot and the specific c olor control spot. The grid position is chosen from the candidates based on the brightest control spots. Once the most likely grid position is determined, w e have to deal w ith the fact that the spots inside our grid might not be perfectly aligned to the grid, since the resolution of the image is quite low. So for each spot, another template matching algorithm is run on the direct vicinity of the spot, to determine the maximum likelihood of the spots exact position. Artifact noise is calculated by checking 8 pixels around a spot, and creating a noise gradient along these spots with linear interpolation. Artifact noise is subtracted from the images -12-
13 4. Data file format plate_id well_id sample_id Asthma Target variables TaqMan Rawread_HW_clustering Taqman_int Rawread_int Clustering_error_int Clustering_error_bool Shows which plate the sample originated from, 2 plates in total Shows which well the sample was in, wells are marked from a01 to p24 Identifier of the sample, eg which person the DNA came from Shows wether the patient had Asthma or not (1=true) Results of validation Our genotype calls (inaccurate, based on a greedy clustering method Same as previous, but in integer form (-1= AA, 0=AG, 1=GG) Clustering error abs(target variable- our result) Boolean clustering error Input variables totalnoiseb Total amount of noise in the blue channel, as calculated from the artifact supression snr_b Signal to noise ratio in blue channel totalnoiseg Total amount of noise in the green channel, as calculated from the artifact supression snr_g Signal to noise ratio in blue channel certainty Distance from cluster center certaintygradient Weighted distance from cluster center (lower intensity is punished more) intensity_b+g Total sum of the intensity of the blue and green spots intensity_b/b+g Ratio of blue to green channel brightness, where 1=all blue and = all green logavgb Average blue intensity across the spot. logintensityb Blue channel intensity sum logintensity varianceb Intensity variance over the spot (see processing flowchart) logcircularityb Metric of circulatiry, low values mean uniform circles, high values are more amorphous logbasenoiseb Base noise level for the spot logartifact corrected intensityb Artifact suppressed intensity rating, this value is used to calculate the clustering plots. logcorner1b logcorner2b logcorner3b logcorner4b logcorner5b logcorner6b logcorner7b logcorner8b logcenterb Intensity values on the 8 corners of the spot image, and the intensity of the images in the center point. Note: Be wary when -13-
14 using these parameters, as they do not represent too much useful information with relation to the genotype or the error of the sample. They can be regarded as quasi random variables. logavgg logintensityg logintensity varianceg logcircularityg logbasenoiseg logartifact corrected intensityg logcorner1g logcorner2g logcorner3g logcorner4g logcorner5 logcorner6g logcorner7g logcorner8g logcenterg Same as previous, but for the green channel. 6. Appendices: Plate number: Collected view for SNP RS7167 Each collected sample for this SNP is shown on the image below. Blue and green spots are placed next to each other while the bottom half of the image shows the version with artifact suppression. Unclustered plot: -14-
15 K-means clustering: Blue view for plate: Green view for plate: -15-
16 Plate number: : Collected view: -16-
17 Unclustered plot: Simple K-means clustered plot: -17-
18 Blue view for plate: Green view for plate: 18
19 19
Correlation & Linear Regression in SPSS
Petra Petrovics Correlation & Linear Regression in SPSS 4 th seminar Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Correlation
Cluster Analysis. Potyó László
Cluster Analysis Potyó László What is Cluster Analysis? Cluster: a collection of data objects Similar to one another within the same cluster Dissimilar to the objects in other clusters Cluster analysis
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Correlation & Linear. Petra Petrovics.
Correlation & Linear Regression in SPSS Petra Petrovics PhD Student Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise
Correlation & Linear Regression in SPSS
Correlation & Linear Regression in SPSS Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise 1 - Correlation File / Open
Supplementary Figure 1
Supplementary Figure 1 Plot of delta-afe of sequence variants detected between resistant and susceptible pool over the genome sequence of the WB42 line of B. vulgaris ssp. maritima. The delta-afe values
Supplementary materials to: Whole-mount single molecule FISH method for zebrafish embryo
Supplementary materials to: Whole-mount single molecule FISH method for zebrafish embryo Yuma Oka and Thomas N. Sato Supplementary Figure S1. Whole-mount smfish with and without the methanol pretreatment.
Supporting Information
Supporting Information Cell-free GFP simulations Cell-free simulations of degfp production were consistent with experimental measurements (Fig. S1). Dual emmission GFP was produced under a P70a promoter
Construction of a cube given with its centre and a sideline
Transformation of a plane of projection Construction of a cube given with its centre and a sideline Exercise. Given the center O and a sideline e of a cube, where e is a vertical line. Construct the projections
Phenotype. Genotype. It is like any other experiment! What is a bioinformatics experiment? Remember the Goal. Infectious Disease Paradigm
It is like any other experiment! What is a bioinformatics experiment? You need to know your data/input sources You need to understand your methods and their assumptions You need a plan to get from point
Using the CW-Net in a user defined IP network
Using the CW-Net in a user defined IP network Data transmission and device control through IP platform CW-Net Basically, CableWorld's CW-Net operates in the 10.123.13.xxx IP address range. User Defined
Mapping Sequencing Reads to a Reference Genome
Mapping Sequencing Reads to a Reference Genome High Throughput Sequencing RN Example applications: Sequencing a genome (DN) Sequencing a transcriptome and gene expression studies (RN) ChIP (chromatin immunoprecipitation)
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Factor Analysis
Factor Analysis Factor analysis is a multiple statistical method, which analyzes the correlation relation between data, and it is for data reduction, dimension reduction and to explore the structure. Aim
Statistical Dependence
Statistical Dependence Petra Petrovics Statistical Dependence Deinition: Statistical dependence exists when the value o some variable is dependent upon or aected by the value o some other variable. Independent
Supplementary Table 1. Cystometric parameters in sham-operated wild type and Trpv4 -/- rats during saline infusion and
WT sham Trpv4 -/- sham Saline 10µM GSK1016709A P value Saline 10µM GSK1016709A P value Number 10 10 8 8 Intercontractile interval (sec) 143 (102 155) 98.4 (71.4 148) 0.01 96 (92 121) 109 (95 123) 0.3 Voided
Klaszterezés, 2. rész
Klaszterezés, 2. rész Csima Judit BME, VIK, Számítástudományi és Információelméleti Tanszék 208. április 6. Csima Judit Klaszterezés, 2. rész / 29 Hierarchikus klaszterezés egymásba ágyazott klasztereket
Contact us Toll free (800) fax (800)
Table of Contents Thank you for purchasing our product, your business is greatly appreciated. If you have any questions, comments, or concerns with the product you received please contact the factory.
Statistical Inference
Petra Petrovics Statistical Inference 1 st lecture Descriptive Statistics Inferential - it is concerned only with collecting and describing data Population - it is used when tentative conclusions about
STUDENT LOGBOOK. 1 week general practice course for the 6 th year medical students SEMMELWEIS EGYETEM. Name of the student:
STUDENT LOGBOOK 1 week general practice course for the 6 th year medical students Name of the student: Dates of the practice course: Name of the tutor: Address of the family practice: Tel: Please read
SOLiD Technology. library preparation & Sequencing Chemistry (sequencing by ligation!) Imaging and analysis. Application specific sample preparation
SOLiD Technology Application specific sample preparation Application specific data analysis library preparation & emulsion PCR Sequencing Chemistry (sequencing by ligation!) Imaging and analysis SOLiD
A rosszindulatú daganatos halálozás változása 1975 és 2001 között Magyarországon
A rosszindulatú daganatos halálozás változása és között Eredeti közlemény Gaudi István 1,2, Kásler Miklós 2 1 MTA Számítástechnikai és Automatizálási Kutató Intézete, Budapest 2 Országos Onkológiai Intézet,
Széchenyi István Egyetem www.sze.hu/~herno
Oldal: 1/6 A feladat során megismerkedünk a C# és a LabVIEW összekapcsolásának egy lehetőségével, pontosabban nagyon egyszerű C#- ban írt kódból fordítunk DLL-t, amit meghívunk LabVIEW-ból. Az eljárás
Flowering time. Col C24 Cvi C24xCol C24xCvi ColxCvi
Flowering time Rosette leaf number 50 45 40 35 30 25 20 15 10 5 0 Col C24 Cvi C24xCol C24xCvi ColxCvi Figure S1. Flowering time in three F 1 hybrids and their parental lines as measured by leaf number
FAMILY STRUCTURES THROUGH THE LIFE CYCLE
FAMILY STRUCTURES THROUGH THE LIFE CYCLE István Harcsa Judit Monostori A magyar társadalom 2012-ben: trendek és perspektívák EU összehasonlításban Budapest, 2012 november 22-23 Introduction Factors which
(c) 2004 F. Estrada & A. Jepson & D. Fleet Canny Edges Tutorial: Oct. 4, '03 Canny Edges Tutorial References: ffl imagetutorial.m ffl cannytutorial.m
Canny Edges Tutorial: Oct. 4, '03 Canny Edges Tutorial References: ffl imagetutorial.m ffl cannytutorial.m ffl ~jepson/pub/matlab/isetoolbox/tutorials ffl ~jepson/pub/matlab/utvistoolbox/tutorials ffl
Rezgésdiagnosztika. Diagnosztika 02 --- 1
Rezgésdiagnosztika Diagnosztika 02 --- 1 Diagnosztika 02 --- 2 A rezgéskép elemzésével kimutatható gépészeti problémák Minden gép, mely tartalmaz forgó részt (pl. motor, generátor, szivattyú, ventilátor,
Proxer 7 Manager szoftver felhasználói leírás
Proxer 7 Manager szoftver felhasználói leírás A program az induláskor elkezdi keresni az eszközöket. Ha van olyan eszköz, amely virtuális billentyűzetként van beállítva, akkor azokat is kijelzi. Azokkal
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Nonparametric Tests
Nonparametric Tests Petra Petrovics Hypothesis Testing Parametric Tests Mean of a population Population proportion Population Standard Deviation Nonparametric Tests Test for Independence Analysis of Variance
Geokémia gyakorlat. 1. Geokémiai adatok értelmezése: egyszerű statisztikai módszerek. Geológus szakirány (BSc) Dr. Lukács Réka
Geokémia gyakorlat 1. Geokémiai adatok értelmezése: egyszerű statisztikai módszerek Geológus szakirány (BSc) Dr. Lukács Réka MTA-ELTE Vulkanológiai Kutatócsoport e-mail: reka.harangi@gmail.com ALAPFOGALMAK:
Genome 373: Hidden Markov Models I. Doug Fowler
Genome 373: Hidden Markov Models I Doug Fowler Review From Gene Prediction I transcriptional start site G open reading frame transcriptional termination site promoter 5 untranslated region 3 untranslated
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Hypothesis Testing. Petra Petrovics.
Hypothesis Testing Petra Petrovics PhD Student Inference from the Sample to the Population Estimation Hypothesis Testing Estimation: how can we determine the value of an unknown parameter of a population
Nagy áteresztő képességű SNP mérések hasznosítása. Dr. Szalai Csaba
Nagy áteresztő képességű SNP mérések hasznosítása Dr. Szalai Csaba 1 2 SNP-k SNP = single nucleotide polymorphism = kb. pontmutáció Általában biallélikusak, általában funkcionálisan semlegesek Több mint
INDEXSTRUKTÚRÁK III.
2MU05_Bitmap.pdf camü_ea INDEXSTRUKTÚRÁK III. Molina-Ullman-Widom: Adatbázisrendszerek megvalósítása Panem, 2001könyv 5.4. Bittérkép indexek fejezete alapján Oracle: Indexek a gyakorlatban Oracle Database
16F628A megszakítás kezelése
16F628A megszakítás kezelése A 'megszakítás' azt jelenti, hogy a program normális, szekvenciális futása valamilyen külső hatás miatt átmenetileg felfüggesztődik, és a vezérlést egy külön rutin, a megszakításkezelő
Trinucleotide Repeat Diseases: CRISPR Cas9 PacBio no PCR Sequencing MFMER slide-1
Trinucleotide Repeat Diseases: CRISPR Cas9 PacBio no PCR Sequencing 2015 MFMER slide-1 Fuch s Eye Disease TCF 4 gene Fuchs occurs in about 4% of the US population. Leads to deteriorating vision without
Descriptive Statistics
Descriptive Statistics Petra Petrovics DESCRIPTIVE STATISTICS Definition: Descriptive statistics is concerned only with collecting and describing data Methods: - statistical tables and graphs - descriptive
Computer Architecture
Computer Architecture Locality-aware programming 2016. április 27. Budapest Gábor Horváth associate professor BUTE Department of Telecommunications ghorvath@hit.bme.hu Számítógép Architektúrák Horváth
Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz
Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz Kvantumkapuk, áramkörök 2016. március 3. A kvantummechanika posztulátumai (1-2) 1. Állapotleírás Zárt fizikai rendszer aktuális állapota
Expression analysis of PIN genes in root tips and nodules of Lotus japonicus
Article Expression analysis of PIN genes in root tips and nodules of Lotus japonicus Izabela Sańko-Sawczenko 1, Dominika Dmitruk 1, Barbara Łotocka 1, Elżbieta Różańska 1 and Weronika Czarnocka 1, * 1
Választási modellek 3
Választási modellek 3 Prileszky István Doktori Iskola 2018 http://www.sze.hu/~prile Forrás: A Self Instructing Course in Mode Choice Modeling: Multinomial and Nested Logit Models Prepared For U.S. Department
Create & validate a signature
IOTA TUTORIAL 7 Create & validate a signature v.0.0 KNBJDBIRYCUGVWMSKPVA9KOOGKKIRCBYHLMUTLGGAV9LIIPZSBGIENVBQ9NBQWXOXQSJRIRBHYJ9LCTJLISGGBRFRTTWD ABBYUVKPYFDJWTFLICYQQWQVDPCAKNVMSQERSYDPSSXPCZLVKWYKYZMREAEYZOSPWEJLHHFPYGSNSUYRZXANDNQTTLLZA
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel Timea Farkas Click here if your download doesn"t start
Csima Judit április 9.
Osztályozókról még pár dolog Csima Judit BME, VIK, Számítástudományi és Információelméleti Tanszék 2018. április 9. Csima Judit Osztályozókról még pár dolog 1 / 19 SVM (support vector machine) ez is egy
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében. Dicse Jenő üzletfejlesztési igazgató
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében Dicse Jenő üzletfejlesztési igazgató How to apply modern e-learning to improve the training of firefighters Jenő Dicse Director of
On The Number Of Slim Semimodular Lattices
On The Number Of Slim Semimodular Lattices Gábor Czédli, Tamás Dékány, László Ozsvárt, Nóra Szakács, Balázs Udvari Bolyai Institute, University of Szeged Conference on Universal Algebra and Lattice Theory
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Correlation & Regression
Correlation & Regression Types of dependence association between nominal data mixed between a nominal and a ratio data correlation among ratio data Correlation describes the strength of a relationship,
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY A feladatsor három részbol áll 1. A vizsgáztató társalgást kezdeményez a vizsgázóval. 2. A vizsgázó egy szituációs feladatban vesz részt a
Lecture 11: Genetic Algorithms
Lecture 11 1 Linear and Combinatorial Optimization Lecture 11: Genetic Algorithms Genetic Algorithms - idea Genetic Algorithms - implementation and examples Lecture 11 2 Genetic algorithms Algorithm is
7 th Iron Smelting Symposium 2010, Holland
7 th Iron Smelting Symposium 2010, Holland Október 13-17 között került megrendezésre a Hollandiai Alphen aan den Rijn városában található Archeon Skanzenben a 7. Vasolvasztó Szimpózium. Az öt napos rendezvényen
General information for the participants of the GTG Budapest, 2017 meeting
General information for the participants of the GTG Budapest, 2017 meeting Currency is Hungarian Forint (HUF). 1 EUR 310 HUF, 1000 HUF 3.20 EUR. Climate is continental, which means cold and dry in February
discosnp demo - Peterlongo Pierre 1 DISCOSNP++: Live demo
discosnp demo - Peterlongo Pierre 1 DISCOSNP++: Live demo Download and install discosnp demo - Peterlongo Pierre 3 Download web page: github.com/gatb/discosnp Chose latest release (2.2.10 today) discosnp
Performance Modeling of Intelligent Car Parking Systems
Performance Modeling of Intelligent Car Parking Systems Károly Farkas Gábor Horváth András Mészáros Miklós Telek Technical University of Budapest, Hungary EPEW 2014, Florence, Italy Outline Intelligent
SAJTÓKÖZLEMÉNY Budapest 2011. július 13.
SAJTÓKÖZLEMÉNY Budapest 2011. július 13. A MinDig TV a legdinamikusabban bıvülı televíziós szolgáltatás Magyarországon 2011 elsı öt hónapjában - A MinDig TV Extra a vezeték nélküli digitális televíziós
University of Bristol - Explore Bristol Research
Al-Salihi, S. A. A., Scott, T. A., Bailey, A. M., & Foster, G. D. (2017). Improved vectors for Agrobacterium mediated genetic manipulation of Hypholoma spp. and other homobasidiomycetes. Journal of Microbiological
Tudományos Ismeretterjesztő Társulat
Sample letter number 5. International Culture Festival PO Box 34467 Harrogate HG 45 67F Sonnenbergstraße 11a CH-6005 Luzern Re: Festival May 19, 2009 Dear Ms Atkinson, We are two students from Switzerland
First experiences with Gd fuel assemblies in. Tamás Parkó, Botond Beliczai AER Symposium 2009.09.21 25.
First experiences with Gd fuel assemblies in the Paks NPP Tams Parkó, Botond Beliczai AER Symposium 2009.09.21 25. Introduction From 2006 we increased the heat power of our units by 8% For reaching this
SQL/PSM kurzorok rész
SQL/PSM kurzorok --- 2.rész Tankönyv: Ullman-Widom: Adatbázisrendszerek Alapvetés Második, átdolgozott kiadás, Panem, 2009 9.3. Az SQL és a befogadó nyelv közötti felület (sormutatók) 9.4. SQL/PSM Sémában
HALLGATÓI KÉRDŐÍV ÉS TESZT ÉRTÉKELÉSE
HALLGATÓI KÉRDŐÍV ÉS TESZT ÉRTÉKELÉSE EVALUATION OF STUDENT QUESTIONNAIRE AND TEST Daragó László, Dinyáné Szabó Marianna, Sára Zoltán, Jávor András Semmelweis Egyetem, Egészségügyi Informatikai Fejlesztő
PIACI HIRDETMÉNY / MARKET NOTICE
PIACI HIRDETMÉNY / MARKET NOTICE HUPX DAM Másnapi Aukció / HUPX DAM Day-Ahead Auction Iktatási szám / Notice #: Dátum / Of: 18/11/2014 HUPX-MN-DAM-2014-0023 Tárgy / Subject: Változások a HUPX másnapi piac
Modular Optimization of Hemicellulose-utilizing Pathway in. Corynebacterium glutamicum for Consolidated Bioprocessing of
[Supplementary materials] Modular Optimization of Hemicellulose-utilizing Pathway in Corynebacterium glutamicum for Consolidated Bioprocessing of Hemicellulosic Biomass Sung Sun Yim 1, Jae Woong Choi 1,
EN United in diversity EN A8-0206/419. Amendment
22.3.2019 A8-0206/419 419 Article 2 paragraph 4 point a point i (i) the identity of the road transport operator; (i) the identity of the road transport operator by means of its intra-community tax identification
TestLine - Angol teszt Minta feladatsor
Minta felaatsor venég Téma: Általános szintfelmérő Aláírás:... Dátum: 2016.05.29 08:18:49 Kérések száma: 25 kérés Kitöltési iő: 1:17:27 Nehézség: Összetett Pont egység: +6-2 Értékelés: Alaértelmezett értékelés
Can/be able to. Using Can in Present, Past, and Future. A Can jelen, múlt és jövő idejű használata
Can/ Can is one of the most commonly used modal verbs in English. It be used to express ability or opportunity, to request or offer permission, and to show possibility or impossibility. A az egyik leggyakrabban
Ültetési és öntözési javaslatok. Planting and watering instructions
Ültetési és öntözési javaslatok Planting and watering instructions 1 Önöntöző-rendszer Sub-irrigation 2 Kedves növénykedvelő A LECHUZA önöntöző rendszerrel növényeink természetüknél fogva gyönyörű virágokat
KN-CP50. MANUAL (p. 2) Digital compass. ANLEITUNG (s. 4) Digitaler Kompass. GEBRUIKSAANWIJZING (p. 10) Digitaal kompas
KN-CP50 MANUAL (p. ) Digital compass ANLEITUNG (s. 4) Digitaler Kompass MODE D EMPLOI (p. 7) Boussole numérique GEBRUIKSAANWIJZING (p. 0) Digitaal kompas MANUALE (p. ) Bussola digitale MANUAL DE USO (p.
Kvantum-informatika és kommunikáció 2015/2016 ősz. A kvantuminformatika jelölésrendszere szeptember 11.
Kvantum-informatika és kommunikáció 2015/2016 ősz A kvantuminformatika jelölésrendszere 2015. szeptember 11. Mi lehet kvantumbit? Kvantum eszközök (1) 15=5 3 Bacsárdi Képek forrása: IBM's László, Almaden
PETER PAZMANY CATHOLIC UNIVERSITY Consortium members SEMMELWEIS UNIVERSITY, DIALOG CAMPUS PUBLISHER
SEMMELWEIS UNIVERSITY PETER PAMANY CATLIC UNIVERSITY Development of Complex Curricula for Molecular Bionics and Infobionics Programs within a consortial* framework** Consortium leader PETER PAMANY CATLIC
NYOMÁSOS ÖNTÉS KÖZBEN ÉBREDŐ NYOMÁSVISZONYOK MÉRÉTECHNOLÓGIAI TERVEZÉSE DEVELOPMENT OF CAVITY PRESSURE MEASUREMENT FOR HIGH PRESURE DIE CASTING
Anyagmérnöki Tudományok, 39/1 (2016) pp. 82 86. NYOMÁSOS ÖNTÉS KÖZBEN ÉBREDŐ NYOMÁSVISZONYOK MÉRÉTECHNOLÓGIAI TERVEZÉSE DEVELOPMENT OF CAVITY PRESSURE MEASUREMENT FOR HIGH PRESURE DIE CASTING LEDNICZKY
Formula Sound árlista
MIXERS FF-6000; FF6000P Formula Sound 160 6 channel dual format DJ mixer with removable fader panel. (Supplied with linear faders) Formula Sound 160P As above but with PRO X crossfade fitted. Formula Sound
Forensic SNP Genotyping using Nanopore MinION Sequencing
Forensic SNP Genotyping using Nanopore MinION Sequencing AUTHORS Senne Cornelis 1, Yannick Gansemans 1, Lieselot Deleye 1, Dieter Deforce 1,#,Filip Van Nieuwerburgh 1,#,* 1 Laboratory of Pharmaceutical
1. Gyakorlat: Telepítés: Windows Server 2008 R2 Enterprise, Core, Windows 7
1. Gyakorlat: Telepítés: Windows Server 2008 R2 Enterprise, Core, Windows 7 1.1. Új virtuális gép és Windows Server 2008 R2 Enterprise alap lemez létrehozása 1.2. A differenciális lemezek és a két új virtuális
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Nonparametric Tests. Petra Petrovics.
Nonparametric Tests Petra Petrovics PhD Student Hypothesis Testing Parametric Tests Mean o a population Population proportion Population Standard Deviation Nonparametric Tests Test or Independence Analysis
A teszt a következő diával indul! The test begins with the next slide!
A teszt a következő diával indul! The test begins with the next slide! A KÖVETKEZŐKBEN SZÁMOZOTT KÉRDÉSEKET VAGY KÉPEKET LÁT SZÁMOZOTT KÉPLETEKKEL. ÍRJA A SZÁMOZOTT KÉRDÉSRE ADOTT VÁLASZT, VAGY A SZÁMOZOTT
Eladni könnyedén? Oracle Sales Cloud. Horváth Tünde Principal Sales Consultant 2014. március 23.
Eladni könnyedén? Oracle Sales Cloud Horváth Tünde Principal Sales Consultant 2014. március 23. Oracle Confidential Internal/Restricted/Highly Restricted Safe Harbor Statement The following is intended
Gottsegen National Institute of Cardiology. Prof. A. JÁNOSI
Myocardial Infarction Registry Pilot Study Hungarian Myocardial Infarction Register Gottsegen National Institute of Cardiology Prof. A. JÁNOSI A https://ir.kardio.hu A Web based study with quality assurance
4 vana, vanb, vanc1, vanc2
77 1) 2) 2) 3) 4) 5) 1) 2) 3) 4) 5) 16 12 7 17 4 8 2003 1 2004 7 3 Enterococcus 5 Enterococcus faecalis 1 Enterococcus avium 1 Enterococcus faecium 2 5 PCR E. faecium 1 E-test MIC 256 mg/ml vana MRSA MRSA
Utolsó frissítés / Last update: február Szerkesztő / Editor: Csatlós Árpádné
Utolsó frissítés / Last update: 2016. február Szerkesztő / Editor: Csatlós Árpádné TARTALOM / Contents BEVEZETŐ / Introduction... 2 FELNŐTT TAGBÉLYEGEK / Adult membership stamps... 3 IFJÚSÁGI TAGBÉLYEGEK
Seven Verses. from the Bhagavad Gita. by Swami Shyam. in Hungarian. magyarul
Seven Verses from the Bhagavad Gita by Swami Shyam Swami Shyam has translated the Bhagavad Gita from the original Sanskrit into English and Hindi. He selected these seven essential verses to be sung and
Utasítások. Üzembe helyezés
HASZNÁLATI ÚTMUTATÓ Üzembe helyezés Utasítások Windows XP / Vista / Windows 7 / Windows 8 rendszerben történő telepítéshez 1 Töltse le az AORUS makróalkalmazás telepítőjét az AORUS hivatalos webhelyéről.
2. Local communities involved in landscape architecture in Óbuda
Év Tájépítésze pályázat - Wallner Krisztina 2. Közösségi tervezés Óbudán Óbuda jelmondata: Közösséget építünk, ennek megfelelően a formálódó helyi közösségeket bevonva fejlesztik a közterületeket. Békásmegyer-Ófaluban
Márkaépítés a YouTube-on
Márkaépítés a YouTube-on Tv+ Adj hozzá YouTube-ot, Google Ground, 2016 Március 7. Bíró Pál, Google - YouTube 9,000,000 INTERNETTEL BÍRÓ ESZKÖZÖK VOLUMENE GLOBÁLISAN WEARABLES OKOS TV 8,000,000 7,000,000
Néhány folyóiratkereső rendszer felsorolása és példa segítségével vázlatos bemutatása Sasvári Péter
Néhány folyóiratkereső rendszer felsorolása és példa segítségével vázlatos bemutatása Sasvári Péter DOI: http://doi.org/10.13140/rg.2.2.28994.22721 A tudományos közlemények írása minden szakma művelésének
ANGOL NYELVI SZINTFELMÉRŐ 2012 A CSOPORT. to into after of about on for in at from
ANGOL NYELVI SZINTFELMÉRŐ 2012 A CSOPORT A feladatok megoldására 45 perc áll rendelkezésedre, melyből körülbelül 10-15 percet érdemes a levélírási feladatra szánnod. Sok sikert! 1. Válaszd ki a helyes
CLUSTALW Multiple Sequence Alignment
Version 3.2 CLUSTALW Multiple Sequence Alignment Selected Sequences) FETA_GORGO FETA_HORSE FETA_HUMAN FETA_MOUSE FETA_PANTR FETA_RAT Import Alignments) Return Help Report Bugs Fasta label *) Workbench
DI-, TETRA- ÉS HEXAPLOID TRITICUM FAJOK GENOMJAINAK ELEMZÉSE ÉS AZOK ÖSSZEHASONLÍTÁSA FLUORESZCENS IN SITU HIBRIDIZÁCIÓVAL
Hagyomány és haladás a növénynemesítésben DI-, TETRA- ÉS HEXAPLOID TRITICUM FAJOK GENOMJAINAK ELEMZÉSE ÉS AZOK ÖSSZEHASONLÍTÁSA FLUORESZCENS IN SITU HIBRIDIZÁCIÓVAL VARGA MÓNIKA, MOLNÁR ISTVÁN ÉS KOVÁCS
Regional Expert Meeting Livestock based Geographical Indication chains as an entry point to maintain agro-biodiversity
How Code of Practice can address the question of biodiversity (indigenous breeds, peculiarities of feeding, rearing traditional or marginalized systems)? Rendek Olga, Kerekegyháza 2009 október 20. 1 2
9el[hW][e\L;BI IjWdZWhZi
9el[hW][e\L;BI IjWdZWhZi The content and activities in Alive 3 and Alive 4 have been prepared to allow students to achieve the Victorian Essential Learning Standards (VELS) for Level 6. The key elements
Utolsó frissítés / Last update: Szeptember / September Szerkesztő / Editor: Csatlós Árpádné
Utolsó frissítés / Last update: 2018. Szeptember / September Szerkesztő / Editor: Csatlós Árpádné TARTALOM / Contents BEVEZETŐ / Introduction... 2 FELNŐTT TAGBÉLYEGEK / Adult membership stamps... 3 IFJÚSÁGI
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 200. május 4. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 200. május 4. 8:00 Az írásbeli vizsga időtartama: 80 perc Pótlapok száma Tisztázati Piszkozati OKTATÁSI
Ellenőrző lista. 2. Hálózati útvonal beállítások, kapcsolatok, névfeloldások ellenőrzése: WebEC és BKPR URL-k kliensről történő ellenőrzése.
Ellenőrző lista 1. HW/SW rendszer követelmények meglétének ellenőrzése: A telepítési segédlet által megjelölt elemek meglétének, helyes üzemének ellenőrzése. 2. Hálózati útvonal beállítások, kapcsolatok,
A cell-based screening system for RNA Polymerase I inhibitors
Electronic Supplementary Material (ESI) for MedChemComm. This journal is The Royal Society of Chemistry 2019 Supporting Information A cell-based screening system for RNA Polymerase I inhibitors Xiao Tan,
FÖLDRAJZ ANGOL NYELVEN
Földrajz angol nyelven középszint 0821 ÉRETTSÉGI VIZSGA 2009. május 14. FÖLDRAJZ ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI ÉRETTSÉGI VIZSGA JAVÍTÁSI-ÉRTÉKELÉSI ÚTMUTATÓ OKTATÁSI ÉS KULTURÁLIS MINISZTÉRIUM Paper
A jövedelem alakulásának vizsgálata az észak-alföldi régióban az 1997-99. évi adatok alapján
A jövedelem alakulásának vizsgálata az észak-alföldi régióban az 1997-99. évi adatok alapján Rózsa Attila Debreceni Egyetem Agrártudományi Centrum, Agrárgazdasági és Vidékfejlesztési Intézet, Számviteli
Tutorial 1 The Central Dogma of molecular biology
oday DN RN rotein utorial 1 he entral Dogma of molecular biology Information flow in genetics:» ranscription» ranslation» Making sense of genomic information Information content in DN - Information content
Supporting Information
Supporting Information Paired design of dcas9 as a systematic platform for the detection of featured nucleic acid sequences in pathogenic strains Yihao Zhang 1,2,8, Long Qian 4,8, Weijia Wei 1,3,7,8, Yu
Cashback 2015 Deposit Promotion teljes szabályzat
Cashback 2015 Deposit Promotion teljes szabályzat 1. Definitions 1. Definíciók: a) Account Client s trading account or any other accounts and/or registers maintained for Számla Az ügyfél kereskedési számlája
(NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV
Kommunikációs rendszerek programozása (NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV (5. mérés) SIP telefonközpont készítése Trixbox-szal 1 Mérés helye: Széchenyi István Egyetem, L-1/7 laboratórium, 9026 Győr, Egyetem
A évi fizikai Nobel-díj
A 2012. évi fizikai Nobel-díj "for ground-breaking experimental methods that enable measuring and manipulation of individual quantum systems" Serge Haroche David Wineland Ecole Normale Superieure, Párizs
István Micsinai Csaba Molnár: Analysing Parliamentary Data in Hungarian
István Micsinai Csaba Molnár: Analysing Parliamentary Data in Hungarian The Hungarian Comparative Agendas Project Participant of international Comparative Agendas Project Datasets on: Laws (1949-2014)
Az Open Data jogi háttere. Dr. Telek Eszter
Az Open Data jogi háttere Dr. Telek Eszter Egy kis ismétlés Open Data/Open Access/Open Knowledge gyökerei Open Source Software FLOSS (Free Libre Open Source Software) Szoftver esetében egyszerű alapok:
A controlling és az értékelemzés összekapcsolása, különös tekintettel a felsőoktatási és a gyakorlati alkalmazhatóságra
A controlling és az értékelemzés összekapcsolása, különös tekintettel a felsőoktatási és a gyakorlati alkalmazhatóságra Dr. Szóka Károly Nyugat-magyarországi Egyetem Közgazdaságtudományi Kar Egyetemi docens