WaveSurfer 3000 Oscilloscopes 200 MHz 500 MHz
|
|
- Albert Szekeres
- 6 évvel ezelőtt
- Látták:
Átírás
1 WaveSurfer 3000 Oscilloscopes 200 MHz 500 MHz Key Features 200 MHz, 350 MHz, and 500 MHz bandwidths Up to 4 GS/s sample rate Long Memory up to 10 Mpts/Ch 10.1 touch screen display MAUI - Advanced User Interface Designed for Touch Built to Simplify Made to Solve Advanced Anomaly Detection Fast Waveform Update History Mode WaveScan Superior Toolset LabNotebook Sequence Mode Advanced Active Probe Interface Math and Measure Multi-Instrument Capabilities Protocol Analysis - Serial Trigger and Decode Waveform Generation - Built-in Function Generator Logic Analysis - 16 Channel MSO Future Proof Upgradeable Bandwidth Field Upgradable Software and Hardware Options WaveSurfer 3000 oscilloscopes feature the MAUI advanced user interface with touch screen simplicity to shorten debug time. Quickly identify and isolate anomalies with WaveScan, Fast Display, and History mode for faster troubleshooting; LabNotebook enables easy documentation and convenient collaboration. The advanced probe interface, upgradable bandwidth and multi-instrument capabilities provide maximum versatility and investment protection. MAUI - A New Wave of Thinking MAUI is the most advanced oscilloscope user interface. MAUI is designed for touch; all important oscilloscope controls are accessed through the intuitive touch screen. MAUI is made for simplicity; time saving shortcuts and intuitive dialogs simplify setup. MAUI is built to solve; deep set of debug and analysis tools help identify problems and find solutions quickly. Advanced Anomaly Detection Combining a fast waveform update rate of 130,000 waveforms/second with History mode waveform playback and WaveScan search and find, the WaveSurfer 3000 is an outstanding tool for waveform anomaly detection. Capture, Debug, Analyze, Document The advanced active probe interface gives tremendous flexibility for capturing all types of signals. Debug, analyze and document problems through the use of powerful math and measurement capabilities, sequence mode segmented memory, and LabNotebook. Multi-Instrument Capabilities Beyond traditional oscilloscope functionality the WaveSurfer 3000 has a variety of multi-instrument capabilities including waveform generation with a built-in function generator, protocol analysis with serial data trigger and decode, and logic analysis with an available 16 channel mixed signal option.
2 MAUI A NEW WAVE OF THINKING MAUI is the most advanced oscilloscope user interface developed to put all the power and capabilities of the modern oscilloscope right at your fingertips. Designed for touch; all important oscilloscope controls are accessed through the intuitive touch screen. Made for simplicity; time saving shortcuts and intuitive dialogs simplify setup. Built to solve; a deep set of debug and analysis tools help identify problems and find solutions quickly. Oscilloscopes are constantly evolving to meet the rapidly changing test and measurement needs of today s cutting edge designs. Additional complexity and capabilities are introduced with each new feature, and in some cases when capabilities of other instruments like a protocol analyzer, function generator or logic analyzer are added. With all this added capability the oscilloscope becomes complex and cumbersome to use. The traditional user interface consisting of knobs, buttons, soft keys and nested menus is unmanageable and more buttons are typically added to access the new functionality. MAUI solves the complexity problem. MAUI eliminates the overwhelming number of buttons and knobs providing an intuitive user interface that is designed for touch, built for simplicity and made to solve without sacrificing any features or cutting edge test capabilities. Designed for Touch MAUI is designed for touch. All important controls for vertical, horizontal and trigger are always one touch away. Touch the waveform to position and drag a box around it to zoom in for more details. Position cursors, configure measurements and interact with tables all through simple touch operation. 2
3 Built for Simplicity MAUI is built for simplicity. Basic waveform viewing and measure- A ment tools as well as advanced math and analysis capabilities are B seamlessly integrated in a single user interface. Time saving shortcuts and intuitive dialogs simplify C setup and shorten debug time. D A Access shortcuts to analysis tools by touching the waveform. C Channel, timebase and trigger descriptors provide easy access to controls without navigating menus. B Configure parameters by touching measurement results. D Shortcuts to commonly used functions are displayed at the bottom of the channel, math and memory menus. Made to Solve MAUI is made to solve. Measure all aspects of a waveform to identify problems. Debug with a large set of time saving tools to find the cause of problems. Solve problems fast with powerful analysis tools. 3
4 ADVANCED ANOMALY DETECTION Combining a fast waveform update rate of 130,000 waveforms/second with History mode waveform playback and WaveScan search and find, the WaveSurfer 3000 is an outstanding tool for waveform anomaly detection. A powerful set of triggering capabilities ensures that once a problem is detected it can be isolated and analyzed. Powerful Triggering Good triggering is essential for effective debug and with a powerful combination basic and advanced triggers the WaveSurfer 3000 ensures that even the most challenging problems can be isolated. Basic triggering like edge and width are great for every day operation. Advanced triggers like runt or interval help isolate anomalies quickly. Qualified triggering allows for configuring a trigger across multiple channels. With the MSO leadset connected, powerful logic triggering can be set up to catch a parallel pattern of up to 16 digital channels. Analog channels can be added to the pattern trigger to configure an analog-digital cross pattern, mixed signal trigger. WaveScan Advanced Search Locate unusual events in a single capture or scan for an anomaly across many acquisitions over a long period of time. WaveScan provides powerful isolation capabilities that hardware triggers cannot provide. Select from more than 20 search modes to find events on any analog or digital channel. Since the scanning modes are not simply copies of the hardware triggers, the utility and capability is much higher. There is no frequency trigger in any oscilloscope, yet WaveScan allows for frequency to be quickly scanned notifying the user upon a shift in frequency. Searching can be done based on measured waveform parameters, runts and non-monotonic edges as well as digital patterns. Built on the traditional Teledyne LeCroy strength of fast data processing, WaveScan quickly and efficiently scans millions of events looking for unusual occurrences. Search and scan results can be seen with annotations directly on the waveform or in the interactive table. Quickly zoom to an event to see more details by simply touching it in the table. Beyond the standard oscilloscope triggering, unique serial data triggering capabilities for I 2 C, SPI, UART and RS-232 add protocol specific triggering to isolate activity on A a variety of serial busses. B SPI A B I 2 C I 2 C SPI UART RS-2 I 2 C SPI UART RS-232 4
5 Fast Waveform Update A fast update rate ensures that no waveform variations or details are missed. With an update rate of up to 130,000 waveforms per second the WaveSurfer 3000 is able to easily display random or infrequent events simplifying anomaly detection, identification and debug. Rapidly changing waveforms are easy to see and visually inspect. Changes over time can be seen with the intensity graded persistence display. Rotating and tilting feet provide four different viewing positions. History Mode Waveform Playback Scroll back in time using History Mode to view previous waveforms and isolate anomalies. Use cursors and measurement parameters to quickly find the source of problems. History mode is always available with a single button press, no need to enable this mode and never miss a waveform. Go Back in Time to Identify the Source of a Problem 5
6 CAPTURE. DEBUG. ANALYZE. DOCUMENT. The advanced active probe interface gives tremendous flexibility for capturing all types of signals. Debug, analyze and document problems through the use of powerful math and measurement capabilities, sequence mode segmented memory, and LabNotebook. Advanced Waveform Capture with Sequence Mode Use Sequence mode to save waveforms into segmented memory. This is ideal for capturing fast pulses in quick succession or when capturing events separated by long time intervals. Combine Sequence mode with advanced triggers to isolate rare events over time. Trigger times and time between segments are provided for additional insight. Advanced Math Capabilities A deep set of 20 math functions adds to the problem solving capability of WaveSurfer Math functions provide quick insight into waveforms and help point to the cause of the most challenging problems. Functions like the powerful FFT provide details of the frequency domain while averaging effectively filters noise out of the signal. Superior Measurement Tools With 24 measurement parameters, the WaveSurfer 3000 can measure and analyze every aspect of analog and digital waveforms. Statistics and histicons go beyond traditional measurement tools providing insight to how a waveform changes over time. Measurement data can be trended to create a visual representation of changing measurements. 6
7 LabNotebook Documentation Tool LabNotebook is a one-button tool to save and restore waveforms, measurements and settings without navigating multiple menus. Saved waveforms can be measured and analyzed later both on the oscilloscope or offline using the WaveStudio PC Utility. Advanced Probe Interface The advanced active probe interface gives tremendous flexibility for measuring high voltages, high frequencies, currents, or differential signals. Waveform Screen Capture V/div T/div Memory Length Sample Rate Measurement Math High Impedance Active Probes Waveform Screen Capture V/div T/div Memory Length Sample Rate Measurement Math Waveform Screen Capture V/div T/div Memory Length Sample Rate Measurement Math High Bandwidth Differential Probes WaveStudio Offline Analysis Tool WaveStudio is a fast and easy way to analyze acquired waveforms offline. Offline tools include x and y axis cursors for quick measurements and 21 built-in automatic measurements for more precise and accurate results. WaveStudio can also connect to the oscilloscope for direct data transfer to the PC. Data saved with LabNotebook can be shared with others using WaveStudio for easy collaboration. High Voltage Differential Probes High Voltage Passive Probes Current Probes 7
8 MULTI-INSTRUMENT CAPABILITIES Beyond traditional oscilloscope functionality the WaveSurfer 3000 has a variety of multi-instrument capabilities including waveform generation with a built-in function generator, protocol analysis with serial data trigger and decode, and logic analysis with an available 16 channel mixed signal option. Protocol Analysis with Serial Trigger and Decode Debugging serial data busses can be confusing and time consuming. Time saving protocol analysis capabilities are provided by the serial trigger and decode tools. Intuitive, Color-Coded Protocol Decode Overlay Protocol decoding is shown directly on the waveform with an intuitive, colorcoded overlay and presented in binary, hex or decimal. Decoding is fast even with long memory and zooming in to the waveform shows precise byte by byte decoding. Powerful Serial Data Triggers The serial data trigger will quickly isolate events on a bus eliminating the need to set manual triggers hoping to catch the right information. Trigger conditions can be entered in binary or hexadecimal formats and conditional trigger capabilities allow for triggering on a range of different events. Table Summary and Search To further simplify the debug process all decoded data can be displayed in a table below the waveform grid. Selecting an entry in the table will display just that event. Additionally, built-in search functionality will find specific decoded values. Supported Protocols I2 C SPI UART RS-232 8
9 Logic Analysis with 16 Channel Mixed Signal Capability The 16 integrated digital channels and tools designed to simultaneously view, measure, and analyze both analog and digital signals enable fast debugging of mixed signal designs. Extensive Triggering Flexible analog and digital cross-pattern triggering across all 20 channels provides the ability to quickly identify and isolate problems in a mixed signal environment. Event triggering can be configured to arm on an analog signal and trigger on a digital pattern or both analog and digital channels can be incorporated in to a single pattern trigger. Advanced Digital Debug Tools Using the powerful parallel pattern search capability of WaveScan, patterns across many digital lines can be isolated and analyzed. Identified patterns are presented in a table with timestamp information and enables quick searching for each pattern occurrence. Use a variety of timing parameters to measure and analyze the characteristics of digital busses. Powerful tools like trends, statistics and histicons provide additional insight and help find anomalies in digital waveforms. Quickly see the state of all the digital lines at the same time using convenient activity indicators. Waveform Generation with Built-in Function Generator The built-in WaveSource function generator provides up to 25 MHz and 125 MS/s waveform generation capabilities. The function generator controls are integrated directly into the oscilloscope with a dedicated user interface. The integrated function generator is a is a convenient time saving tool allowing for quick and easy generation of sine, square, pulse, ramp, triangle, noise and DC waveforms. Familiar function generator controls are seamlessly integrated in to the WaveSurfer 3000 user interface simplifying the process of generating waveform stimulus and measuring the response with the oscilloscope. 9
10 SPECIFICATIONS WaveSurfer 3022 WaveSurfer 3024 WaveSurfer 3034 WaveSurfer 3054 Analog - Vertical Bandwidth (@ 50Ω) 200 MHz 350 MHz 500 MHz Rise time 1.75 ns typical 1 ns typical 800 ps typical Input Channels 2 4 Vertical Resolution 8-bits Sensitivity 50 Ω: 1mV/div - 1 V/div; 1 MΩ: 1 mv/div - 10 V/div DC Gain Accuracy ±(1.5%) Full Scale, Offset at 0 > 5mV; (2.5%) < 5 mv BW Limit 20 MHz 20 MHz, 200 MHz Maximum Input Voltage 50 Ω: 5 Vrms, ±10 V Peak; 1 MΩ: 400 V max (DC + Peak AC 10 khz) Input Coupling 50 Ω: DC, GND; 1 MΩ: AC, DC, GND Input Impedance 50 Ω ±2.0%, 1 MΩ ±2.0% 16 pf Offset Range 50 Ω: 1 mv mv: ±2 V, 20 mv mv: ±5 V, 102 mv mv: ±20 V, 200 mv - 1 V: ±50 V 1 MΩ: 1 mv mv: ±2 V, 20 mv mv: ±5 V, 102 mv mv: ±20 V, 200 mv - 1 V: ±50 V, 1.02 V V: ±200 V, 2 V - 10 V: ±400 V Offset Accuracy ±(1.0% of offset value + 1.5%FS + 1 mv) Analog - Acquisition Sample Rate (Single-shot) 2 GS/s (4 GS/s interleaved) Sample Rate (Repetitive) 50 GS/s Record Length 10 Mpts/ch (all channels) Acquisition Modes Real Time, Roll, RIS (Random Interleaved Sampling), Sequence (Segmented Memory up to 1,000 segments with 1μs minimum intersegment time) Real Time Timebase Range 2 ns/div - 50 s/div 1 ns/div - 50 s/div RIS ModeTimebase Range 2 ns/div - 10 ns/div 1 ns/div - 10 ns/div Roll Mode Timebase Range Up to 50 s/div (roll mode is user selectable at 100 ms/div) Timebase Accuracy ±10 ppm measured over > 1ms interval Digital - Vertical and Acquisition (WS3K-MSO Option Only) Input Channels 16 Digital Channels Threshold Groupings Pod 2: D15 - D8, Pod 1: D7 - D0 Threshold Selections TTL(+1.4V), 5V CMOS (+2.5V), ECL (-1.3V) or User Defined Maximum Input Voltage ±30V Peak Threshold Accuracy ±(3% of threshold setting + 100mV) Input Dynamic Range ±20V Minimum Input Voltage Swing 500mVpp Input Impedance (Flying Leads) 100 kω 5 pf Maximum Input Frequency 125 MHz Sample Rate 500 MS/s Record Length 10MS - 16 Channels Minimum Detectable Pulse Width 4 ns Channel-to-Channel Skew ± (1 digital sample interval) User defined threshold range ±10V in 20mV steps Trigger System Modes Sources Coupling Pre-trigger Delay Post-trigger Delay Hold-off Internal Trigger Level Range External Trigger Level Range Trigger Types Auto, Normal, Single, Stop Any input channel, External, Ext/5, or line; slope and level unique to each source (except for line trigger) DC, AC, HFREJ, LFREJ 0-100% of full scale 0-10,000 Divisions 10ns up to 20s or 1 to 100,000,000 events ±4.1 Divisions Ext: ±610mV, Ext/5: ±3.05V Edge, Width, Logic (Pattern), TV (NTSC, PAL, SECAM, HDTV - 720p, 1080i, 1080p), Runt, Slew Rate, Interval (Signal or Pattern), Dropout, Qualified (State or Edge); External and Ext/5 support edge trigger only. Measure, Zoom and Math Tools Measurement Parameters Up to 6 of the following parameters can be calculated at one time on any waveform: Amplitude, Area, Base, Delay, Duty Cycle, Fall Time (90% 10%), Fall Time (80% 20%), Frequency, Maximum, Mean, Minimum, Overshoot+, Overshoot-, Peak-Peak, Period, Phase, Rise Time (10% 90%), Rise Time (20% 80%), RMS, Skew, Standard Deviation, Top, Width+, Width-. Statistics and histicons can be added to measurements Measurements can be gated. Zooming Use front panel QuickZoom button, or use touch screen or mouse to draw a box around the zoom area. Math Functions Up to 2 of the following functions can be calculated at one time: Sum, Difference, Product, Ratio, Absolute Value, Average, Derivative, Envelope, Floor, Integral, Invert, Reciprocal, Rescale, Roof, SinX/x, Square, Square Root, Trend, Zoom and FFT (up to 1 Mpts with power spectrum output and rectangular, VonHann, and FlatTop windows). 10
11 SPECIFICATIONS WaveSurfer 3022 WaveSurfer 3024 WaveSurfer 3034 WaveSurfer 3054 Probes Standard Probes One PP019 (5mm) per channel One PP020 (5mm) per channel Probing System BNC and Teledyne LeCroy ProBus for Active voltage, current and differential probes Display System Display Size 10.1 Wide TFT-LCD Touch-Screen Display Resolution 1024 x 600 Connectivity Ethernet Port 10/100Base-T Ethernet interface (RJ-45 connector) Removable Storage (1) MicroSD Port - 8 GB microsd card installed standard USB Host Ports (4) USB Ports Total (2) Front USB Ports USB Device Port (1) USBTMC GPIB Port (Optional) Supports IEEE External Monitor Port Standard DB-15 connector (support resolution of 1024x600) Remote Control Via Windows Automation, or via Teledyne LeCroy Remote Command Set Network Communication GPIB IEEE-488.2,LXI Class C, VXI-11 and VICP, USBTMC/USB488 Standard Power Requirements Voltage Power Consumption (Nominal) Power Consumption (Max) VAC ± 10% at Hz +/-5%; VAC ± 10% at 400 Hz +/- 5%; Automatic AC Voltage Selection 100 W / 100 VA 150 W / 150 VA (with all PC peripherals, digital leadset and active probes connected to 4 channels) Environmental Temperature Operating: 0 C to 50 C; Non-Operating: -30 C to 70 C Humidity Operating: 5% to 90% relative humidity (non-condensing) up to 30 C, Upper limit derates to 50% relative humidity (non-condensing) at +50 C Non-Operating: 5% to 95% relative humidity (non-condensing) as tested per MIL-PRF-28800F Altitude Operating: 3,048 m (10,000 ft) max at 25C; Non-Operating: Up to 12,192 meters (40,000 ft) Physical Dimensions (HWD) Weight 8.66 H x W x 5.71 D (220 mm x 350 mm x 1450 mm) 4.81 kg (10.6 lbs) Regulatory CE Certification Low Voltage Directive 2006/95/EC; EN :2010, EN :2010 EMC Directive 2004/108/EC; EN :2013, EN :2013; RoHS2 Directive 2011/65/EU UL and cul Listing UL , UL :2010, 3rd Edition; CAN/CSA C22.2 No WaveSource Function Generator (optional) General Max Output Frequency 25 MHz Channels 1 Frequency Resolution 125 MS/s Vertical Resolution 14-bit Vertical Range ±3V (HiZ); ±1.5V (50 Ω) Waveform Types Sine, Square, Pulse, Ramp, Noise, DC Frequency Specification Sine Square/Pulse Ramp/Triangular Noise Resolution Accuracy Aging Output Specification Amplitude Vertical Accuracy Amplitude Flatness 1 μhz - 25 MHz 1 μhz - 10 MHz 1 μhz KHz 25 MHz (-3dB) 1 μhz ±50 ppm, over temperature ±3 ppm/year, first year 4 mvpp - 6 Vpp (HiZ) 2 mvpp - 3 Vpp(50 Ω) ±(0.3dB + 1 mv) ±0.5dB DC Offset Range (DC) ±3V (HiZ); ±1.5V (50 Ω) Offset Accuracy ±(1% of offset value + 3 mv) Waveform Output Impedance 50 Ω ± 2% Protection Short-circuit protection Sine Spectrum Purity SFDR (Non DC-1 MHz -60dBc 1 MHz - 5 MHz -55dBc 5 MHz - 25 MHz -50dBc Harmonic DC - 5 MHz -50dBc 5 MHz - 25 MHz -45dBc Square/Pulse Rise/fall time 24 ns (10% - 90%) Overshoot 3% (typical - 1 khz, 1 Vpp) Pulse Width 50 ns min. Jitter 500ps + 10ppm of period (RMS cycle to cycle jitter) Ramp/Triangle Linearity Symmetry 0% to 100% 0.1% of Peak value output (typical - 1 khz, 1 Vpp, 100% symmetric) 11
WaveSurfer 3000 Oscilloscopes 200 MHz 750 MHz
WaveSurfer 3000 Oscilloscopes 200 MHz 750 MHz Key Features 200 MHz, 350 MHz, 500 MHz and 750 MHz bandwidths Up to 4 GS/s sample rate Long Memory up to 10 Mpts/Ch 10.1 touch screen display MAUI - Advanced
WaveJet Touch Oscilloscopes 350 MHz / 500 MHz
WaveJet Touch Oscilloscopes 350 MHz / 500 MHz Key Features 350 MHz and 500 MHz bandwidths Up to 2 GS/s sample rate Long Memory up to 5 Mpts 7.5 touch screen display 26 measurement parameters Replay mode
THS710A, THS720A, THS730A & THS720P TekScope Reference
THS710A, THS720A, THS730A & THS720P TekScope Reference 070-9741-01 Getting Started 1 Connect probes or leads. 2 Choose SCOPE 3 or METER mode. Press AUTORANGE. Copyright Tektronix, Inc. Printed in U.S.A.
Using the CW-Net in a user defined IP network
Using the CW-Net in a user defined IP network Data transmission and device control through IP platform CW-Net Basically, CableWorld's CW-Net operates in the 10.123.13.xxx IP address range. User Defined
Out-Look. Display. Analog Bar. Testing Mode. Main Parameter. Battery Indicator. Second Parameter. Testing Frequency
Out-Look Display Analog Bar Testing Mode Battery Indicator 1. LCD Display 2. Power Key 3. Mode Key 4. HOLD Key 5. Function Keys 6. Component socket (5Wire) 7. 2Wire Input Terminals Testing Frequency Main
Proxer 7 Manager szoftver felhasználói leírás
Proxer 7 Manager szoftver felhasználói leírás A program az induláskor elkezdi keresni az eszközöket. Ha van olyan eszköz, amely virtuális billentyűzetként van beállítva, akkor azokat is kijelzi. Azokkal
WaveMaster 8 Zi-B Oscilloscopes 4 GHz 30 GHz
8 Zi-B Oscilloscopes 4 GHz 30 GHz Key Features Up to 30 GHz bandwidth and 80 GS/s sample rate Most advanced oscilloscope user interface makes configuring complex measurements easy The industry s only true
1. sz. mérés. Mérések digitális oszcilloszkóppal
1. sz. mérés Mérések digitális oszcilloszkóppal A mérés célja, hogy megismerjük egy digitális oszcilloszkóp (DSO: Digital Storage Oscilloscope) kezelését, speciális szolgáltatásait, mint pl. automatikus
WaveMaster 8 Zi-B Oscilloscopes 4 GHz 30 GHz
8 Zi-B Oscilloscopes 4 GHz 30 GHz Key Features Up to 30 GHz bandwidth and 80 GS/s sample rate Most advanced oscilloscope user interface makes configuring complex measurements easy The industry s only true
WaveMaster 8 Zi-B Oscilloscopes 4 GHz 30 GHz
8 Zi-B Oscilloscopes 4 GHz 30 GHz Key Features Up to 30 GHz bandwidth and 80 GS/s sample rate Most advanced oscillscope user interface makes configuring complex measurements easy The industry s only true
Correlation & Linear Regression in SPSS
Petra Petrovics Correlation & Linear Regression in SPSS 4 th seminar Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Correlation
Pro sensors Measurement sensors to IP Thermo Professional network
Pro sensors Measurement sensors to IP Thermo Professional network T-05 Temperature sensor TH-05 Temperature, humidity sensor THP- 05 Temperature, humidity, air pressure, air velocity, wet sensors indoor
Kezdőlap > Termékek > Szabályozó rendszerek > EASYLAB és TCU-LON-II szabályozó rendszer LABCONTROL > Érzékelő rendszerek > Típus DS-TRD-01
Típus DS-TRD FOR EASYLAB FUME CUPBOARD CONTROLLERS Sash distance sensor for the variable, demand-based control of extract air flows in fume cupboards Sash distance measurement For fume cupboards with vertical
Correlation & Linear Regression in SPSS
Correlation & Linear Regression in SPSS Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise 1 - Correlation File / Open
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2008. május 26. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2008. május 26. 8:00 Az írásbeli vizsga időtartama: 180 perc Pótlapok száma Tisztázati Piszkozati OKTATÁSI
Construction of a cube given with its centre and a sideline
Transformation of a plane of projection Construction of a cube given with its centre and a sideline Exercise. Given the center O and a sideline e of a cube, where e is a vertical line. Construct the projections
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Correlation & Linear. Petra Petrovics.
Correlation & Linear Regression in SPSS Petra Petrovics PhD Student Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2013. május 23. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2013. május 23. 8:00 Az írásbeli vizsga időtartama: 180 perc Pótlapok száma Tisztázati Piszkozati EMBERI
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 200. május 4. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 200. május 4. 8:00 Az írásbeli vizsga időtartama: 80 perc Pótlapok száma Tisztázati Piszkozati OKTATÁSI
Széchenyi István Egyetem www.sze.hu/~herno
Oldal: 1/6 A feladat során megismerkedünk a C# és a LabVIEW összekapcsolásának egy lehetőségével, pontosabban nagyon egyszerű C#- ban írt kódból fordítunk DLL-t, amit meghívunk LabVIEW-ból. Az eljárás
T H U R L B Y T H A N D A R I N S T R U M E N T S
T H U R L B Y T H A N D A R I N S T R U M E N T S TG5011 és TG2511 Funkció / tetszõleges hullámforma / pulzus generátor Max. 50 MHz szinusz és négyszög, 1 µhz vagy 14 digit felbontás Tetszõleges hullámformák
Lab. gyak.: jelszintézis (Wfm Editor, ARBgen) és jelanalízis (DSO/FFT)
Lab. gyak.: jelszintézis (Wfm Editor, ARBgen) és jelanalízis (DSO/FFT) A közvetlen digitális szintézis (DDS: Direct Digital Synthesis) elvén működő jelgenerátor diszkrét (idő)rekordból állítja elő a programozható
Gitárerősítő. Használati utasítás
Gitárerősítő Használati utasítás Óvintézkedések Olvassa el figyelmesen az utasításokat! Tartsa be ezeket az utasításokat! Vegyen figyelembe minden figyelmeztetést! Kövessen minden utasítást! Ne használja
Formula Sound árlista
MIXERS FF-6000; FF6000P Formula Sound 160 6 channel dual format DJ mixer with removable fader panel. (Supplied with linear faders) Formula Sound 160P As above but with PRO X crossfade fitted. Formula Sound
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN FOUNDATIONS IN ELECTRONICS
ÉRETTSÉGI VIZSGA 2007. május 25. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN FOUNDATIONS IN ELECTRONICS 2007. május 25. 8:00 KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA STANDARD-LEVEL WRITTEN EXAM Az írásbeli vizsga időtartama:
Pataky István Fővárosi Gyakorló Híradásipari és Informatikai Szakközépiskola. GwINSTEK GDS-1000
Pataky István Fővárosi Gyakorló Híradásipari és Informatikai Szakközépiskola Elektronikus anyag a gyakorlati képzéshez GwINSTEK GDS1000 sorozatú oszcilloszkóp magyar nyelvű használati útmutatója 2010.
Rezgésdiagnosztika. Diagnosztika 02 --- 1
Rezgésdiagnosztika Diagnosztika 02 --- 1 Diagnosztika 02 --- 2 A rezgéskép elemzésével kimutatható gépészeti problémák Minden gép, mely tartalmaz forgó részt (pl. motor, generátor, szivattyú, ventilátor,
AS-i illesztő-tápegység Pick-to Light rendszerekhez. Kábel keresztmetszet
AS-I ILLESZTŐ-TÁPEGYSÉG PTL RENDSZEREKHEZ KVL-AGW01 FŐBB PARAMÉTEREK AS-i vezérlők illesztését végzi a KVL COMP által gyártott PTL rendszerekhez. 3 A terhelhetőségű AS-i tápegység. 5 A terhelhetőségű tápegység
MAKING MODERN LIVING POSSIBLE. Danfoss Heating Solutions
MAKING MODERN LIVING POSSIBLE Danfoss Danfoss Link Link HC Hidronikus HC Hydronic szabályozó Controller Szerelési Installation útmutató Guide Danfoss Heating Solutions Szerelési útmutató Tartalomjegyzék
KN-CP50. MANUAL (p. 2) Digital compass. ANLEITUNG (s. 4) Digitaler Kompass. GEBRUIKSAANWIJZING (p. 10) Digitaal kompas
KN-CP50 MANUAL (p. ) Digital compass ANLEITUNG (s. 4) Digitaler Kompass MODE D EMPLOI (p. 7) Boussole numérique GEBRUIKSAANWIJZING (p. 0) Digitaal kompas MANUALE (p. ) Bussola digitale MANUAL DE USO (p.
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2012. május 25. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2012. május 25. 8:00 Az írásbeli vizsga időtartama: 180 perc Pótlapok száma Tisztázati Piszkozati NEMZETI
ARM processzorok felépítése
ARM processzorok felépítése Az ARM processzorok több családra bontható közösséget alkotnak. Az Cortex-A sorozatú processzorok, ill. az azokból felépülő mikrokontrollerek a high-end kategóriájú, nagy teljesítményű
Adatkezelő szoftver. Továbbfejlesztett termékvizsgálat-felügyelet Fokozott minőség és gyártási hatékonyság
Adatkezelő szoftver ProdX Inspect szoftver Fokozott termelékenység Páratlan termékminőség Magas fokú biztonság Teljesen átlátható folyamatok Továbbfejlesztett termékvizsgálat-felügyelet Fokozott minőség
± ± ± ƒ ± ± ± ± ± ± ± ƒ. ± ± ƒ ± ± ± ± ƒ. ± ± ± ± ƒ
± ± ± ± ƒ ± ± ± ƒ ± ± ƒ ± ç å ± ƒ ± ± ± ± ± ± ± ± ± ± ± ƒ ± ± ± ä ± ± ± ± ƒ ± ± ± ± ƒ ± ± ± ± ƒ ± ± ± ± ƒ ± ± ± ± ± ± ± ± ± ± ± ± ± ± ƒ ± ± ± ± ± ƒ ± ± ± ± ƒ ± ± ± ƒ ± ± ƒ ± ± ± ± ± ± ± ± ± ± ± ± ± ±
Csatlakozás a BME eduroam hálózatához Setting up the BUTE eduroam network
Csatlakozás a BME eduroam hálózatához Setting up the BUTE eduroam network Table of Contents Windows 7... 2 Windows 8... 6 Windows Phone... 11 Android... 12 iphone... 14 Linux (Debian)... 20 Sebők Márton
Analog- and digital hw Signal processing- and operating sw Equipment System (INTERJAM) Dr. Eged Bertalan. www.sagax.hu
Analog- and digital hw Signal processing- and operating sw Equipment System Integrált felderítő és s zavaró rendszer (INTERJAM) Dr. Eged Bertalan Sagax Communications Ltd., 1096 Budapest Haller u. 11-13.
SIGNAL HD 527 DVB T vevő, rögzítő, és médialejátszó készülék
SIGNAL HD 527 DVB T vevő, rögzítő, és médialejátszó készülék A magyarországi földfelszíni digitális adások vételére alkalmas. Szemközti nézet IR érzékelő, LED kijelző, USB 2.0 port Nézet hátulról antennabemenet,
DIGIAIR PRO (DVB-T) Használati útmutató. Készitette: Dasyst Kft. www.dasyst.hu
DIGIAIR PRO (DVB-T) Használati útmutató Tartalom: 1 Első lépések 1.1 KI/BE kapcsolás (Power ON/OFF) 1.2 Töltés és az akkumulátor (Power supply and battery) 1.3 Műszer használat (How to use the meter) 1.4
Utasítások. Üzembe helyezés
HASZNÁLATI ÚTMUTATÓ Üzembe helyezés Utasítások Windows XP / Vista / Windows 7 / Windows 8 rendszerben történő telepítéshez 1 Töltse le az AORUS makróalkalmazás telepítőjét az AORUS hivatalos webhelyéről.
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 201. május 20. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN EMELT SZINTŰ ÍRÁSBELI VIZSGA 201. május 20. 8:00 Az írásbeli vizsga időtartama: 20 perc Pótlapok száma Tisztázati Piszkozati EMBERI
Descriptive Statistics
Descriptive Statistics Petra Petrovics DESCRIPTIVE STATISTICS Definition: Descriptive statistics is concerned only with collecting and describing data Methods: - statistical tables and graphs - descriptive
Supporting Information
Supporting Information Cell-free GFP simulations Cell-free simulations of degfp production were consistent with experimental measurements (Fig. S1). Dual emmission GFP was produced under a P70a promoter
1. Gyakorlat: Telepítés: Windows Server 2008 R2 Enterprise, Core, Windows 7
1. Gyakorlat: Telepítés: Windows Server 2008 R2 Enterprise, Core, Windows 7 1.1. Új virtuális gép és Windows Server 2008 R2 Enterprise alap lemez létrehozása 1.2. A differenciális lemezek és a két új virtuális
i1400 Image Processing Guide A-61623_zh-tw
i1400 Image Processing Guide A-61623_zh-tw ................................................................. 1.............................................................. 1.........................................................
építészet & design ipari alkalmazás teherautó felépítmény
A Design-Composit egy kompozitpaneleket gyártó vállalat, mely teherautó felépítményekhez, az építészet számára és design termékekhez készít paneleket. We are an innovative manufacturer of composite panels
TRMS Digitális áram védőrelé Túláram, alacsony áram, áram kimaradás, és áram aszimmetria elleni védelem
TRMS Digitális áram védőrelé Túláram, alacsony áram, áram kimaradás, és áram aszimmetria elleni védelem Valódi RMS (TRMS) mérés Kijelzési pontosság 0.5% 4-digites 7-szegmenses LED 4 különböző paraméter
Hasznos és kártevő rovarok monitorozása innovatív szenzorokkal (LIFE13 ENV/HU/001092)
Hasznos és kártevő rovarok monitorozása innovatív szenzorokkal (LIFE13 ENV/HU/001092) www.zoolog.hu Dr. Dombos Miklós Tudományos főmunkatárs MTA ATK TAKI Innovative Real-time Monitoring and Pest control
PÁLYÁZATI BESZÁMOLÓ. képernyőinek cseréjére megkezdett program folytatása további 10 használt LCD. monitor megvásárlásával.
PÁLYÁZATI BESZÁMOLÓ A program megnevezése: A régi számítógéplabor (78-as terem) elavult képernyőinek cseréjére megkezdett program folytatása további 10 használt LCD monitor megvásárlásával. A pályázat
Cég név: Készítette: Telefon: Fax: Dátum:
Pozíció Darab Leírás Egyszeri ár 1 ALPHA Pro 1540 130 Külön kérésre Cikkszám: 96283590 GRUNDFOS ALPHA Pro is a complete range of circulator pumps featuring: integrated differentialpressure control enabling
PSP3404DUOBLACK MultiPhone 3404 DUO
PSP3404DUOBLACK MultiPhone 3404 DUO MultiPhone PSP3404 DUO (Dual sim,4" WVGA 480x800 TFT, MT6572m Dual core 1Ghz, Android 4.4, RAM 512MB + emmc 4GB, 2MP AF + 0.3MP, 2000 mah battery) Black Retail Garancia,
A világ elsõ teljesen érintõképernyõs kivitelû tábla oszcilloszkópja!
A világ elsõ teljesen érintõképernyõs kivitelû tábla oszcilloszkópja! tbook sorozat 70M~1GHz sávszélesség 1~5 GSa/s 9~450 Mpts 200 000 wfms/s 2/4 csatorna Max. 1 GHz sávszélesség és max. 5 GSa/s mintavételezési
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2015. május 19. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2015. május 19. 8:00 Az írásbeli vizsga időtartama: 180 perc Pótlapok száma Tisztázati Piszkozati EMBERI
ÚJ! Hálózati paraméterek mérőműszere, ND30 ALKALMAZÁSI PÉLDA. Mért és kijelzett hálózati paraméterek
Hálózati paraméterek mérőműszere, ND30 ÚJ! Elec trical cat i Safety 1-fázisú 2-vezetékes és 3-fázisú 3- és 4-vezetékes, szimmetrikusan és aszimmetrikusan terhelt hálózatok 54 paraméterének mérése beleértve
EN United in diversity EN A8-0206/419. Amendment
22.3.2019 A8-0206/419 419 Article 2 paragraph 4 point a point i (i) the identity of the road transport operator; (i) the identity of the road transport operator by means of its intra-community tax identification
PIACI HIRDETMÉNY / MARKET NOTICE
PIACI HIRDETMÉNY / MARKET NOTICE HUPX DAM Másnapi Aukció / HUPX DAM Day-Ahead Auction Iktatási szám / Notice #: Dátum / Of: 18/11/2014 HUPX-MN-DAM-2014-0023 Tárgy / Subject: Változások a HUPX másnapi piac
E208 akusztikus gitárkombó. Használati utasítás
E208 akusztikus gitárkombó Használati utasítás Óvintézkedések Olvassa el figyelmesen az utasításokat! Tartsa be ezeket az utasításokat! Vegyen figyelembe minden figyelmeztetést! Kövessen minden utasítást!
AX-DG105. FIGYELMEZTETÉS Balesetveszélyes v. akár halálos tevékenységek és körülmények meghatározása
AX-DG105 1. A kezelési útmutató használata A termék használata előtt figyelmesen olvassa el a kezelési útmutatót. Átolvasás után is tartsa kéznél az útmutatót, hogy szükség esetén elérhető legyen. Amennyiben
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2011. május 13. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2011. május 13. 8:00 Az írásbeli vizsga időtartama: 180 perc Pótlapok száma Tisztázati Piszkozati NEMZETI
Statistical Inference
Petra Petrovics Statistical Inference 1 st lecture Descriptive Statistics Inferential - it is concerned only with collecting and describing data Population - it is used when tentative conclusions about
Verification of the operation of resonance frequency charger with reference battery.
www.tuv.hu Oldal/ Page 2 / 40 Test report No.: 28231499 001 1. Measurement procedure Goal of testing Verification of the energy loaded into a battery, using the fast charger, and standard DC charger with
HAMBURG Használati útmutató Vezérlőmodul UKSM 24VDC Cikkszám: 260.033
HABURG Használati útmutató Vezérlőmodul UKS 24VDC Cikkszám: 260.033 Brandschutz-Technik und Rauchabzug GmbH Schnackenburgallee 41d D-22525 Hamburg Germany +49 40 89 71 20-0 Fax: +49 40 89 71 20-20 Internet:
Magyar ISO 9001:2000. English
Magyar ISO 9001:2000 English ISO 9001:2000 A z 1 9 9 3 - b a n a l a p í t o t t T E C. L A S r l. e g y 2 3 0 0 m 2- e s ü z e m m e l r e n d e l k e z õ, k o r l á t o l t f e l e l õ s s é g û t á
First experiences with Gd fuel assemblies in. Tamás Parkó, Botond Beliczai AER Symposium 2009.09.21 25.
First experiences with Gd fuel assemblies in the Paks NPP Tams Parkó, Botond Beliczai AER Symposium 2009.09.21 25. Introduction From 2006 we increased the heat power of our units by 8% For reaching this
OX 7042 OX 7062 OX 7102 OX 7104 OX 7202 OX 7204
OX 7042 OX 7062 OX 7102 OX 7104 OX 7202 OX 7204 l 5 complementary tools in a single instrument: OSCILLOSCOPE, FFT ANALYSER, MULTIMETER/WATTMETER, HARMONIC ANALYSER on voltage/current/power and RECORDER
Mérés és adatgyűjtés
Mérés és adatgyűjtés 9. óra Mingesz Róbert Szegedi Tudományegyetem 2012. április 2. MA - 9. óra Verzió: 2.1 Utolsó frissítés: 2012. április 2. 1/42 Tartalom I 1 További műszerek 2 Multifinkciós műszerek
Eladni könnyedén? Oracle Sales Cloud. Horváth Tünde Principal Sales Consultant 2014. március 23.
Eladni könnyedén? Oracle Sales Cloud Horváth Tünde Principal Sales Consultant 2014. március 23. Oracle Confidential Internal/Restricted/Highly Restricted Safe Harbor Statement The following is intended
Használati útmutató. Memóriával rendelkező digitális oszcilloszkóp sorozat AX-DS1000. Verziószám: V1.0
Használati útmutató Memóriával rendelkező digitális oszcilloszkóp sorozat AX-DS1000 Verziószám: V1.0 Nyilatkozat Copyright Transfer Multisort Elektronik Sp. z o.o. Minden jog fenntartva. A jelen használati
Alkalmazás-shop (Internet-kapcsolat szükséges)
Alkalmazás-shop (Internet-kapcsolat szükséges) 1) Lépj ide: Webszolgáltatások -> 1. kép: Alkalmazások indítása 2) Megjelenik az elérhető alkalmazások listája. 3) A távirányító navigációs gombjaival lépj
16F628A megszakítás kezelése
16F628A megszakítás kezelése A 'megszakítás' azt jelenti, hogy a program normális, szekvenciális futása valamilyen külső hatás miatt átmenetileg felfüggesztődik, és a vezérlést egy külön rutin, a megszakításkezelő
PC oszcilloszkópok ABC-je A-Z-ig A
PC oszcilloszkópok ABC-je A-Z-ig A Advanced display (magasabb szintű display) A PicoScope display majdnem teljes felületét a hullámalak megjelenítésére használja. Ez biztosítja a maximális adatmennyiség
Mérőerősítőkről. Borbás s Lajos
Mérőerősítőkről Borbás s Lajos 1 A mérőerm erősítők általános felépítése Kiegyenlített Wheatstone híd Fed with high-frequency a.c, Measuring sign (quantity) must be lower than the carrier frequency, Static,
LabView Academy. Alapismeretek II.
LabView Academy Alapismeretek II. A LabView grafikus fejlesztői környezet első verzióját több mint 20 éve, 1986-ban adta ki a National Instruments, és azóta vezető platform az ipari alkalmazások között,
Laboratóriumi munkaállomás és NI Akadémiai Program
NI ELVIS II Laboratóriumi munkaállomás és NI Akadémiai Program Kapcsolat Telefon: 06 80 204 704 Fax: 00 36 1 203 3490 Email: ni.hungary@ni.com Web: hungary.ni.com National Instruments Magyarország Neumann
EEA, Eionet and Country visits. Bernt Röndell - SES
EEA, Eionet and Country visits Bernt Röndell - SES Európai Környezetvédelmi Ügynökség Küldetésünk Annak elősegítése, hogy az EU és a tagállamok a szükséges információk alapján hozhassák meg a környezet
PolyNet Kft. Szinkron mérések IP környezetben. Szigeti Viktor Vezető Mérnök
PolyNet Kft. Szinkron mérések IP környezetben Szigeti Viktor Vezető Mérnök A hálózat szinkronizáció jelentősége A szinkron minőségnek alapvető hatása van a TDM és a szinkron IP (4G, LTE) hálózatok működésére
Statistical Dependence
Statistical Dependence Petra Petrovics Statistical Dependence Deinition: Statistical dependence exists when the value o some variable is dependent upon or aected by the value o some other variable. Independent
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Factor Analysis
Factor Analysis Factor analysis is a multiple statistical method, which analyzes the correlation relation between data, and it is for data reduction, dimension reduction and to explore the structure. Aim
XPS 8920 Setup and Specifications
XPS 8920 Setup and Specifications Számítógép típusa: XPS 8920 Szabályozó modell: D24M Szabályozó típus: D24M001 Megjegyzések, figyelmeztetések és Vigyázat jelzések MEGJEGYZÉS: A MEGJEGYZÉSEK fontos tudnivalókat
THE CHARACTERISTICS OF SOUNDS ANALYSIS AND SYNTHESIS OF SOUNDS
THE CHARACTERISTICS OF SOUNDS ANALYSIS AND SYNTHESIS OF SOUNDS Study aid for learning of Communication Acoustics VIHIA 000 2017. szeptember 27., Budapest Fülöp Augusztinovicz professor BME Dept. of Networked
Napenergia potenciál térképezése Debrecenben légi LIDAR adatok és légifelvételek alapján
Napenergia potenciál térképezése Debrecenben légi LIDAR adatok és légifelvételek alapján Enyedi Péter, Dr. Szabó Szilárd Fény-Tér-Kép Konferencia Gyöngyös, Károly Róbert Főiskola 2015. október 29-30. Távérzékelési
ASTRASUN HIBRID SZIGETÜZEMŰ INVERTEREK ÉS TÖLTÉSVEZÉRLŐK
Szerelési és üzemeltetési utasítás ASPI _._K HIBRID INVERTERHEZ 1. BEVEZETÉS Jelen leírás tartalmazza, az összes telepítéshez és üzemeltetéshez szükséges információt. Kérjük, hogy figyelmesen olvassa el
Computer Architecture
Computer Architecture Locality-aware programming 2016. április 27. Budapest Gábor Horváth associate professor BUTE Department of Telecommunications ghorvath@hit.bme.hu Számítógép Architektúrák Horváth
(NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV
Kommunikációs rendszerek programozása (NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV (5. mérés) SIP telefonközpont készítése Trixbox-szal 1 Mérés helye: Széchenyi István Egyetem, L-1/7 laboratórium, 9026 Győr, Egyetem
EK VIZSGÁLATI TANÚSÍTVÁNY EC Test Certificate (TC)
Magyar Kereskedelmi Engedélyezési Hivatal Metrológiai Hatóság Metrological Authority, Hungary H-1124 Budapest, Németvölgyi út 37-39 H-1535 Budapest Pf.: 919, fax (36)-1-3550598 EU bejelentett testület
Create & validate a signature
IOTA TUTORIAL 7 Create & validate a signature v.0.0 KNBJDBIRYCUGVWMSKPVA9KOOGKKIRCBYHLMUTLGGAV9LIIPZSBGIENVBQ9NBQWXOXQSJRIRBHYJ9LCTJLISGGBRFRTTWD ABBYUVKPYFDJWTFLICYQQWQVDPCAKNVMSQERSYDPSSXPCZLVKWYKYZMREAEYZOSPWEJLHHFPYGSNSUYRZXANDNQTTLLZA
REMOTE RADAR DETECTOR (connectable to GPS DETECTOR device.) BEÉPÍTHETŐ RADARDETEKTOR (GPS DETECTOR készülékhez) USER MANUAL / HASZNÁLATI ÚTMUTATÓ
REMOTE RADAR DETECTOR (connectable to GPS DETECTOR device.) BEÉPÍTHETŐ RADARDETEKTOR (GPS DETECTOR készülékhez) USER MANUAL / HASZNÁLATI ÚTMUTATÓ 1 REMOTE RADAR DETECTOR (connectable to GPS DETECTOR device.)
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Nonparametric Tests
Nonparametric Tests Petra Petrovics Hypothesis Testing Parametric Tests Mean of a population Population proportion Population Standard Deviation Nonparametric Tests Test for Independence Analysis of Variance
USER MANUAL Guest user
USER MANUAL Guest user 1 Welcome in Kutatótér (Researchroom) Top menu 1. Click on it and the left side menu will pop up 2. With the slider you can make left side menu visible 3. Font side: enlarging font
Önkiszolgáló BI infrastruktúra az adatvezérelt teljesítménymenedzsmentben
Önkiszolgáló BI infrastruktúra az adatvezérelt teljesítménymenedzsmentben Microsoft Future Decoded 2018.03.21. Krizsanovich Péter Ügyvezető igazgató, Stratégiai-, Tervezési és Controlling Igazgatóság Horváth
BKI13ATEX0030/1 EK-Típus Vizsgálati Tanúsítvány/ EC-Type Examination Certificate 1. kiegészítés / Amendment 1 MSZ EN 60079-31:2014
(1) EK-TípusVizsgálati Tanúsítvány (2) A potenciálisan robbanásveszélyes környezetben történő alkalmazásra szánt berendezések, védelmi rendszerek 94/9/EK Direktíva / Equipment or Protective Systems Intended
THS710A, THS720A, THS730A & THS720P TekScope
Service Manual THS710A, THS720A, THS730A & THS720P TekScope 070-9752-00 This document applies to to serial number B010100 and above and firmware version 1.00 and above. First printing: November 1996 Warning
Útmutató a Computer Setup (F10) segédprogram használatához dx2300 minitorony
Útmutató a Computer Setup (F10) segédprogram használatához dx2300 minitorony HP Compaq üzleti célú számítógép Copyright 2007 Hewlett-Packard Development Company, L.P. Az itt közölt információ értesítés
T W z àöä á TÜtÇç{tÄ á t [öüéå ^ äöçáöz
T W z àöä á TÜtÇç{tÄ á t [öüéå ^ äöçáöz Excel Customer Digital Experience Real time, personalised and omni channel PROVICE Informatika, 2016 1 Az Insurance Királyságban boldogan éldegélt a Királyfi az
HPS10 kézi oszcilloszkóp Rend.sz.: 120980. Tápellátás. [Az ábra hivatkozások az eredeti útmutatóra vonatkoznak]
Conrad Szaküzlet 1067 Budapest, Teréz krt. 23. Tel: (061) 302-3588 Conrad Vevőszolgálat 1124 Budapest, Jagelló út 30. Tel: (061) 319-0250 HPS10 kézi oszcilloszkóp Rend.sz.: 120980 [Az ábra hivatkozások
Coating thickness measurement
Measurement of coating thicknesses is known from, for example, the paint measurement for coating thickness at cars. In fact, these measurements are used much more widely in industrial applications. This
SOPHOS simple + secure. A dobozba rejtett biztonság UTM 9. Kókai Gábor - Sophos Advanced Engineer Balogh Viktor - Sophos Architect SOPHOS
SOPHOS simple + secure A dobozba rejtett biztonság UTM 9 Kókai Gábor - Sophos Advanced Engineer Balogh Viktor - Sophos Architect SOPHOS SOPHOS simple + secure Megint egy UTM? Egy újabb tűzfal extrákkal?
9. Gyakorlat: Network Load Balancing (NLB)
9. Gyakorlat: Network Load Balancing (NLB) 9.1. Az NLB01 és az NLB02 szerverek létrehozása 9.2. Az NLB01 szerver konfigurálása 9.3. Az NLB02 szerver konfigurálása 9.4. Teszt weboldal létrehozása 9.5. Az
DVI-HDCP-TP-TX100R, HDMI-TP-TX100R, DVI-HDCP-TP-RX100R, HDMI-TP-RX100R
CAT5, CAT6 and CAT7 Twisted Pair HDMI Extenders The Lightware DI-HDCP-TP and HDMI-TP 100 series deep color extenders can transmit HDMI or DI-D signals over two CAT5, CAT6 or CAT7 cables. They fully support
4. Gyakorlat: Csoportházirend beállítások
4. Gyakorlat: Csoportházirend beállítások 4.1. A Default Domain Policy jelszóra vonatkozó beállításai 4.2. Parancsikon, mappa és hálózati meghajtó megjelenítése csoport házirend segítségével 4.3. Alkalmazások
General information for the participants of the GTG Budapest, 2017 meeting
General information for the participants of the GTG Budapest, 2017 meeting Currency is Hungarian Forint (HUF). 1 EUR 310 HUF, 1000 HUF 3.20 EUR. Climate is continental, which means cold and dry in February