Artificial Neural Networks 3. Department of Cybernetics, CTU Prague.
|
|
- Erika Tóth
- 6 évvel ezelőtt
- Látták:
Átírás
1 Artificial Neural Networks 3 Jiří Kubaĺık Department of Cybernetics, CTU Prague
2 pcontents Hopfield Neural Network topology, Hebb learning rule, energy function and capacity, example - character recognition. Self-organization unsupervised learning, vector quantization, Lloyd s algorithm, Kohonen learning, Kohonen Self-Organizing Map, Example - building a model of a corridor from robotic data. Artificial Neural Networks 3
3 phopfield Neural Network :: Linear associative memory record in the memory is indexed by partial knowledge auto-associative refinement of the information given on the input Ex.: input: b/w portrait, output: corresponding colors hetero-associative knowledge related to the knowledge on the input is retrieved Ex.: input: b/w portrait, output: name of the person :: Topological structure all n neurons are of I/O type, bipolar neuron s output: y j { 1, 1}, neuron s potential: ξ j Z, w ji Z, w ii = 0, bias i = 0. Artificial Neural Networks 3
4 phopfield Neural Network: Adaptation :: Training set τ = {x k x k = (x k1,..., x kn ) { 1, 1} n, k = 1,..., p)} :: Hebb rule, named after neurophysiologist Donald Hebb that explains how conditional reflexes are established. Change in synaptic weight of the connection between two neurons is proportional to their mutual activity, i.e. to the product of the neurons states. If two neurons have the same value then the synaptic weight is strengthened, otherwise it is weakened. first neuron represents a condition, second neuron represents an action. :: Adaptation 1. t = 0: all weights are set to 0 w ji = 0 (j = 1,..., m, i = 1,..., n). 2. t = 1,..., p (p is a number of training samples): k th training sample is connected to the network and weights are adapted according to the Hebb rule: w (t) ji = w (t 1) ji + x kj x ki 1 j i n. Artificial Neural Networks 3
5 phopfield Neural Network: Adaptation cont. Resulting in a final configuration w ji = p x kj x ki 1 j i n. k=1 Symmetric network as w ji = w ij. Voting - training samples vote for links between neurons. Weight w ji = w ij represents a difference between a number of consistent states x kj = x ki, where each contributes by (x kj x ki = 1) to the final value of w ji, and a number of inconsistent states x kj x ki states (that contribute by x kj x ki = 1). sign of w ji indicates the result of voting, w ji is the strength of the winning alternative. Artificial Neural Networks 3
6 phopfield Neural Network: Active Mode :: Sequential mode 1. t = 0: y (0) i = x i (i = 1,..., n) 2. t > 0: neuron j is updated. First, its inner potential is calculated as n ξ (t 1) j = w ji y (t 1) i, then its new bipolar state is determined as i=1 y (t) j 1 ξ (t 1) j > 0 ξ (t 1) j = 0 = y (t 1) j -1 ξ (t 1) j < 0 Neurons are taken one by one, j th neuron at time t given as t = τn + j where τ is so-called macroscopic time, a number of periods all neurons were updated. Other neurons stay intact. Artificial Neural Networks 3
7 phopfield Neural Network: Active Mode 3. Calculation stops at t when the network gets into a stable state (states of the neurons do not change any more): y (t +n) j = y (t ) j (j = 1,..., n). Given the weights are symmetric, the sequential process stops for any input data. Thus, Hopfield network realizes a function y(w) : { 1, 1} n { 1, 1} n Output depends on the configuration w as well as the order in which the neurons are updated. :: Parallel mode in each time step, multiple neurons are updated; this might result in an unstable state when the network switches between two different states. Artificial Neural Networks 3
8 phopfield Neural Network: Energy Function :: Hopfield network resembles simple models of magnetic materials (spin glasses) in statistical physics. :: Energy function E(y) assigns a potential energy to every state of the network according to: E(y) = 1 n n w ji y j y i. 2 j=1 i=1 low E(y)... stable states; sign of w ji corresponds to a mutual relation between states of y i and y j. highe(y)... unstable states. :: Minimization of E(y) in active mode, the network starts with y (0) that generates energy E(y (0) ), that is iteratively eliminated E(y (t) ) E(y (t+1) ) till the process stops in time t at some local minimum of the energy function E(y (t ) ). This resembles a minimization of the error function by a gradient method since the new state y (t) j is equal to an inverse gradient of the energy function at y (t 1) j E n (y (t 1) j ) = w ji y (t 1) i. y j i=1 Artificial Neural Networks 3
9 phopfield Neural Network: Energy Function cont. :: Goal of the adaptation is to find a configuration w such that the network realizes autoassociative memory this means that for any input that is close to some training sample, the output will correspond to that training sample; so, every training sample should represent a local minimum of E(y) (a stable state, in other words). Surface of the energy function splits into several regions of attraction each region of attraction represents all input states of the network that converge to the same local minimum. phantoms do not correspond to any training sample. Removing phantoms: w ji = w ji x j x i for 1 j i n. Artificial Neural Networks 3
10 phopfield Neural Network: Capacity :: Capacity of the network is defined as the ratio p/n of the training samples p to the number of neurons n. determines its capability of reproducing the training samples. Given the states of neurons of the training samples are chosen by random with the same probability, then the probability P that the state of a given neuron in a training sample will be stable is P = π n/2p 0 e x2 dx. for p = 0.185n we can assume that a number of unstable neuron states in training patterns will not be greater than 1%; does not anything about whether the network will converge to a stable state that is close to the corresponding training pattern. :: Capacity analyzes For p 0.138n training patterns correspond to local minima of the energy function. So, the network can be used as an auto-associative memory. Ex.: In order the network to be able to work well for 10 training patterns, a number of 200 neurons would have to be used, which implies connections. Artificial Neural Networks 3
11 phopfield Neural Network: Example :: Character recognition Characters are represented by a matrix of pixels. Each pixel corresponds to one neuron, whose state y j = 1 and y j = 1 represents black and white color, respectively. Training set consists of 8 training patterns. Trained network was tested on a picture of character 3 which was partially damaged by changing 25% of its pixels. Question: What would be the output of the network if the input vector was an inversion of some of the training patterns? c J. Šíma and R. Neruda: Teoretické otázky neuronových sítí. Artificial Neural Networks 3
12 pself-organization and Vector Quantization :: Competitive learning output neurons compete for being active (only one neuron is active at a time). :: Goal is to find a set of representatives such that each of them would have the same probability of being the closest one to an input pattern chosen randomly from the same distribution as the distribution of training patterns. representatives have the same probability of being selected. :: Vector Quantization (VQ) a problem from a field of signal processing and approximation. Goal of VQ is to approximate a probability density p(x) of real input vectors x R n by means of a finite number of representatives w i R n ; (i = 1,..., h). Given a set of representatives, we can find to every vector x R n the closest w c : c = arg min { x w l } l=1,...,h Artificial Neural Networks 3
13 pvector Quantization One way to find a solution to this problem is to minimize an error of VQ defined as E = x w c 2 p(x) dx, when the probability density of p(x) is known, or E = 1 k k x (t) w c 2, when the problem is given by a finite set of training patterns. Where is Euclidean norm and c is defined as c = arg min l=1,...,h { x w l }. Formulas look simple, but t=1 c depends on both patterns x and representatives w, so it is not easy to express a gradient of error function w.r.t. parameters of w and use it in a standard minimization procedure. Instead, heuristic iterative procedures have been proposed for finding a solution. Artificial Neural Networks 3
14 pself-organization: Lloyd s Algorithm Lloyd s algorithm also known as Voronoi iteration or relaxation, a method for evenly distributing samples or objects, usually points. Input: Training set T = {x (t) ; t = 1,..., k} and parameter h that specifies a number of representatives w i. Output: Weights of the representatives w j ; j = 1,..., h. 1. Initialization: Set the representatives by random. 2. Assign representative w c to each vector x (t) T according to c = arg min l=1,...,h { x w l }. 3. Calculate error E = 1 k k t=1 x(t) w c If E < ε, then stop. 5. For each j = 1,..., h calculate t j according to t j = 1 T j 6. Assign w j = t j. 7. Goto step 2. x j T j x j. The algorithm iterates until the distribution is good enough. Another common termination criterion is when the maximum distance a point moves in one iteration is below some set limit. Representatives are updated after the whole training set has been processed. Artificial Neural Networks 3
15 pself-organizing Network: Kohonen Learning :: Topological structure 2-layer network n input neurons (x R n ), h output neurons (representatives), each representative j is connected to all input neurons; w j = (w ji,..., w jn ), j = 1,..., h. :: Active mode winner-takes-all strategy Output neurons take values y j {0, 1}, and just one output neuron is active. Output of each neuron with respect to its distance to the input vector x (t) is calculated as :: Adaptation Kohonen Learning Go through the training set and for each training vector run a competition among the representatives. Winner of each competition is updated according to Parameter 0 < θ 1 defines the change rate (decreases 1 0). Artificial Neural Networks 3
16 pkohonen Self-Organizing Map :: Self-organizing map (SOM) is trained using unsupervised learning to produce a lowdimensional, discretized representation of the input space of the training samples, called a map. The map seeks to preserve the topological properties of the input space. :: Topological structure like in self-organizing network, plus the output units are arranged into a topological structure (1D or 2D lattice). The topological structure defines for each unit c a neighborhood N s (c) of size s as a number of neurons whose distance to neuron c is less than or equal to s as N s (c) = {j; d(j, c) s} :: Active mode The neighborhood information is not considered. The output unit that is closest to the input vector is activated (y winner = 1). Other units are inactive (y loser = 0). Artificial Neural Networks 3
17 pkohonen Self-Organizing Map: Adaptation Takes into consideration the topological structure of neurons so that the winner neuron is updated along with all its neighbors. Neurons that are neighbors in the network should not be far apart in the input space as well. The size of the neighborhood is not a constant. At the beginning of the learning phase s is set to a rather big value (for example a half of the network size) and decreases towards zero. So, at the final stage of the process, only the winner neuron is considered for being updated. Weights of the representatives are updated according to where c is the winner neuron. This can be re-written as w (t) ji = w (t 1) ji + h c (j)(x (t) i w (t 1) ji ) if we define a function h c (j) as Artificial Neural Networks 3
18 pkohonen Self-Organizing Map: Adaptation cont. Usually, h c (j) is defined so that a transition between zero and non-zero values is continuous. Typically, a Gaussian function of the form d(j, c)2 h c (j) = h 0 exp( ) σ 2 is used with the center in c, width σ R, and parameter h 0 R defines a maximal shift of units. h 0 and σ decrease in time. More time-consuming approach. Hints for running the learning algorithm Representatives should be initialized so that they are maximally different. A number of iterations should be at least 500 h (typically, 10 4 to 10 5 ). We distinguish two phases 1. coarse-learning short stage, up to 1000 iterations; θ drops from 0.9 to 0.01, s drops from a value that is comparable to the size of a network to 1. Units are globally distributed. 2. fine-learning both θ and s decrease to 0. Several proofs of convergence have been given for one-dimensional Kohonen networks in onedimensional domains. There is no general proof of convergence for multidimensional networks. Artificial Neural Networks 3
19 pkohonen Self-Organizing Map: Example 1 :: Mapping a square with a two-dimensional lattice c R. Rojas: Neural Networks, Springer-Verlag, Berlin, The four diagrams display the state of the network after 100,1000, 5000, and iterations. In the second diagram several iterations have been overlapped to give a feeling of the iteration process. Since in this experiment the dimension of the input domain and of the network are the same, the learning process reaches a very satisfactory result. Artificial Neural Networks 3
20 pkohonen Self-Organizing Map: Example 2 :: Planar network with a knot c R. Rojas: Neural Networks, Springer-Verlag, Berlin, An example of a network which has reached a state very difficult to correct. A knot has appeared during the training process and, if the plasticity of the network has reached a low level, the knot will not be undone by further training, as the overlapped iterations in the diagram on the right, in figure show. Artificial Neural Networks 3
21 pexample: Building 3D Models by means of Self-Organization (1) Using one 2D lattice. Using two 2D lattices. c J. Koutník, Computational Intelligence Group, CTU Prague. Artificial Neural Networks 3
22 pexample: Building 3D Models by means of Self-Organization (2) c J. Koutnı k, R. Ma zl and M. Kulich: Building of 3D Environment Models for Mobile Robotics Using Self-Organization, In proceedings of PPSN Data Acquisition Experimental data were gathered by two laser range-finders orthogonally mounted on a mobile robot. Artificial Neural Networks 3
23 pexample: Initial Clustering 2. Data ( 105 vectors) were clustered using K-means algorithm. Artificial Neural Networks 3
24 pexample: Building Sub-maps 3. Each cluster is covered by a rectangular mesh constructed by Kohonen SOM algorithm. Artificial Neural Networks 3
25 pexample: Joining Phase 4. All meshes are joined together using nearest neighbor search algorithm with an adaptive threshold, which depends on mean distances between nodes in meshes being joined. Artificial Neural Networks 3
26 pexample: Re-Optimization 5. The SOM algorithm is executed again on the complex non-planar mesh for joints re-optimization. Artificial Neural Networks 3
27 preferences 1. Šíma, J., Neruda, R.: Teoretické otázky neuronových sítí. Praha: MATFYZPRESS, Rojas, R.: Neural Networks - A Systematic Introduction, Springer-Verlag, Berlin, New-York, (on-line: Artificial Neural Networks 3
Cluster Analysis. Potyó László
Cluster Analysis Potyó László What is Cluster Analysis? Cluster: a collection of data objects Similar to one another within the same cluster Dissimilar to the objects in other clusters Cluster analysis
On The Number Of Slim Semimodular Lattices
On The Number Of Slim Semimodular Lattices Gábor Czédli, Tamás Dékány, László Ozsvárt, Nóra Szakács, Balázs Udvari Bolyai Institute, University of Szeged Conference on Universal Algebra and Lattice Theory
Construction of a cube given with its centre and a sideline
Transformation of a plane of projection Construction of a cube given with its centre and a sideline Exercise. Given the center O and a sideline e of a cube, where e is a vertical line. Construct the projections
Correlation & Linear Regression in SPSS
Petra Petrovics Correlation & Linear Regression in SPSS 4 th seminar Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Correlation
Statistical Inference
Petra Petrovics Statistical Inference 1 st lecture Descriptive Statistics Inferential - it is concerned only with collecting and describing data Population - it is used when tentative conclusions about
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Hypothesis Testing. Petra Petrovics.
Hypothesis Testing Petra Petrovics PhD Student Inference from the Sample to the Population Estimation Hypothesis Testing Estimation: how can we determine the value of an unknown parameter of a population
Performance Modeling of Intelligent Car Parking Systems
Performance Modeling of Intelligent Car Parking Systems Károly Farkas Gábor Horváth András Mészáros Miklós Telek Technical University of Budapest, Hungary EPEW 2014, Florence, Italy Outline Intelligent
Correlation & Linear Regression in SPSS
Correlation & Linear Regression in SPSS Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise 1 - Correlation File / Open
Using the CW-Net in a user defined IP network
Using the CW-Net in a user defined IP network Data transmission and device control through IP platform CW-Net Basically, CableWorld's CW-Net operates in the 10.123.13.xxx IP address range. User Defined
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Correlation & Linear. Petra Petrovics.
Correlation & Linear Regression in SPSS Petra Petrovics PhD Student Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise
Mapping Sequencing Reads to a Reference Genome
Mapping Sequencing Reads to a Reference Genome High Throughput Sequencing RN Example applications: Sequencing a genome (DN) Sequencing a transcriptome and gene expression studies (RN) ChIP (chromatin immunoprecipitation)
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Nonparametric Tests
Nonparametric Tests Petra Petrovics Hypothesis Testing Parametric Tests Mean of a population Population proportion Population Standard Deviation Nonparametric Tests Test for Independence Analysis of Variance
KIEGÉSZÍTŽ FELADATOK. Készlet Bud. Kap. Pápa Sopr. Veszp. Kecsk. 310 4 6 8 10 5 Pécs 260 6 4 5 6 3 Szomb. 280 9 5 4 3 5 Igény 220 200 80 180 160
KIEGÉSZÍTŽ FELADATOK (Szállítási probléma) Árut kell elszállítani három telephelyr l (Kecskemét, Pécs, Szombathely) öt területi raktárba, melyek Budapesten, Kaposváron, Pápán, Sopronban és Veszprémben
Genome 373: Hidden Markov Models I. Doug Fowler
Genome 373: Hidden Markov Models I Doug Fowler Review From Gene Prediction I transcriptional start site G open reading frame transcriptional termination site promoter 5 untranslated region 3 untranslated
Széchenyi István Egyetem www.sze.hu/~herno
Oldal: 1/6 A feladat során megismerkedünk a C# és a LabVIEW összekapcsolásának egy lehetőségével, pontosabban nagyon egyszerű C#- ban írt kódból fordítunk DLL-t, amit meghívunk LabVIEW-ból. Az eljárás
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Factor Analysis
Factor Analysis Factor analysis is a multiple statistical method, which analyzes the correlation relation between data, and it is for data reduction, dimension reduction and to explore the structure. Aim
Csima Judit április 9.
Osztályozókról még pár dolog Csima Judit BME, VIK, Számítástudományi és Információelméleti Tanszék 2018. április 9. Csima Judit Osztályozókról még pár dolog 1 / 19 SVM (support vector machine) ez is egy
Computer Architecture
Computer Architecture Locality-aware programming 2016. április 27. Budapest Gábor Horváth associate professor BUTE Department of Telecommunications ghorvath@hit.bme.hu Számítógép Architektúrák Horváth
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Nonparametric Tests. Petra Petrovics.
Nonparametric Tests Petra Petrovics PhD Student Hypothesis Testing Parametric Tests Mean o a population Population proportion Population Standard Deviation Nonparametric Tests Test or Independence Analysis
Supporting Information
Supporting Information Cell-free GFP simulations Cell-free simulations of degfp production were consistent with experimental measurements (Fig. S1). Dual emmission GFP was produced under a P70a promoter
Pletykaalapú gépi tanulás teljesen elosztott környezetben
Pletykaalapú gépi tanulás teljesen elosztott környezetben Hegedűs István Jelasity Márk témavezető Szegedi Tudományegyetem MTA-SZTE Mesterséges Intelligencia Kutatócsopot Motiváció Az adat adatközpontokban
Phenotype. Genotype. It is like any other experiment! What is a bioinformatics experiment? Remember the Goal. Infectious Disease Paradigm
It is like any other experiment! What is a bioinformatics experiment? You need to know your data/input sources You need to understand your methods and their assumptions You need a plan to get from point
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében. Dicse Jenő üzletfejlesztési igazgató
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében Dicse Jenő üzletfejlesztési igazgató How to apply modern e-learning to improve the training of firefighters Jenő Dicse Director of
Ensemble Kalman Filters Part 1: The basics
Ensemble Kalman Filters Part 1: The basics Peter Jan van Leeuwen Data Assimilation Research Centre DARC University of Reading p.j.vanleeuwen@reading.ac.uk Model: 10 9 unknowns P[u(x1),u(x2),T(x3),.. Observations:
Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz
Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz Kvantumkapuk, áramkörök 2016. március 3. A kvantummechanika posztulátumai (1-2) 1. Állapotleírás Zárt fizikai rendszer aktuális állapota
Statistical Dependence
Statistical Dependence Petra Petrovics Statistical Dependence Deinition: Statistical dependence exists when the value o some variable is dependent upon or aected by the value o some other variable. Independent
TestLine - Angol teszt Minta feladatsor
Minta felaatsor venég Téma: Általános szintfelmérő Aláírás:... Dátum: 2016.05.29 08:18:49 Kérések száma: 25 kérés Kitöltési iő: 1:17:27 Nehézség: Összetett Pont egység: +6-2 Értékelés: Alaértelmezett értékelés
A rosszindulatú daganatos halálozás változása 1975 és 2001 között Magyarországon
A rosszindulatú daganatos halálozás változása és között Eredeti közlemény Gaudi István 1,2, Kásler Miklós 2 1 MTA Számítástechnikai és Automatizálási Kutató Intézete, Budapest 2 Országos Onkológiai Intézet,
2. Local communities involved in landscape architecture in Óbuda
Év Tájépítésze pályázat - Wallner Krisztina 2. Közösségi tervezés Óbudán Óbuda jelmondata: Közösséget építünk, ennek megfelelően a formálódó helyi közösségeket bevonva fejlesztik a közterületeket. Békásmegyer-Ófaluban
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel Timea Farkas Click here if your download doesn"t start
Lopocsi Istvánné MINTA DOLGOZATOK FELTÉTELES MONDATOK. (1 st, 2 nd, 3 rd CONDITIONAL) + ANSWER KEY PRESENT PERFECT + ANSWER KEY
Lopocsi Istvánné MINTA DOLGOZATOK FELTÉTELES MONDATOK (1 st, 2 nd, 3 rd CONDITIONAL) + ANSWER KEY PRESENT PERFECT + ANSWER KEY FELTÉTELES MONDATOK 1 st, 2 nd, 3 rd CONDITIONAL I. A) Egészítsd ki a mondatokat!
3. MINTAFELADATSOR KÖZÉPSZINT. Az írásbeli vizsga időtartama: 30 perc. III. Hallott szöveg értése
Oktatáskutató és Fejlesztő Intézet TÁMOP-3.1.1-11/1-2012-0001 XXI. századi közoktatás (fejlesztés, koordináció) II. szakasz ANGOL NYELV 3. MINTAFELADATSOR KÖZÉPSZINT Az írásbeli vizsga időtartama: 30 perc
Proxer 7 Manager szoftver felhasználói leírás
Proxer 7 Manager szoftver felhasználói leírás A program az induláskor elkezdi keresni az eszközöket. Ha van olyan eszköz, amely virtuális billentyűzetként van beállítva, akkor azokat is kijelzi. Azokkal
Választási modellek 3
Választási modellek 3 Prileszky István Doktori Iskola 2018 http://www.sze.hu/~prile Forrás: A Self Instructing Course in Mode Choice Modeling: Multinomial and Nested Logit Models Prepared For U.S. Department
Klaszterezés, 2. rész
Klaszterezés, 2. rész Csima Judit BME, VIK, Számítástudományi és Információelméleti Tanszék 208. április 6. Csima Judit Klaszterezés, 2. rész / 29 Hierarchikus klaszterezés egymásba ágyazott klasztereket
FÖLDRAJZ ANGOL NYELVEN GEOGRAPHY
Földrajz angol nyelven középszint 0513 ÉRETTSÉGI VIZSGA 2005. május 18. FÖLDRAJZ ANGOL NYELVEN GEOGRAPHY KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA STANDARD LEVEL WRITTEN EXAMINATION Duration of written examination:
Decision where Process Based OpRisk Management. made the difference. Norbert Kozma Head of Operational Risk Control. Erste Bank Hungary
Decision where Process Based OpRisk Management made the difference Norbert Kozma Head of Operational Risk Control Erste Bank Hungary About Erste Group 2010. 09. 30. 2 Erste Bank Hungary Erste Group entered
(c) 2004 F. Estrada & A. Jepson & D. Fleet Canny Edges Tutorial: Oct. 4, '03 Canny Edges Tutorial References: ffl imagetutorial.m ffl cannytutorial.m
Canny Edges Tutorial: Oct. 4, '03 Canny Edges Tutorial References: ffl imagetutorial.m ffl cannytutorial.m ffl ~jepson/pub/matlab/isetoolbox/tutorials ffl ~jepson/pub/matlab/utvistoolbox/tutorials ffl
Kvantum-informatika és kommunikáció 2015/2016 ősz. A kvantuminformatika jelölésrendszere szeptember 11.
Kvantum-informatika és kommunikáció 2015/2016 ősz A kvantuminformatika jelölésrendszere 2015. szeptember 11. Mi lehet kvantumbit? Kvantum eszközök (1) 15=5 3 Bacsárdi Képek forrása: IBM's László, Almaden
A forrás pontos megnevezésének elmulasztása valamennyi hivatkozásban szerzői jogsértés (plágium).
A szakirodalmi idézések és hivatkozások rendszere és megadásuk szabályai A bibliográfia legfontosabb szabályai Fogalma: Bibliográfiai hivatkozáson azoknak a pontos és kellően részletezett adatoknak az
Cashback 2015 Deposit Promotion teljes szabályzat
Cashback 2015 Deposit Promotion teljes szabályzat 1. Definitions 1. Definíciók: a) Account Client s trading account or any other accounts and/or registers maintained for Számla Az ügyfél kereskedési számlája
MATEMATIKA ANGOL NYELVEN
ÉRETTSÉGI VIZSGA MATEMATIKA ANGOL NYELVEN EMELT SZINTŰ ÍRÁSBELI VIZSGA 8:00 Az írásbeli vizsga időtartama: 240 perc Pótlapok száma Tisztázati Piszkozati OKTATÁSI ÉS KULTURÁLIS MINISZTÉRIUM Matematika angol
EN United in diversity EN A8-0206/419. Amendment
22.3.2019 A8-0206/419 419 Article 2 paragraph 4 point a point i (i) the identity of the road transport operator; (i) the identity of the road transport operator by means of its intra-community tax identification
USER MANUAL Guest user
USER MANUAL Guest user 1 Welcome in Kutatótér (Researchroom) Top menu 1. Click on it and the left side menu will pop up 2. With the slider you can make left side menu visible 3. Font side: enlarging font
IES TM Evaluating Light Source Color Rendition
IES TM-30-15 Evaluating Light Source Color Rendition "Original" "CRI = 80" Desaturated "CRI = 80" Saturated More metrics Color Fidelity Color Discrimination Color Preference Metrics/Measures R f (IES TM-30-15)
SQL/PSM kurzorok rész
SQL/PSM kurzorok --- 2.rész Tankönyv: Ullman-Widom: Adatbázisrendszerek Alapvetés Második, átdolgozott kiadás, Panem, 2009 9.3. Az SQL és a befogadó nyelv közötti felület (sormutatók) 9.4. SQL/PSM Sémában
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2008. május 26. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2008. május 26. 8:00 Az írásbeli vizsga időtartama: 180 perc Pótlapok száma Tisztázati Piszkozati OKTATÁSI
AZ ACM NEMZETKÖZI PROGRAMOZÓI VERSENYE
AZ ACM NEMZETKÖZI PROGRAMOZÓI VERSENYE Kuki Attila, kuki@math.klte.hu Kossuth Lajos Tudományegyetem, Információ Technológia Tanszék Abstract This paper is dedicated to the Scholastic Programming Contest
THE CHARACTERISTICS OF SOUNDS ANALYSIS AND SYNTHESIS OF SOUNDS
THE CHARACTERISTICS OF SOUNDS ANALYSIS AND SYNTHESIS OF SOUNDS Study aid for learning of Communication Acoustics VIHIA 000 2017. szeptember 27., Budapest Fülöp Augusztinovicz professor BME Dept. of Networked
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY A feladatsor három részbol áll 1. A vizsgáztató társalgást kezdeményez a vizsgázóval. 2. A vizsgázó egy szituációs feladatban vesz részt a
GEOGRAPHICAL ECONOMICS B
GEOGRAPHICAL ECONOMICS B ELTE Faculty of Social Sciences, Department of Economics Geographical Economics "B" KRUGMAN (1991) MODEL: EXTENSIONS Authors: Gábor Békés, Sarolta Rózsás Supervised by Gábor
General information for the participants of the GTG Budapest, 2017 meeting
General information for the participants of the GTG Budapest, 2017 meeting Currency is Hungarian Forint (HUF). 1 EUR 310 HUF, 1000 HUF 3.20 EUR. Climate is continental, which means cold and dry in February
Számítógéppel irányított rendszerek elmélete. A rendszer- és irányításelmélet legfontosabb részterületei. Hangos Katalin. Budapest
CCS-10 p. 1/1 Számítógéppel irányított rendszerek elmélete A rendszer- és irányításelmélet legfontosabb részterületei Hangos Katalin Villamosmérnöki és Információs Rendszerek Tanszék Folyamatirányítási
Számítógéppel irányított rendszerek elmélete. Gyakorlat - Mintavételezés, DT-LTI rendszermodellek
Számítógéppel irányított rendszerek elmélete Gyakorlat - Mintavételezés, DT-LTI rendszermodellek Hangos Katalin Villamosmérnöki és Információs Rendszerek Tanszék e-mail: hangos.katalin@virt.uni-pannon.hu
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY A feladatsor három részből áll 1. A vizsgáztató társalgást kezdeményez a vizsgázóval. 2. A vizsgázó egy szituációs feladatban vesz részt a
16F628A megszakítás kezelése
16F628A megszakítás kezelése A 'megszakítás' azt jelenti, hogy a program normális, szekvenciális futása valamilyen külső hatás miatt átmenetileg felfüggesztődik, és a vezérlést egy külön rutin, a megszakításkezelő
Dependency preservation
Adatbázis-kezelés. (4 előadás: Relácó felbontásai (dekomponálás)) 1 Getting lossless decomposition is necessary. But of course, we also want to keep dependencies, since losing a dependency means, that
MATEMATIKA ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2014. május 6. MATEMATIKA ANGOL NYELVEN EMELT SZINTŰ ÍRÁSBELI VIZSGA 2014. május 6. 8:00 Az írásbeli vizsga időtartama: 240 perc Pótlapok száma Tisztázati Piszkozati EMBERI ERŐFORRÁSOK
A golyók felállítása a Pool-biliárd 8-as játékának felel meg. A golyók átmérıje 57.2 mm. 15 számozott és egy fehér golyó. Az elsı 7 egyszínő, 9-15-ig
A golyók elhelyezkedése a Snooker alaphelyzetet mutatja. A golyók átmérıje 52 mm, egyszínőek. 15 db piros, és 1-1 db fehér, fekete, rózsa, kék, barna, zöld, sárga. A garázsban állítjuk fel, ilyenkor az
Dense Matrix Algorithms (Chapter 8) Alexandre David B2-206
Dense Matrix Algorithms (Chapter 8) Alexandre David B2-206 Dense Matrix Algorithm Dense or full matrices: few known zeros. Other algorithms for sparse matrix. Square matrices for pedagogical purposes only
Lecture 11: Genetic Algorithms
Lecture 11 1 Linear and Combinatorial Optimization Lecture 11: Genetic Algorithms Genetic Algorithms - idea Genetic Algorithms - implementation and examples Lecture 11 2 Genetic algorithms Algorithm is
Rezgésdiagnosztika. Diagnosztika 02 --- 1
Rezgésdiagnosztika Diagnosztika 02 --- 1 Diagnosztika 02 --- 2 A rezgéskép elemzésével kimutatható gépészeti problémák Minden gép, mely tartalmaz forgó részt (pl. motor, generátor, szivattyú, ventilátor,
Tudományos Ismeretterjesztő Társulat
Sample letter number 5. International Culture Festival PO Box 34467 Harrogate HG 45 67F Sonnenbergstraße 11a CH-6005 Luzern Re: Festival May 19, 2009 Dear Ms Atkinson, We are two students from Switzerland
First experiences with Gd fuel assemblies in. Tamás Parkó, Botond Beliczai AER Symposium 2009.09.21 25.
First experiences with Gd fuel assemblies in the Paks NPP Tams Parkó, Botond Beliczai AER Symposium 2009.09.21 25. Introduction From 2006 we increased the heat power of our units by 8% For reaching this
FÖLDRAJZ ANGOL NYELVEN
Földrajz angol nyelven középszint 0821 ÉRETTSÉGI VIZSGA 2009. május 14. FÖLDRAJZ ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI ÉRETTSÉGI VIZSGA JAVÍTÁSI-ÉRTÉKELÉSI ÚTMUTATÓ OKTATÁSI ÉS KULTURÁLIS MINISZTÉRIUM Paper
Lexington Public Schools 146 Maple Street Lexington, Massachusetts 02420
146 Maple Street Lexington, Massachusetts 02420 Surplus Printing Equipment For Sale Key Dates/Times: Item Date Time Location Release of Bid 10/23/2014 11:00 a.m. http://lps.lexingtonma.org (under Quick
Create & validate a signature
IOTA TUTORIAL 7 Create & validate a signature v.0.0 KNBJDBIRYCUGVWMSKPVA9KOOGKKIRCBYHLMUTLGGAV9LIIPZSBGIENVBQ9NBQWXOXQSJRIRBHYJ9LCTJLISGGBRFRTTWD ABBYUVKPYFDJWTFLICYQQWQVDPCAKNVMSQERSYDPSSXPCZLVKWYKYZMREAEYZOSPWEJLHHFPYGSNSUYRZXANDNQTTLLZA
A jövedelem alakulásának vizsgálata az észak-alföldi régióban az 1997-99. évi adatok alapján
A jövedelem alakulásának vizsgálata az észak-alföldi régióban az 1997-99. évi adatok alapján Rózsa Attila Debreceni Egyetem Agrártudományi Centrum, Agrárgazdasági és Vidékfejlesztési Intézet, Számviteli
Local fluctuations of critical Mandelbrot cascades. Konrad Kolesko
Local fluctuations of critical Mandelbrot cascades Konrad Kolesko joint with D. Buraczewski and P. Dyszewski Warwick, 18-22 May, 2015 Random measures µ µ 1 µ 2 For given random variables X 1, X 2 s.t.
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2013. május 23. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2013. május 23. 8:00 Az írásbeli vizsga időtartama: 180 perc Pótlapok száma Tisztázati Piszkozati EMBERI
MATEMATIKA ANGOL NYELVEN MATHEMATICS
ÉRETTSÉGI VIZSGA 2005. május 10. MATEMATIKA ANGOL NYELVEN MATHEMATICS EMELT SZINTŰ ÍRÁSBELI VIZSGA HIGHER LEVEL WRITTEN EXAMINATION Az írásbeli vizsga időtartama: 240 perc Time allowed for the examination:
Cloud computing. Cloud computing. Dr. Bakonyi Péter.
Cloud computing Cloud computing Dr. Bakonyi Péter. 1/24/2011 1/24/2011 Cloud computing 2 Cloud definició A cloud vagy felhő egy platform vagy infrastruktúra Az alkalmazások és szolgáltatások végrehajtására
Tavaszi Sporttábor / Spring Sports Camp. 2016. május 27 29. (péntek vasárnap) 27 29 May 2016 (Friday Sunday)
Tavaszi Sporttábor / Spring Sports Camp 2016. május 27 29. (péntek vasárnap) 27 29 May 2016 (Friday Sunday) SZÁLLÁS / ACCOMODDATION on a Hotel Gellért*** szálloda 2 ágyas szobáiban, vagy 2x2 ágyas hostel
A logaritmikus legkisebb négyzetek módszerének karakterizációi
A logaritmikus legkisebb négyzetek módszerének karakterizációi Csató László laszlo.csato@uni-corvinus.hu MTA Számítástechnikai és Automatizálási Kutatóintézet (MTA SZTAKI) Operációkutatás és Döntési Rendszerek
STUDENT LOGBOOK. 1 week general practice course for the 6 th year medical students SEMMELWEIS EGYETEM. Name of the student:
STUDENT LOGBOOK 1 week general practice course for the 6 th year medical students Name of the student: Dates of the practice course: Name of the tutor: Address of the family practice: Tel: Please read
7 th Iron Smelting Symposium 2010, Holland
7 th Iron Smelting Symposium 2010, Holland Október 13-17 között került megrendezésre a Hollandiai Alphen aan den Rijn városában található Archeon Skanzenben a 7. Vasolvasztó Szimpózium. Az öt napos rendezvényen
Searching in an Unsorted Database
Searching in an Unsorted Database "Man - a being in search of meaning." Plato History of data base searching v1 2018.04.20. 2 History of data base searching v2 2018.04.20. 3 History of data base searching
(NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV
Kommunikációs rendszerek programozása (NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV (5. mérés) SIP telefonközpont készítése Trixbox-szal 1 Mérés helye: Széchenyi István Egyetem, L-1/7 laboratórium, 9026 Győr, Egyetem
Can/be able to. Using Can in Present, Past, and Future. A Can jelen, múlt és jövő idejű használata
Can/ Can is one of the most commonly used modal verbs in English. It be used to express ability or opportunity, to request or offer permission, and to show possibility or impossibility. A az egyik leggyakrabban
PIACI HIRDETMÉNY / MARKET NOTICE
PIACI HIRDETMÉNY / MARKET NOTICE HUPX DAM Másnapi Aukció / HUPX DAM Day-Ahead Auction Iktatási szám / Notice #: Dátum / Of: 18/11/2014 HUPX-MN-DAM-2014-0023 Tárgy / Subject: Változások a HUPX másnapi piac
Société Réaliste / 2012.06.05. Ocular Braces
Société Réaliste / 2012.06.05. Ocular Braces Az Ocular Braces ( Szem-támaszok ) egy tipográfiai munka két tárgyi következménnyel: egyrészről vállalati emblémaként szolgál az insurart-nak, másrészről egy
Utolsó frissítés / Last update: február Szerkesztő / Editor: Csatlós Árpádné
Utolsó frissítés / Last update: 2016. február Szerkesztő / Editor: Csatlós Árpádné TARTALOM / Contents BEVEZETŐ / Introduction... 2 FELNŐTT TAGBÉLYEGEK / Adult membership stamps... 3 IFJÚSÁGI TAGBÉLYEGEK
T Á J É K O Z T A T Ó. A 1108INT számú nyomtatvány a http://www.nav.gov.hu webcímen a Letöltések Nyomtatványkitöltő programok fülön érhető el.
T Á J É K O Z T A T Ó A 1108INT számú nyomtatvány a http://www.nav.gov.hu webcímen a Letöltések Nyomtatványkitöltő programok fülön érhető el. A Nyomtatványkitöltő programok fület választva a megjelenő
MAKING MODERN LIVING POSSIBLE. Danfoss Heating Solutions
MAKING MODERN LIVING POSSIBLE Danfoss Danfoss Link Link HC Hidronikus HC Hydronic szabályozó Controller Szerelési Installation útmutató Guide Danfoss Heating Solutions Szerelési útmutató Tartalomjegyzék
FÖLDRAJZ ANGOL NYELVEN GEOGRAPHY
Földrajz angol nyelven középszint 0623 ÉRETTSÉGI VIZSGA 2007. május 15. FÖLDRAJZ ANGOL NYELVEN GEOGRAPHY KÖZÉPSZINTŰ ÍRÁSBELI ÉRETTSÉGI VIZSGA INTERMEDIATE LEVEL WRITTEN EXAM JAVÍTÁSI-ÉRTÉKELÉSI ÚTMUTATÓ
Descriptive Statistics
Descriptive Statistics Petra Petrovics DESCRIPTIVE STATISTICS Definition: Descriptive statistics is concerned only with collecting and describing data Methods: - statistical tables and graphs - descriptive
Efficient symmetric key private authentication
Efficient symmetric key private authentication Cryptographic Protocols (EIT ICT MSc) Dr. Levente Buttyán Associate Professor BME Hálózati Rendszerek és Szolgáltatások Tanszék Lab of Cryptography and System
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2012. május 25. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2012. május 25. 8:00 Az írásbeli vizsga időtartama: 180 perc Pótlapok száma Tisztázati Piszkozati NEMZETI
Supplementary materials to: Whole-mount single molecule FISH method for zebrafish embryo
Supplementary materials to: Whole-mount single molecule FISH method for zebrafish embryo Yuma Oka and Thomas N. Sato Supplementary Figure S1. Whole-mount smfish with and without the methanol pretreatment.
Ültetési és öntözési javaslatok. Planting and watering instructions
Ültetési és öntözési javaslatok Planting and watering instructions 1 Önöntöző-rendszer Sub-irrigation 2 Kedves növénykedvelő A LECHUZA önöntöző rendszerrel növényeink természetüknél fogva gyönyörű virágokat
Smaller Pleasures. Apróbb örömök. Keleti lakk tárgyak Répás János Sándor mûhelyébõl Lacquerware from the workshop of Répás János Sándor
Smaller Pleasures Apróbb örömök Keleti lakk tárgyak Répás János Sándor mûhelyébõl Lacquerware from the workshop of Répás János Sándor Smaller Pleasures Oriental lacquer, or urushi by its frequently used
Kezdőlap > Termékek > Szabályozó rendszerek > EASYLAB és TCU-LON-II szabályozó rendszer LABCONTROL > Érzékelő rendszerek > Típus DS-TRD-01
Típus DS-TRD FOR EASYLAB FUME CUPBOARD CONTROLLERS Sash distance sensor for the variable, demand-based control of extract air flows in fume cupboards Sash distance measurement For fume cupboards with vertical
FÖLDRAJZ ANGOL NYELVEN
Földrajz angol nyelven középszint 1311 ÉRETTSÉGI VIZSGA 2013. május 15. FÖLDRAJZ ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI ÉRETTSÉGI VIZSGA JAVÍTÁSI-ÉRTÉKELÉSI ÚTMUTATÓ EMBERI ERŐFORRÁSOK MINISZTÉRIUMA Paper
Abigail Norfleet James, Ph.D.
Abigail Norfleet James, Ph.D. Left side of brain develops first in girls, right in boys o Probably source of girls verbal skills o And source of boys spatial skills Pre-frontal lobes Control impulses and
Adatbázisok 1. Rekurzió a Datalogban és SQL-99
Adatbázisok 1 Rekurzió a Datalogban és SQL-99 Expressive Power of Datalog Without recursion, Datalog can express all and only the queries of core relational algebra. The same as SQL select-from-where,
Bird species status and trends reporting format for the period (Annex 2)
1. Species Information 1.1 Member State Hungary 1.2.2 Natura 2000 code A634-B 1.3 Species name Ardea purpurea purpurea 1.3.1 Sub-specific population East Europe, Black Sea & Mediterranean/Sub-Saharan Africa
PETER PAZMANY CATHOLIC UNIVERSITY Consortium members SEMMELWEIS UNIVERSITY, DIALOG CAMPUS PUBLISHER
SEMMELWEIS UNIVERSITY PETER PAMANY CATLIC UNIVERSITY Development of Complex Curricula for Molecular Bionics and Infobionics Programs within a consortial* framework** Consortium leader PETER PAMANY CATLIC
MATEMATIKA ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2017. október 17. MATEMATIKA ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2017. október 17. 8:00 I. Időtartam: 57 perc Pótlapok száma Tisztázati Piszkozati EMBERI ERŐFORRÁSOK MINISZTÉRIUMA
Cloud computing Dr. Bakonyi Péter.
Cloud computing Dr. Bakonyi Péter. 1/24/2011 Cloud computing 1/24/2011 Cloud computing 2 Cloud definició A cloud vagy felhő egy platform vagy infrastruktúra Az alkalmazások és szolgáltatások végrehajtására
Utolsó frissítés / Last update: Szeptember / September Szerkesztő / Editor: Csatlós Árpádné
Utolsó frissítés / Last update: 2018. Szeptember / September Szerkesztő / Editor: Csatlós Árpádné TARTALOM / Contents BEVEZETŐ / Introduction... 2 FELNŐTT TAGBÉLYEGEK / Adult membership stamps... 3 IFJÚSÁGI