Grammatical Evolution. Department of Cybernetics, CTU Prague.
|
|
- Ilona Molnárné
- 6 évvel ezelőtt
- Látták:
Átírás
1 Grammatical Evolution Jiří Kubaĺık Department of Cybernetics, CTU Prague
2 pcontents GP and closure problem Strongly-typed GP Grammatical Evolution Representation and genotype-phenotype mapping Crossover operators Automatically defined functions Examples: Symbolic regression, Artificial ant problem Grammatical Evolution
3 pgp and Closure Problem: Motivation Example Closure - any non-terminal should be able to handle as an argument any data type and value returned from a terminal or non-terminal. Fuzzy-rule based classifier consists of fuzzy if-then rules of type where IF(x1 is medium) and (x3 is large) THEN class = 1 with cf = 0.73 Linguistic terms small, medium small, medium, medium large, large, Fuzzy membership functions approximate the confidence in that the crisp value is represented by the linguistic term. Grammatical Evolution
4 pgp and Closure Problem: Motivation Example A syntactically correct tree representing a classifier as a disjunction of the three rules: IF(x1 is small) THEN class = 1 with cf = 0.67, IF(x2 is large) THEN class = 2 with cf = 0.89, IF(x1 is medium) and (x3 is large) THEN class = 1 with cf = Grammatical Evolution
5 pgp and Closure Problem: Motivation Example Using simple subtree-swapping crossover or subtree-regeneration mutation an invalid tree that does not represent a syntactically correct rule base can be generated. Obviously, this happens due to the fact that the closure constraint does not hold here. Standard GP is not designed to handle a mixture of data types. Grammatical Evolution
6 pgp and Closure Problem: Motivation Example Using simple subtree-swapping crossover or subtree-regeneration mutation an invalid tree that does not represent a syntactically correct rule base can be generated. Obviously, this happens due to the fact that the closure constraint does not hold here. Standard GP is not designed to handle a mixture of data types. What can we do to get around the problem with the closure constraint? Grammatical Evolution
7 pstrongly-typed Genetic Programming STGP - defines syntax of evolved tree structures by specifying the data types of each argument of each non-terminal and the data types returned by each terminal and non-terminal. prevents generating illegal individuals, quite a big overhead = inefficient for manipulating large trees. Any other elegant way to get around the closure constraint? Grammatical Evolution
8 pgrammatical Evolution Grammatical Evolution (GE) a grammatical-based GP system that can evolve complete programs in an arbitrary language using a variable-length binary/integer strings. The evolutionary process is performed on variable-length binary strings. A genotype-phenotype mapping process is used to generate programs (expression trees) in any language by using the binary strings to select production rules in a Backus-Naur form (BNF) grammar definition. By the use of the mapping between linear chromosomes and programs the closure problem is overcome, only valid programs are generated. The syntactically correct programs are evaluated by a fitness function. Grammatical Evolution
9 pgrammatical Evolution Grammatical Evolution (GE) a grammatical-based GP system that can evolve complete programs in an arbitrary language using a variable-length binary/integer strings. The evolutionary process is performed on variable-length binary strings. A genotype-phenotype mapping process is used to generate programs (expression trees) in any language by using the binary strings to select production rules in a Backus-Naur form (BNF) grammar definition. By the use of the mapping between linear chromosomes and programs the closure problem is overcome, only valid programs are generated. The syntactically correct programs are evaluated by a fitness function. A user can specify and modify the grammar, whilst ignoring the task of designing specific genetic search operators. Grammatical Evolution
10 pbackus-naur Form Backus-Naur form (BNF) is a notation for expressing the grammar of a language in the form of production rules. BNF is represented by the tuple {N, T, P, S}, where T is a set of terminals items that can appear in the language (+, -, X,...), N is a set of nonterminals items that can be further expanded into one or more terminals or nonterminals, P is a set of production rules that map the elements of N to T, S is a start symbol that is a member of N. Remark: Do not mistake terminals/nonterminals used in GP for terminals/nonterminals used in GP! Grammatical Evolution
11 pbnf: Arithmetical expressions N = {expr, op, pre op } P : <expr> ::= <expr><op><expr> (0) T = {sin, +,, /,, X, 1.0, (, )} (<expr><op><expr>) (1) S = expr <pre-op>(<expr>) (2) <var> (3) <op> ::= + (0) - (1) / (2) (3) <pre-op> ::= cos (0) <var> ::= X (0) 1.0 (1) Each nonterminal has one or more possible ways of expansion. Example of a tree compliant with the BNF. Grammatical Evolution
12 pgenotype-phenotype Mapping Process: Modulo Rule Variable-length binary chromosomes are transcribed to codons (a consecutive group of 8 bits encoding an integer number) The codons are used in a mapping function to select an appropriate production rule from the BNF definition to expand a given nonterminal using the following mapping function rule=(codon integer value) modulo (number of rules for the current nonterminal) This implies that only syntactically correct programs can be generated!!! Grammatical Evolution
13 pgenotype-phenotype Mapping Process: Modulo Rule Example: Assume that a nonterminal <op> is to be expanded, and the codon being read produces the integer 6. There are four production rules to choose from <op> ::= + (0) - (1) / (2) (3) Then would select rule (2). 6 modulo 4 = 2 Grammatical Evolution
14 pgenotype-phenotype Mapping Process: Wrapping Mapping finishes when all of the nonterminals have been expanded. During the genotype-phenotype mapping process it is possible for individuals to run out of codons and in this case so called wrapping is used the chromosome is being traversed multiple times, so the codons are reused several times. Each time the same codon is expressed it will always generate the same integer value, but depending on the current nonterminal to which it is being applied, it may result in the selection of a different production rule. The codon 240 can be read one time to expand the nonterminal <expr>, another time to expand the nonterminal <pre-op>, etc. chromosome: A maximum number of wrapping events is specified if an incomplete mapping occurs after the specified number of wrapping events, the individual is assigned the lowest possible fitness value. To reduce the number of invalid individuals in the population, a steady-state replacement is used. Grammatical Evolution
15 pgenotype-phenotype Mapping Process: Example Grammatical Evolution
16 pgrammatical Evolution: Genetic Code Degeneracy Neutral mutations mutations that have no effect on the phenotypic fitness of an individual. cause diversity within equally fit individuals in the search space. Adaptive mutations mutations that change the phenotype. explore the solution space. Neutral theory of evolution most mutations driving the evolutionary process are neutral with respect to the phenotype. Degenerate genetic code a genetic code with redundancy. Each codon can represent a number of distinct integer values many of these values can represent the same production rule. Various genotypes can represent the same phenotype, thus facilitating the maintenance of genetic diversity within a population. Example: Subtle changes in the genotype may have no effect on the phenotype. A rule for operator selection: <op> ::= + (0) - (1) / (2) (3) If the current codon value were 8, then 8 modulo 4 = 2 would select rule (0); the same rule that would be selected by codon value 4, 12, 16, etc. Grammatical Evolution
17 pgrammatical Evolution: 1-point Crossover Ripple effect a single crossover event can remove any number of subtrees to the right of the crossover point. It is more exploratory than the subtree crossover used in GP. It transmits on average half of the genetic material for each parent, It is equally recombinative regardless of the size of the individuals involved, The subtree crossover exchanges less and less genetic material as the trees are growing. It is less likely to get trapped in a local optimum than the subtree crossover. The head sequence of codons does not change its meaning, while the tale sequence may or may not change its interpretation (the function of a gene depends on the genes that precede it) implying a limited exploitation capability of the recombination operation. Grammatical Evolution
18 pgrammatical Evolution: Evolutionary Algorithm Typically, the search is carried out by an EA. However, any search method with the ability to operate over variable-length binary strings could be employed. Grammatical Differential Evolution, Grammatical Swarm. Grammatical Evolution
19 pgrammatical Evolution for Symbolic Regression The grammar used N = {expr, op, pre op } P : <expr> ::= <expr><op><expr> (0) T = {sin, cos, exp, log, (<expr><op><expr>) (1) +,, /,, X, 1.0, (, )} <pre-op>(<expr>) (2) S = expr <var> (3) <op> ::= + (0) - (1) / (2) (3) <pre-op> ::= sin (0) cos (1) exp (2) log (3) <var> ::= X (0) 1.0 (1) Grammatical Evolution
20 pgrammatical Evolution for Symbolic Regression Experimental setup: Grammatical Evolution
21 pgrammatical Evolution for Symbolic Regression Results: GE compared to standard GP. GE successfully found the target function. GP slightly outperforms GE this might be attributed to more careful initialization of the initial population in the GP. Grammatical Evolution
22 pgrammatical Evolution for Artificial Ant Problem Ant capabilities detection of the food right in front of him in direction he faces. actions observable from outside MOVE makes a step and eats a food piece if there is some, LEFT turns left, RIGHT turns right, NOP no operation. Goal is to find a strategy that would navigate an ant through the grid so that it finds all the food pieces in the given time (600 time steps). Santa Fe trail toroidal grid with 89 food pieces. Obstacles: 1, 2 strait; 1, 2, 3 right/left. Grammatical Evolution
23 pgrammatical Evolution for Artificial Ant Problem The grammar used N = {code, line, if-statement, op} P : <code> ::= <line> (0) T = {lef t(), right(), move(), <code><line> (1) food ahead, else, if, {, }, (, ), ; } <line> <if-statement> (0) S = code <op> (1) <if-statement> ::= if (food ahead()) (0) {<line>} else {<line>} <op> ::= left() (0) right() (1) move() (2). Grammatical Evolution
24 pgrammatical Evolution for Artificial Ant Problem Experimental setup: Grammatical Evolution
25 pgrammatical Evolution for Artificial Ant Problem GE was successful at finding a solution to the Santa Fe trail. Solutions have a form of a multiline code. GE outperforms GP: The left side figure shows the performance of the GP using solution length and the number of food pieces eaten in the fitness. The right side figure shows the performance of the GP using just the number of food pieces eaten in the fitness measure. move(); left(); if(food ahead()) left(); else right(); right(); if(food ahead()) move(); else left(); Each solution is executed in a loop until the number of time steps allowed is reached. Grammatical Evolution
26 pgrammatical Evolution and Automatically Defined Functions Three approaches illustrating the possibilities to adopt the principles of automatically capturing modularity from GP 1. Grammatical Evolution by Grammatical Evolution or meta-grammar GE (GE) 2 the input grammar is used to specify the construction of another syntactically correct grammar, which is then used in a mapping process to construct a solution. 2. GE grammar with the ability to define one ADF. 3. GE grammar with the ability to define any number of ADFs. Grammatical Evolution
27 pgrammatical Evolution by Grammatical Evolution (GE) 2 is a variant of GE which evolves the input grammar itself, thus it has an ability to automatically define and evolve a number of ADFs. The meta grammar dictates the construction of the solution grammar. Two separate, variable-length binary chromosomes are used Solution grammar chrom. to generate the solution grammar from the meta grammar. Solution structure chromosome to generate the solution itself. Crossover operates between homologous chromosomes. The solution grammar and the structure of the solution are evolved simultaneously. Grammatical Evolution
28 pgrammatical Evolution by Grammatical Evolution Example: Meta grammar for the artificial ant problem. Quotes are used to escape symbols, e.g. not expand non-terminals in the meta-grammar, instead expand them in the solution grammar. adf () is a function call to a defined function. A codon from the solution chromosome is used to select which function is called. In a solution grammar the multiple defined ADFs are post-processed to make each function signature unique. Grammatical Evolution
29 pge Grammar with one ADF GE evolving a population of individuals, each individual has a single chromosome that encodes both the main program as well as the ADF. A header of a single ADF, adf0(), is defined so only a body of this particular ADF can be generated using the chromosome. Grammatical Evolution
30 pge Grammar with Multiple ADFs A number of ADFs can be generated via the non-terminal <adfs> using the chromosome. adf*() is expanded to enumerate all the allowed ADFs. Grammatical Evolution
31 pge with ADFs: Results on Santa Fe Ant Trail Irrespective of the ADF representation, the presence of ADFs alone is sufficient to significantly improve performance of the GE. Grammatical Evolution
32 preading Poli, R., Langdon, W., McPhee, N.F.: A Field Guide to Genetic Programming, O Neill, M., Ryan, C.: Grammatical Evolution. IEEE Transactions on Evolutionary Computation, VOL. 5, NO. 4, AUGUST Grammatical-Evolution.org Grammatical Evolution
Széchenyi István Egyetem www.sze.hu/~herno
Oldal: 1/6 A feladat során megismerkedünk a C# és a LabVIEW összekapcsolásának egy lehetőségével, pontosabban nagyon egyszerű C#- ban írt kódból fordítunk DLL-t, amit meghívunk LabVIEW-ból. Az eljárás
Construction of a cube given with its centre and a sideline
Transformation of a plane of projection Construction of a cube given with its centre and a sideline Exercise. Given the center O and a sideline e of a cube, where e is a vertical line. Construct the projections
Performance Modeling of Intelligent Car Parking Systems
Performance Modeling of Intelligent Car Parking Systems Károly Farkas Gábor Horváth András Mészáros Miklós Telek Technical University of Budapest, Hungary EPEW 2014, Florence, Italy Outline Intelligent
16F628A megszakítás kezelése
16F628A megszakítás kezelése A 'megszakítás' azt jelenti, hogy a program normális, szekvenciális futása valamilyen külső hatás miatt átmenetileg felfüggesztődik, és a vezérlést egy külön rutin, a megszakításkezelő
Mapping Sequencing Reads to a Reference Genome
Mapping Sequencing Reads to a Reference Genome High Throughput Sequencing RN Example applications: Sequencing a genome (DN) Sequencing a transcriptome and gene expression studies (RN) ChIP (chromatin immunoprecipitation)
Statistical Inference
Petra Petrovics Statistical Inference 1 st lecture Descriptive Statistics Inferential - it is concerned only with collecting and describing data Population - it is used when tentative conclusions about
Cluster Analysis. Potyó László
Cluster Analysis Potyó László What is Cluster Analysis? Cluster: a collection of data objects Similar to one another within the same cluster Dissimilar to the objects in other clusters Cluster analysis
On The Number Of Slim Semimodular Lattices
On The Number Of Slim Semimodular Lattices Gábor Czédli, Tamás Dékány, László Ozsvárt, Nóra Szakács, Balázs Udvari Bolyai Institute, University of Szeged Conference on Universal Algebra and Lattice Theory
Lecture 11: Genetic Algorithms
Lecture 11 1 Linear and Combinatorial Optimization Lecture 11: Genetic Algorithms Genetic Algorithms - idea Genetic Algorithms - implementation and examples Lecture 11 2 Genetic algorithms Algorithm is
Genome 373: Hidden Markov Models I. Doug Fowler
Genome 373: Hidden Markov Models I Doug Fowler Review From Gene Prediction I transcriptional start site G open reading frame transcriptional termination site promoter 5 untranslated region 3 untranslated
SQL/PSM kurzorok rész
SQL/PSM kurzorok --- 2.rész Tankönyv: Ullman-Widom: Adatbázisrendszerek Alapvetés Második, átdolgozott kiadás, Panem, 2009 9.3. Az SQL és a befogadó nyelv közötti felület (sormutatók) 9.4. SQL/PSM Sémában
Using the CW-Net in a user defined IP network
Using the CW-Net in a user defined IP network Data transmission and device control through IP platform CW-Net Basically, CableWorld's CW-Net operates in the 10.123.13.xxx IP address range. User Defined
Correlation & Linear Regression in SPSS
Petra Petrovics Correlation & Linear Regression in SPSS 4 th seminar Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Correlation
Proxer 7 Manager szoftver felhasználói leírás
Proxer 7 Manager szoftver felhasználói leírás A program az induláskor elkezdi keresni az eszközöket. Ha van olyan eszköz, amely virtuális billentyűzetként van beállítva, akkor azokat is kijelzi. Azokkal
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Hypothesis Testing. Petra Petrovics.
Hypothesis Testing Petra Petrovics PhD Student Inference from the Sample to the Population Estimation Hypothesis Testing Estimation: how can we determine the value of an unknown parameter of a population
Cashback 2015 Deposit Promotion teljes szabályzat
Cashback 2015 Deposit Promotion teljes szabályzat 1. Definitions 1. Definíciók: a) Account Client s trading account or any other accounts and/or registers maintained for Számla Az ügyfél kereskedési számlája
PIACI HIRDETMÉNY / MARKET NOTICE
PIACI HIRDETMÉNY / MARKET NOTICE HUPX DAM Másnapi Aukció / HUPX DAM Day-Ahead Auction Iktatási szám / Notice #: Dátum / Of: 18/11/2014 HUPX-MN-DAM-2014-0023 Tárgy / Subject: Változások a HUPX másnapi piac
Dependency preservation
Adatbázis-kezelés. (4 előadás: Relácó felbontásai (dekomponálás)) 1 Getting lossless decomposition is necessary. But of course, we also want to keep dependencies, since losing a dependency means, that
Computer Architecture
Computer Architecture Locality-aware programming 2016. április 27. Budapest Gábor Horváth associate professor BUTE Department of Telecommunications ghorvath@hit.bme.hu Számítógép Architektúrák Horváth
Supporting Information
Supporting Information Cell-free GFP simulations Cell-free simulations of degfp production were consistent with experimental measurements (Fig. S1). Dual emmission GFP was produced under a P70a promoter
EN United in diversity EN A8-0206/419. Amendment
22.3.2019 A8-0206/419 419 Article 2 paragraph 4 point a point i (i) the identity of the road transport operator; (i) the identity of the road transport operator by means of its intra-community tax identification
Intelligens Rendszerek I. Problémamegoldás kereséssel: informált kereső eljárások (Optimálási módszerek)
Intelligens Rendszerek I. Problémamegoldás kereséssel: informált kereső eljárások (Optimálási módszerek) 2007/2008. tanév, I. félév Dr. Kovács Szilveszter E-mail: szkovacs@iit.uni-miskolc.hu Miskolci Egyetem
Adatbázisok 1. Rekurzió a Datalogban és SQL-99
Adatbázisok 1 Rekurzió a Datalogban és SQL-99 Expressive Power of Datalog Without recursion, Datalog can express all and only the queries of core relational algebra. The same as SQL select-from-where,
Szundikáló macska Sleeping kitty
Model: Peter Budai 999. Diagrams: Peter Budai 999.. Oda-visszahajtás átlósan. Fold and unfold diagonally. 2. Behajtunk középre. Fold to the center. 3. Oda-visszahajtások derékszögben. Fold and unfold at
Csima Judit április 9.
Osztályozókról még pár dolog Csima Judit BME, VIK, Számítástudományi és Információelméleti Tanszék 2018. április 9. Csima Judit Osztályozókról még pár dolog 1 / 19 SVM (support vector machine) ez is egy
FAMILY STRUCTURES THROUGH THE LIFE CYCLE
FAMILY STRUCTURES THROUGH THE LIFE CYCLE István Harcsa Judit Monostori A magyar társadalom 2012-ben: trendek és perspektívák EU összehasonlításban Budapest, 2012 november 22-23 Introduction Factors which
USER MANUAL Guest user
USER MANUAL Guest user 1 Welcome in Kutatótér (Researchroom) Top menu 1. Click on it and the left side menu will pop up 2. With the slider you can make left side menu visible 3. Font side: enlarging font
Utasítások. Üzembe helyezés
HASZNÁLATI ÚTMUTATÓ Üzembe helyezés Utasítások Windows XP / Vista / Windows 7 / Windows 8 rendszerben történő telepítéshez 1 Töltse le az AORUS makróalkalmazás telepítőjét az AORUS hivatalos webhelyéről.
Néhány folyóiratkereső rendszer felsorolása és példa segítségével vázlatos bemutatása Sasvári Péter
Néhány folyóiratkereső rendszer felsorolása és példa segítségével vázlatos bemutatása Sasvári Péter DOI: http://doi.org/10.13140/rg.2.2.28994.22721 A tudományos közlemények írása minden szakma művelésének
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében. Dicse Jenő üzletfejlesztési igazgató
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében Dicse Jenő üzletfejlesztési igazgató How to apply modern e-learning to improve the training of firefighters Jenő Dicse Director of
Create & validate a signature
IOTA TUTORIAL 7 Create & validate a signature v.0.0 KNBJDBIRYCUGVWMSKPVA9KOOGKKIRCBYHLMUTLGGAV9LIIPZSBGIENVBQ9NBQWXOXQSJRIRBHYJ9LCTJLISGGBRFRTTWD ABBYUVKPYFDJWTFLICYQQWQVDPCAKNVMSQERSYDPSSXPCZLVKWYKYZMREAEYZOSPWEJLHHFPYGSNSUYRZXANDNQTTLLZA
INDEXSTRUKTÚRÁK III.
2MU05_Bitmap.pdf camü_ea INDEXSTRUKTÚRÁK III. Molina-Ullman-Widom: Adatbázisrendszerek megvalósítása Panem, 2001könyv 5.4. Bittérkép indexek fejezete alapján Oracle: Indexek a gyakorlatban Oracle Database
A évi fizikai Nobel-díj
A 2012. évi fizikai Nobel-díj "for ground-breaking experimental methods that enable measuring and manipulation of individual quantum systems" Serge Haroche David Wineland Ecole Normale Superieure, Párizs
discosnp demo - Peterlongo Pierre 1 DISCOSNP++: Live demo
discosnp demo - Peterlongo Pierre 1 DISCOSNP++: Live demo Download and install discosnp demo - Peterlongo Pierre 3 Download web page: github.com/gatb/discosnp Chose latest release (2.2.10 today) discosnp
Correlation & Linear Regression in SPSS
Correlation & Linear Regression in SPSS Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise 1 - Correlation File / Open
Léptetőmotorok. Előnyök: Hátrányok:
Léptetőmotorok A léptetőmotorok lényeges tulajdonsága, hogy egy körülforduláshoz hány lépés szükséges. Ezt megadhatják fokban, ekkor az egy lépésre eső szögelfordulást adják meg. Illetve megadhatják az
Hogyan használja az OROS online pótalkatrész jegyzéket?
Hogyan használja az OROS online pótalkatrész jegyzéket? Program indítása/program starts up Válassza ki a weblap nyelvét/choose the language of the webpage Látogasson el az oros.hu weboldalra, majd klikkeljen
Contact us Toll free (800) fax (800)
Table of Contents Thank you for purchasing our product, your business is greatly appreciated. If you have any questions, comments, or concerns with the product you received please contact the factory.
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Correlation & Linear. Petra Petrovics.
Correlation & Linear Regression in SPSS Petra Petrovics PhD Student Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise
Tutorial 1 The Central Dogma of molecular biology
oday DN RN rotein utorial 1 he entral Dogma of molecular biology Information flow in genetics:» ranscription» ranslation» Making sense of genomic information Information content in DN - Information content
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Factor Analysis
Factor Analysis Factor analysis is a multiple statistical method, which analyzes the correlation relation between data, and it is for data reduction, dimension reduction and to explore the structure. Aim
Supplementary Figure 1
Supplementary Figure 1 Plot of delta-afe of sequence variants detected between resistant and susceptible pool over the genome sequence of the WB42 line of B. vulgaris ssp. maritima. The delta-afe values
KN-CP50. MANUAL (p. 2) Digital compass. ANLEITUNG (s. 4) Digitaler Kompass. GEBRUIKSAANWIJZING (p. 10) Digitaal kompas
KN-CP50 MANUAL (p. ) Digital compass ANLEITUNG (s. 4) Digitaler Kompass MODE D EMPLOI (p. 7) Boussole numérique GEBRUIKSAANWIJZING (p. 0) Digitaal kompas MANUALE (p. ) Bussola digitale MANUAL DE USO (p.
7 th Iron Smelting Symposium 2010, Holland
7 th Iron Smelting Symposium 2010, Holland Október 13-17 között került megrendezésre a Hollandiai Alphen aan den Rijn városában található Archeon Skanzenben a 7. Vasolvasztó Szimpózium. Az öt napos rendezvényen
Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz
Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz Kvantumkapuk, áramkörök 2016. március 3. A kvantummechanika posztulátumai (1-2) 1. Állapotleírás Zárt fizikai rendszer aktuális állapota
A jövedelem alakulásának vizsgálata az észak-alföldi régióban az 1997-99. évi adatok alapján
A jövedelem alakulásának vizsgálata az észak-alföldi régióban az 1997-99. évi adatok alapján Rózsa Attila Debreceni Egyetem Agrártudományi Centrum, Agrárgazdasági és Vidékfejlesztési Intézet, Számviteli
2. Local communities involved in landscape architecture in Óbuda
Év Tájépítésze pályázat - Wallner Krisztina 2. Közösségi tervezés Óbudán Óbuda jelmondata: Közösséget építünk, ennek megfelelően a formálódó helyi közösségeket bevonva fejlesztik a közterületeket. Békásmegyer-Ófaluban
Phenotype. Genotype. It is like any other experiment! What is a bioinformatics experiment? Remember the Goal. Infectious Disease Paradigm
It is like any other experiment! What is a bioinformatics experiment? You need to know your data/input sources You need to understand your methods and their assumptions You need a plan to get from point
Szoftver-technológia II. Tervezési minták. Irodalom. Szoftver-technológia II.
Tervezési minták Irodalom Steven R. Schach: Object Oriented & Classical Software Engineering, McGRAW-HILL, 6th edition, 2005, chapter 8. E. Gamma, R. Helm, R. Johnson, J. Vlissides:Design patterns: Elements
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2008. május 26. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2008. május 26. 8:00 Az írásbeli vizsga időtartama: 180 perc Pótlapok száma Tisztázati Piszkozati OKTATÁSI
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel Timea Farkas Click here if your download doesn"t start
Supplementary Table 1. Cystometric parameters in sham-operated wild type and Trpv4 -/- rats during saline infusion and
WT sham Trpv4 -/- sham Saline 10µM GSK1016709A P value Saline 10µM GSK1016709A P value Number 10 10 8 8 Intercontractile interval (sec) 143 (102 155) 98.4 (71.4 148) 0.01 96 (92 121) 109 (95 123) 0.3 Voided
(Asking for permission) (-hatok/-hetek?; Szabad ni? Lehet ni?) Az engedélykérés kifejezésére a következő segédigéket használhatjuk: vagy vagy vagy
(Asking for permission) (-hatok/-hetek?; Szabad ni? Lehet ni?) SEGÉDIGÉKKEL Az engedélykérés kifejezésére a következő segédigéket használhatjuk: vagy vagy vagy A fenti felsorolásban a magabiztosság/félénkség
Utolsó frissítés / Last update: február Szerkesztő / Editor: Csatlós Árpádné
Utolsó frissítés / Last update: 2016. február Szerkesztő / Editor: Csatlós Árpádné TARTALOM / Contents BEVEZETŐ / Introduction... 2 FELNŐTT TAGBÉLYEGEK / Adult membership stamps... 3 IFJÚSÁGI TAGBÉLYEGEK
A rosszindulatú daganatos halálozás változása 1975 és 2001 között Magyarországon
A rosszindulatú daganatos halálozás változása és között Eredeti közlemény Gaudi István 1,2, Kásler Miklós 2 1 MTA Számítástechnikai és Automatizálási Kutató Intézete, Budapest 2 Országos Onkológiai Intézet,
Lopocsi Istvánné MINTA DOLGOZATOK FELTÉTELES MONDATOK. (1 st, 2 nd, 3 rd CONDITIONAL) + ANSWER KEY PRESENT PERFECT + ANSWER KEY
Lopocsi Istvánné MINTA DOLGOZATOK FELTÉTELES MONDATOK (1 st, 2 nd, 3 rd CONDITIONAL) + ANSWER KEY PRESENT PERFECT + ANSWER KEY FELTÉTELES MONDATOK 1 st, 2 nd, 3 rd CONDITIONAL I. A) Egészítsd ki a mondatokat!
Smaller Pleasures. Apróbb örömök. Keleti lakk tárgyak Répás János Sándor mûhelyébõl Lacquerware from the workshop of Répás János Sándor
Smaller Pleasures Apróbb örömök Keleti lakk tárgyak Répás János Sándor mûhelyébõl Lacquerware from the workshop of Répás János Sándor Smaller Pleasures Oriental lacquer, or urushi by its frequently used
Választási modellek 3
Választási modellek 3 Prileszky István Doktori Iskola 2018 http://www.sze.hu/~prile Forrás: A Self Instructing Course in Mode Choice Modeling: Multinomial and Nested Logit Models Prepared For U.S. Department
Ensemble Kalman Filters Part 1: The basics
Ensemble Kalman Filters Part 1: The basics Peter Jan van Leeuwen Data Assimilation Research Centre DARC University of Reading p.j.vanleeuwen@reading.ac.uk Model: 10 9 unknowns P[u(x1),u(x2),T(x3),.. Observations:
Lexington Public Schools 146 Maple Street Lexington, Massachusetts 02420
146 Maple Street Lexington, Massachusetts 02420 Surplus Printing Equipment For Sale Key Dates/Times: Item Date Time Location Release of Bid 10/23/2014 11:00 a.m. http://lps.lexingtonma.org (under Quick
EN United in diversity EN A8-0206/473. Amendment
21.3.2019 A8-0206/473 473 Recital 12 d (new) (12d) Since there is no sufficient link of a driver with a territory of a Member State of transit, transit operations should not be considered as posting situations.
General information for the participants of the GTG Budapest, 2017 meeting
General information for the participants of the GTG Budapest, 2017 meeting Currency is Hungarian Forint (HUF). 1 EUR 310 HUF, 1000 HUF 3.20 EUR. Climate is continental, which means cold and dry in February
Abigail Norfleet James, Ph.D.
Abigail Norfleet James, Ph.D. Left side of brain develops first in girls, right in boys o Probably source of girls verbal skills o And source of boys spatial skills Pre-frontal lobes Control impulses and
Basic Arrays. Contents. Chris Wild & Steven Zeil. May 28, Description 3
Chris Wild & Steven Zeil May 28, 2013 Contents 1 Description 3 1 2 Example 4 3 Tips 6 4 String Literals 7 4.1 Description...................................... 7 4.2 Example........................................
Utolsó frissítés / Last update: Szeptember / September Szerkesztő / Editor: Csatlós Árpádné
Utolsó frissítés / Last update: 2018. Szeptember / September Szerkesztő / Editor: Csatlós Árpádné TARTALOM / Contents BEVEZETŐ / Introduction... 2 FELNŐTT TAGBÉLYEGEK / Adult membership stamps... 3 IFJÚSÁGI
AZ ACM NEMZETKÖZI PROGRAMOZÓI VERSENYE
AZ ACM NEMZETKÖZI PROGRAMOZÓI VERSENYE Kuki Attila, kuki@math.klte.hu Kossuth Lajos Tudományegyetem, Információ Technológia Tanszék Abstract This paper is dedicated to the Scholastic Programming Contest
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY A feladatsor három részből áll 1. A vizsgáztató társalgást kezdeményez a vizsgázóval. 2. A vizsgázó egy szituációs feladatban vesz részt a
Cloud computing. Cloud computing. Dr. Bakonyi Péter.
Cloud computing Cloud computing Dr. Bakonyi Péter. 1/24/2011 1/24/2011 Cloud computing 2 Cloud definició A cloud vagy felhő egy platform vagy infrastruktúra Az alkalmazások és szolgáltatások végrehajtására
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Nonparametric Tests
Nonparametric Tests Petra Petrovics Hypothesis Testing Parametric Tests Mean of a population Population proportion Population Standard Deviation Nonparametric Tests Test for Independence Analysis of Variance
A Lean Beszállító fejlesztés tapasztalatai a Knorr Bremse-nél
A Lean Beszállító fejlesztés tapasztalatai a Knorr Bremse-nél Magyar Minőséghét Konferencia 206 Május 3. Lantos Gábor Lean Beszállító fejlesztés tapasztalatai a Knorr Bremse-nél Continuous mprovement Program
Can/be able to. Using Can in Present, Past, and Future. A Can jelen, múlt és jövő idejű használata
Can/ Can is one of the most commonly used modal verbs in English. It be used to express ability or opportunity, to request or offer permission, and to show possibility or impossibility. A az egyik leggyakrabban
University of Bristol - Explore Bristol Research
Al-Salihi, S. A. A., Scott, T. A., Bailey, A. M., & Foster, G. D. (2017). Improved vectors for Agrobacterium mediated genetic manipulation of Hypholoma spp. and other homobasidiomycetes. Journal of Microbiological
Dynamic freefly DIVE POOL LINES
Dynamic freefly 3.rész Part 3 DIVE POOL LINES A dynamic repülés három fajta mozgásból áll: Dynamic freeflying is composed of three types of movements: -Lines (vízszintes "szlalom") (horizontal "slalom")
Új funkciók az RBP-ben 2015. október 1-től New functions in RBP from 1 October 2015. Tatár Balázs
Új funkciók az RBP-ben 2015. október 1-től New functions in RBP from 1 October 2015 Tatár Balázs Üzletfejlesztés vezető / Business Development Manager Rendszerhasználói Tájékoztató Nap, 2015. szeptember
ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP
ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP CHILD S DATA / GYERMEK ADATAI PLEASE FILL IN THIS INFORMATION WITH DATA BASED ON OFFICIAL DOCUMENTS / KÉRJÜK, TÖLTSE KI A HIVATALOS DOKUMENTUMOKBAN SZEREPLŐ ADATOK
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 200. május 4. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 200. május 4. 8:00 Az írásbeli vizsga időtartama: 80 perc Pótlapok száma Tisztázati Piszkozati OKTATÁSI
BKI13ATEX0030/1 EK-Típus Vizsgálati Tanúsítvány/ EC-Type Examination Certificate 1. kiegészítés / Amendment 1 MSZ EN 60079-31:2014
(1) EK-TípusVizsgálati Tanúsítvány (2) A potenciálisan robbanásveszélyes környezetben történő alkalmazásra szánt berendezések, védelmi rendszerek 94/9/EK Direktíva / Equipment or Protective Systems Intended
EN United in diversity EN A8-0206/445. Amendment
21.3.2019 A8-0206/445 445 Title Proposal for a DIRECTIVE OF THE EUROPEAN PARLIAMENT AND OF THE COUNCIL amending Directive 2006/22/EC as regards enforcement requirements and laying down specific rules with
FOSS4G-CEE Prágra, 2012 május. Márta Gergely Sándor Csaba
FOSS4G-CEE Prágra, 2012 május Márta Gergely Sándor Csaba Reklám helye 2009 óta Intergraph szoftverek felől jöttünk FOSS4G felé megyünk Békés egymás mellett élés több helyen: Geoshop.hu Terkep.torokbalint.hu
3. MINTAFELADATSOR KÖZÉPSZINT. Az írásbeli vizsga időtartama: 30 perc. III. Hallott szöveg értése
Oktatáskutató és Fejlesztő Intézet TÁMOP-3.1.1-11/1-2012-0001 XXI. századi közoktatás (fejlesztés, koordináció) II. szakasz ANGOL NYELV 3. MINTAFELADATSOR KÖZÉPSZINT Az írásbeli vizsga időtartama: 30 perc
Számítógéppel irányított rendszerek elmélete. Gyakorlat - Mintavételezés, DT-LTI rendszermodellek
Számítógéppel irányított rendszerek elmélete Gyakorlat - Mintavételezés, DT-LTI rendszermodellek Hangos Katalin Villamosmérnöki és Információs Rendszerek Tanszék e-mail: hangos.katalin@virt.uni-pannon.hu
Nemzetközi Kenguru Matematikatábor
Nemzetközi Kenguru Matematikatábor 2011. augusztus 19-27., Werbellinsee, Németország BESZÁMOLÓ Bevezető Idén hetedik alkalommal került megrendezére a Nemzetközi Kenguru Matematikatábor (7. Internationale
(NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV
Kommunikációs rendszerek programozása (NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV (5. mérés) SIP telefonközpont készítése Trixbox-szal 1 Mérés helye: Széchenyi István Egyetem, L-1/7 laboratórium, 9026 Győr, Egyetem
Véges szavak általánosított részszó-bonyolultsága
Véges szavak általánosított részszó-bonyolultsága KÁSA Zoltán Sapientia Erdélyi Magyar Tudományegyetem Kolozsvár Marosvásárhely Csíkszereda Matematika-Informatika Tanszék, Marosvásárhely Budapest, 2010.
FÖLDRAJZ ANGOL NYELVEN
Földrajz angol nyelven középszint 0821 ÉRETTSÉGI VIZSGA 2009. május 14. FÖLDRAJZ ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI ÉRETTSÉGI VIZSGA JAVÍTÁSI-ÉRTÉKELÉSI ÚTMUTATÓ OKTATÁSI ÉS KULTURÁLIS MINISZTÉRIUM Paper
Word and Polygon List for Obtuse Triangular Billiards II
Word and Polygon List for Obtuse Triangular Billiards II Richard Evan Schwartz August 19, 2008 Abstract This is the list of words and polygons we use for our paper. 1 Notation To compress our notation
Rezgésdiagnosztika. Diagnosztika 02 --- 1
Rezgésdiagnosztika Diagnosztika 02 --- 1 Diagnosztika 02 --- 2 A rezgéskép elemzésével kimutatható gépészeti problémák Minden gép, mely tartalmaz forgó részt (pl. motor, generátor, szivattyú, ventilátor,
2 level 3 innovation tiles. 3 level 2 innovation tiles. 3 level 1 innovation tiles. 2 tribe pawns of each color. 3 height 3 tribe pawns.
2 darab 3-as szintű találmány jelző Origin kártyaszövegek fordítása Vágd ki a az egyes kártyákhoz tartozó lapokat a vonalak és a színes terület mentén, majd csúsztasd be a kártyavédő fóliába úgy, hogy
Kvantum-informatika és kommunikáció 2015/2016 ősz. A kvantuminformatika jelölésrendszere szeptember 11.
Kvantum-informatika és kommunikáció 2015/2016 ősz A kvantuminformatika jelölésrendszere 2015. szeptember 11. Mi lehet kvantumbit? Kvantum eszközök (1) 15=5 3 Bacsárdi Képek forrása: IBM's László, Almaden
Cloud computing Dr. Bakonyi Péter.
Cloud computing Dr. Bakonyi Péter. 1/24/2011 Cloud computing 1/24/2011 Cloud computing 2 Cloud definició A cloud vagy felhő egy platform vagy infrastruktúra Az alkalmazások és szolgáltatások végrehajtására
A vitorlázás versenyszabályai a 2013-2016. évekre angol-magyar nyelvű kiadásának változási és hibajegyzéke
A vitorlázás versenyszabályai a 2013-2016. évekre angol-magyar nyelvű kiadásának változási és hibajegyzéke A dokumentum A vitorlázás versenyszabályai a 2013-2016. évekre angol-magyar nyelvű kiadásában
Statistical Dependence
Statistical Dependence Petra Petrovics Statistical Dependence Deinition: Statistical dependence exists when the value o some variable is dependent upon or aected by the value o some other variable. Independent
Tavaszi Sporttábor / Spring Sports Camp. 2016. május 27 29. (péntek vasárnap) 27 29 May 2016 (Friday Sunday)
Tavaszi Sporttábor / Spring Sports Camp 2016. május 27 29. (péntek vasárnap) 27 29 May 2016 (Friday Sunday) SZÁLLÁS / ACCOMODDATION on a Hotel Gellért*** szálloda 2 ágyas szobáiban, vagy 2x2 ágyas hostel
Klaszterezés, 2. rész
Klaszterezés, 2. rész Csima Judit BME, VIK, Számítástudományi és Információelméleti Tanszék 208. április 6. Csima Judit Klaszterezés, 2. rész / 29 Hierarchikus klaszterezés egymásba ágyazott klasztereket
(c) 2004 F. Estrada & A. Jepson & D. Fleet Canny Edges Tutorial: Oct. 4, '03 Canny Edges Tutorial References: ffl imagetutorial.m ffl cannytutorial.m
Canny Edges Tutorial: Oct. 4, '03 Canny Edges Tutorial References: ffl imagetutorial.m ffl cannytutorial.m ffl ~jepson/pub/matlab/isetoolbox/tutorials ffl ~jepson/pub/matlab/utvistoolbox/tutorials ffl
EEA, Eionet and Country visits. Bernt Röndell - SES
EEA, Eionet and Country visits Bernt Röndell - SES Európai Környezetvédelmi Ügynökség Küldetésünk Annak elősegítése, hogy az EU és a tagállamok a szükséges információk alapján hozhassák meg a környezet
Vállalati kockázatkezelés jelentősége
www.pwc.com/hu Vállalati kockázatkezelés jelentősége Fedor Péter 2013. szeptember 19. Miről lesz szó 1. Mi is az az ERM? 2. Miért fontos? 3. Gyakorlati sajátosságok PwC Magyarország Mi is az az ERM? PwC
Eladni könnyedén? Oracle Sales Cloud. Horváth Tünde Principal Sales Consultant 2014. március 23.
Eladni könnyedén? Oracle Sales Cloud Horváth Tünde Principal Sales Consultant 2014. március 23. Oracle Confidential Internal/Restricted/Highly Restricted Safe Harbor Statement The following is intended
1. Gyakorlat: Telepítés: Windows Server 2008 R2 Enterprise, Core, Windows 7
1. Gyakorlat: Telepítés: Windows Server 2008 R2 Enterprise, Core, Windows 7 1.1. Új virtuális gép és Windows Server 2008 R2 Enterprise alap lemez létrehozása 1.2. A differenciális lemezek és a két új virtuális
fátyolka tojásgy jtœ lap [CHRegg] összeszereléséhez
Útmutató fátyolka tojásgy jtœ lap [CHRegg] összeszereléséhez (Assembling instructions to [CHRegg] lacewing egg concentrator) Tartozékok: 1 = csalétket tartalmazó alufólia tasak 2 = tojásgy jtœ lap tépœzár