Security in WiFi networks
|
|
- Rebeka Farkasné
- 7 évvel ezelőtt
- Látták:
Átírás
1 Cryptographic Protocols (EIT ICT MSc) Dr. Levente Buttyán associate professor BME Hálózati Rendszerek és Szolgáltatások Tanszék Lab of Cryptography and System Security (CrySyS)
2 2 Outline - reminder on the operation of WiFi networks - MAC address filtering and SSID based access control - WEP operation and attacks i (WPA/TKIP, WPA2/AES-CCMP)
3 3 Brief reminder on WiFi networks connected scanning on each channel STA association request association response AP beacon - MAC header - timestamp - beacon interval - capability info - SSID (network name) - supported data rates - radio parameters - flags
4 4 SSID-based access control SSID = Service Set IDentifier (network name) a 32-character unique identifier (differentiates one WLAN from another) found in the header of packets and acts as a password when a mobile device tries to connect to the WLAN unfortunately, the SSID can be sniffed, and hence, this mechanism does not provide really secure access control
5 5 MAC filtering based access control MAC address filtering only devices with certain MAC addresses are allowed to associate needs pre-registration of all allowed devices at the AP unfortunately, MAC addresses can be sniffed and forged sniffing MAC address is sent in clear in each packet put your WLAN adapter card in promiscuous mode (accepts all packets) eavesdrop the traffic and find out which MAC addresses are accepted forging MAC address of certain WLAN adapter cards can be set by the user example:
6 Eavesdropping with Wireshark Buttyán Levente, BME HIT 6
7 7 Security problems in wireless no inherent physical protection physical connections between devices are replaced by logical associations sending and receiving messages do not need physical access to the network infrastructure (cables, hubs, routers, etc.) broadcast communications wireless usually means radio, which has a broadcast nature transmissions can be overheard by anyone in range anyone can generate transmissions, which will be received by other devices in range which will interfere with other nearby transmissions and may prevent their correct reception (jamming) eavesdropping is easy injecting bogus messages into the network is easy replaying previously recorded messages is easy illegitimate access to the network and its services is easy denial of service is easily achieved by jamming
8 8 Wireless com sec requirements confidentiality messages sent over wireless links must be encrypted authenticity origin of messages received over wireless links must be verified replay detection freshness of messages received over wireless links must be checked integrity modifying messages on-the-fly (during radio transmission) is not so easy, but possible integrity of messages received over wireless links must be verified access control access to the network services should be provided only to legitimate entities access control should be permanent it is not enough to check the legitimacy of an entity only when it joins the network and its logical associations are established, because logical associations can be hijacked protection against jamming
9 9 WEP Wired Equivalent Privacy part of the original IEEE specification goal make the WiFi network at least as secure as a wired LAN (that has no particular protection mechanisms) WEP has never intended to achieve strong security at the end, it has achieved no security at all services access control to the network message confidentiality message authenticity/integrity
10 10 WEP Access control before association, the STA needs to authenticate itself to the AP authentication is based on a simple challenge-response protocol: STA AP: authenticate request AP STA: authenticate challenge (r) // r is 128 bits long STA AP: authenticate response (e K (r)) AP STA: authenticate success/failure once authenticated, the STA can send an association request, and the AP will respond with an association response if authentication fails, no association is possible
11 11 WEP Message conf and integrity WEP encryption is based on the RC4 stream cipher it is essential that each message is encrypted with a different key stream the RC4 cipher is initialized with a shared secret key and an IV (initial value) shared secret key (40 or 104 bits) remains unchanged 24-bit IV is changed for every message sent RC4 produces a pseudo-random byte sequence (key stream), which is XORed to the message reception is analogous WEP integrity protection is based on an encrypted CRC value ICV (integrity check value) is computed and appended to the message the message and the ICV are encrypted together as described above
12 12 WEP Message conf and integrity message + ICV IV secret key RC4 encode IV message + ICV decode IV secret key RC4 message + ICV
13 13 WEP Keys two kinds of keys are allowed by the standard default key (also called shared key, group key, multicast key, broadcast key, key) key mapping keys (also called individual key, per-station key, unique key) id:x key:abc default key id:x key:def key mapping key id:y key:abc id:y key:ghi id:z key:abc key:abc id:z key:jkl id:x key:def id:y key:ghi id:z key:jkl in practice, often only default keys are supported the default key is manually installed in every STA and the AP each STA uses the same shared secret key in principle, STAs can decrypt each other s messages
14 WEP Management of default keys the default key is a group key, and group keys need to be changed when a member leaves the group e.g., when someone leaves the company and shouldn t have access to the network anymore it is practically impossible to change the default key in every device simultaneously hence, WEP supports multiple default keys to help the smooth change of keys one of the keys is called the active key the active key is used to encrypt messages any key can be used to decrypt messages the message header contains a key ID that allows the receiver to find out which key should be used to decrypt the message Buttyán Levente, BME HIT 14
15 time Buttyán Levente, BME HIT 15 WEP The key change process abc* --- abc* --- * active key abc* --- abc* def abc def* --- def* abc def* --- def* --- def*
16 16 WEP flaws Auth and access control authentication is one-way only AP is not authenticated to STA STA may associate to a rogue AP which can perform a Man-in-the-Middle attack the same shared secret key is used for authentication and encryption weaknesses in any of the two protocol can be used to break the key different keys for different functions are desirable no session key is established during authentication access control is not continuous once a STA has authenticated and associated to the AP, an attacker can send messages using the MAC address of STA correctly encrypted messages cannot be produced by the attacker, but replay of STA messages is still possible STA can be impersonated next slide
17 WEP flaws Auth and access control recall that authentication is based on a challenge-response protocol: AP STA: r STA AP: IV r K where K is a 128 bit RC4 output on IV and the shared secret an attacker can compute r (r K) = K she can use K (and the same IV) to impersonate STA later: AP attacker: r attacker AP: IV r K Buttyán Levente, BME HIT 17
18 18 WEP flaws Integrity and replay there s no replay protection at all IV is not mandated to be incremented after each message receiver is not mandated to check the freshness of received IVs attacker can manipulate messages despite the ICV mechanism and encryption CRC is a linear function wrt to XOR: CRC(X Y) = CRC(X) CRC(Y) - attacker observes (M CRC(M)) K where K is the RC4 output - for any DM, the attacker can compute CRC(DM) - hence, the attacker can compute: ((M CRC(M)) K) (DM CRC(DM)) = ((M DM) (CRC(M) CRC(DM))) K = ((M DM) CRC(M DM)) K
19 19 WEP flaws Confidentiality IV reuse IV space is too small IV size is only 24 bits there are 16,777,216 possible IVs after around 17 million messages, IVs are reused a busy AP at 11 Mbps is capable for transmitting 700 packets per second IV space is used up in around 7 hours in many implementations IVs are initialized with 0 on startup and then incremented by one after each message if several devices are switched on nearly at the same time, they all use the same sequence of IVs if they all use the same default key (which is the common case), then IV collisions are readily available to an attacker exploiting weaknesses in the RC4 cipher see next slides
20 20 Operation of RC4 initialization: for i = 0 to 255 do S[i] = i end j = 0 for i = 0 to 255 do j = j+s[i]+k[i mod len(k)] mod 256 swap(s, i, j) end i = 0 j = 0 generation: i = i+1 mod 256 j = j+s[i] mod 256 swap(s, i, j) return S[ S[i]+S[j] mod 256 ]
21 FMS (Fluhrer-Mantin-Shamir) attack notation: (S k, i k, j k ) is the state after the k-th step of the initialization algorithm (S 256, i 256 =0, j 256 =0) is the state before the generation starts in WEP, the attacker knows the first 3 bytes of K (K[0..2] = IV) the attacker can simulate the execution of the RC4 initialization for the first three steps, and hence, knows S 3 and j 3 in the next step (i 4 = 3): j 4 = j 3 + S 3 [3] + K[3] S 4 [3] = S 3 [j 4 ] = S 3 [ j 3 + S 3 [3] + K[3] ] since S is a permutation, S[a] = b implies S -1 [b] = a thus, we have: K[3] = S 3-1 [ S 4 [3] ] j 3 S 3 [3] if we knew S 4 [3], we would be able to compute K[3] (first byte of the key) Buttyán Levente, BME HIT 21
22 FMS attack let s assume that S 256 [1] = S 3 [1], S 256 [S 256 [1]] = S 3 [S 3 [1]], and S 256 [3] = S 4 [3] (i.e., S[1], S[S[1]], and S[3] do not participate in any more swaps in the rest of the initialization procedure) S 3 [1] < 3, S 3 [1] + S 3 [S 3 [1]] = 3 (note that these can be tested, because S 3 is known to the attacker) let s compute the first key stream byte: i = 1, j = S 256 [1] swap S 256 [1] and S 256 [S 256 [1]] their sum is still S 256 [1] + S 256 [S 256 [1]] = S 3 [1] + S 3 [S 3 [1]] = 3 output X = S 256 [3] = S 4 [3] hence the first key stream byte will give us S 4 [3], which reveals K[3] Buttyán Levente, BME HIT 22
23 FMS attack what is the probability that S[1], S[S[1]], and S[3] do not participate in any swaps in the remaining 253 steps of the initialization? note that S 3 [1] < 3 (by assumption), and i > 3 (we passed the first 3 steps) S[1], S[S[1]], and S[3] may be swapped only if j takes the value 1, S[1], or 3, respectively (i will not take these values anymore) if we assume that j changes randomly, then it takes any value with probability 1/256 hence, we get (253/256) 253 ~ if the conditions S 3 [1] < 3 and S 3 [1] + S 3 [S 3 [1]] = 3 are satisfied, then we compute the correct value of K[3] with probability otherwise the value that we compute for K[3] can be any value with probability 1/255 ~ if we repeat this experiment, then the most frequent value that we compute for K[3] is the correct value! Buttyán Levente, BME HIT 23
24 24 Example: RC4 initialization swap for i = 0 to 7 do j = j + S[i] + K[i] mod 8 swap (S, i, j) end j = 0 S 0 = i = 0 j 1 = K =
25 25 Example: RC4 initialization S 1 = K = swap for i = 0 to 7 do j = j + S[i] + K[i] mod 8 swap (S, i, j) end j = 0 i = 0 j 1 = 3 i = 1 j 2 = 3
26 26 Example: RC4 initialization S 2 = K = swap for i = 0 to 7 do j = j + S[i] + K[i] mod 8 swap (S, i, j) end j = 0 i = 0 j 1 = 3 i = 1 j 2 = 3 i = 2 j 3 = 6
27 27 Example: RC4 initialization S 3 = K = swap for i = 0 to 7 do j = j + S[i] + K[i] mod 8 swap (S, i, j) end j = 0 i = 0 j 1 = 3 i = 1 j 2 = 3 i = 2 j 3 = 6 i = 3 j 4 = 4
28 28 Example: RC4 initialization S 4 = K = swap for i = 0 to 7 do j = j + S[i] + K[i] mod 8 swap (S, i, j) end j = 0 i = 0 j 1 = 3 i = 1 j 2 = 3 i = 2 j 3 = 6 i = 3 j 4 = 4 i = 4 j 5 = 4
29 29 Example: RC4 initialization S 5 = K = swap for i = 0 to 7 do j = j + S[i] + K[i] mod 8 swap (S, i, j) end j = 0 i = 0 j 1 = 3 i = 1 j 2 = 3 i = 2 j 3 = 6 i = 3 j 4 = 4 i = 4 j 5 = 4 i = 5 j 6 = 2
30 30 Example: RC4 initialization S 6 = K = swap for i = 0 to 7 do j = j + S[i] + K[i] mod 8 swap (S, i, j) end j = 0 i = 0 j 1 = 3 i = 1 j 2 = 3 i = 2 j 3 = 6 i = 3 j 4 = 4 i = 4 j 5 = 4 i = 5 j 6 = 2 i = 6 j 7 = 4
31 31 Example: RC4 initialization swap for i = 0 to 7 do j = j + S[i] + K[i] mod 8 swap (S, i, j) end S 7 = K = j = 0 i = 0 j 1 = 3 i = 1 j 2 = 3 i = 2 j 3 = 6 i = 3 j 4 = 4 i = 4 j 5 = 4 i = 5 j 6 = 2 i = 6 j 7 = 4 i = 7 j = 6
32 32 Example: RC4 generation swap i = i+1 mod 8 j = j + S[i] mod 8 swap (S, i, j) return S[ S[i]+S[j] mod 8 ] i = 0 j = 0 S 8 = i = 1 j = 0 + K = output X = 4 K[3] = S 3-1 [X] j 3 S 3 [3] = = 5
33 FMS attack the full monty assume that we know K[0..c] observe the traffic and pick messages for which the FMS conditions (S c [1] < c, S c [1] + S c [S c [1]] = c) hold for each message, guess the first byte of the message (and hence the first byte X of the key stream used for encrypting the message) compute a candidate value for K[c] as S c -1 [X] j c S c [c] select the most frequent candidate K[c] increment c and repeat when you have a full K, try it by decrypting the eavesdropped messages if it does not work, then go back and select the second most frequent candidate for K[c] in the last step Buttyán Levente, BME HIT 33
34 34 FMS attack success rate source: Erik Tews, Attacks on the WEP protocol, Diploma Thesis, TU Darmstadt, 2007
35 35 Chopchop attack (KoreK) allows an attacker to interactively decrypt the last m bytes of plaintext of a WEP encrypted packet by sending 128m crafted packets on average to the network, and observing if they are accepted or not (ICV is correct or not) does not reveal the root key! not based on any special properties of the RC4 stream cipher (protocol flaw!)
36 36 Chopchop attack background CRC verification mechanism: (message, ICV) is represented as a binary polynomial P if P mod R CRC = P ONE, then the message is accepted, where R CRC is the given CRC polynomial P ONE is polynomial with all coefficients equal to one we can write P as Qx 8 + L, where Q represents the one byte shortened packet L represents the last byte if P verifies correctly then how do we need to modify Q such that it verifies correctly too? P mod R CRC = P ONE Qx 8 mod R CRC = P ONE + L mod R CRC Q mod R CRC = (P ONE + L)(x 8 ) -1 mod R CRC DQ P ONE + (P ONE + L)(x 8 ) -1
37 37 Chopchop attack background Q+DQ verifies correctly and DQ depends only on L Q+DQ mod R CRC = Q + P ONE + (P ONE + L)(x 8 ) -1 mod R CRC = P ONE because Q + (P ONE + L)(x 8 ) -1 mod R CRC = 0 due to RC4 stream ciphering, anything can be added to an encrypted packet without knowing the encryption key
38 38 Chopchop attack the full monty eavesdrop a WEP encrypted packet P + K we know that P verifies correctly, but we don t know P guess the last byte L of P there are only 256 possibilities! chop the last byte of the encrypted packet and XOR in DQ to get (Q + K ) + DQ = (Q + DQ) + K send (Q + DQ) + K to the AP and observe if it is accepted send the packet from a station not yet associated to the AP if the packet is correct, the AP will send a message telling the station that it needs to rejoin the network, otherwise the packet is discarded if unsuccessful, try another candidate for L on average, after 128 trials you have the correct value for L repeat the procedure by chopping Q + DQ
39 39 Tools there are many available on the web look at for a comprehensive cracking toolbox
40 40 WEP Lessons learnt 1. engineering security protocols is a very risky business you may combine otherwise strong building blocks in a wrong way and obtain an insecure system at the end example: stream ciphers alone are OK challenge-response protocols for entity authentication are OK but they shouldn t be combined in a way done in WEP example: encrypting a message digest to obtain an ICV is acceptable but it doesn t work if the message digest function is linear wrt to the encryption function using an expert in the design phase pays out (fixing the system after deployment will be much more expensive) experts will not guarantee that your system is 100% secure but at least they know many pitfalls that you don t they know the details of crypto algorithms better than you do 2. avoid the use of WEP (as much as possible)
41 41 Overview of i after the collapse of WEP, IEEE started to develop a new security architecture i (now integrated in ) main novelties in i wrt to WEP access control model is based on 802.1X flexible authentication framework (based on EAP) authentication can be based on strong protocols (e.g., TLS) authentication process results in a shared session key (which prevents session hijacking) different functions (encryption, integrity) use different keys derived from the session key using a one-way function integrity protection is improved replay protection is added encryption function is improved
42 i, WPA, and WPA2 WPA (WiFi protected access) industrial name for i TKIP (Temporal Key Integrity Protocol) integrity protection is based on Michael encryption is based on RC4, but WEP s problems have been avoided ugly solution, but runs on old hardware (after software upgrade) WPA2 industrial name for i AES-CCMP (Counter mode and CBC-MAC Protocol) integrity protection and encryption is based on AES (in CCMP mode) nice solution, but needs new hardware
43 X authentication model supplicant sys authenticator system auth server sys supplicant services authenticator authentication server port controls LAN the supplicant requests access to the services (wants to connect to the network) the authenticator controls access to the services (controls the state of a port) the authentication server authorizes access to the services the supplicant authenticates itself to the authentication server if the authentication is successful, the authentication server instructs the authenticator to switch the port on the authentication server informs the supplicant that access is allowed
44 Mapping the 802.1X model to WiFi supplicant mobile device (STA) authenticator access point (AP) authentication server server application running on the AP or on a dedicated machine port logical state implemented in software in the AP one more thing is added to the basic 802.1X model in i: successful authentication results not only in switching the port on, but also in a session key between the mobile device and the authentication server the session key is sent to the AP in a secure way this assumes a shared key between the AP and the auth server this key is usually set up manually Buttyán Levente, BME HIT 44
45 45 Protocols: EAP, EAPOL, RADIUS EAP (Extensible Authentication Protocol) [RFC 3748] carrier protocol designed to transport the messages of real authentication protocols (e.g., TLS) very simple, four types of messages: EAP request carries messages from the authentication server to the supplicant EAP response carries messages from the supplicant to the authentication server EAP success signals successful authentication EAP failure signals authentication failure authenticator doesn t understand what is inside the EAP messages, it recognizes only EAP success and failure EAPOL (EAP over LAN) [802.1X] used to encapsulate EAP messages into LAN protocols (e.g., Ethernet) EAPOL is used to carry EAP messages between the STA and the AP RADIUS (Remote Access Dial-In User Service) [RFC , RFC 2548] used to carry EAP messages between the AP and the auth server MS-MPPE-Recv-Key attribute is used to transport the session key from the auth server to the AP RADIUS is mandated by WPA and optional for WPA2
46 embedded auth. protocol Buttyán Levente, BME HIT 46 EAP in action STA encapsulated in EAPOL EAP Request (Identity) EAP Response (Identity) AP encapsulated in RADIUS EAP Response (Identity) auth server EAP Request 1 EAP Request 1 EAP Response 1 EAP Response EAP Request n EAP Response n EAP Request n EAP Response n EAP Success EAP Success
47 Protocols: EAP-TLS, EAP-TTLS, EAP-TLS (TLS over EAP) [RFC 5216] only the TLS Handshake Protocol is used server and client authentication, generation of master secret TLS master secret becomes the session key mandated by WPA, optional in WPA2 EAP-TTLS (Tunneled TLS over EAP) [RFC 5281] phase 1: TLS Handshake possibly without client authentication phase 2: legacy client authentication (e.g., password based) protected by the secure tunnel established in phase 1 eavesdropping and man-in-the-middle attacks are prevented privacy is improved (user name is also encrypted) EAP-PSK, EAP-FAST, EAP-PEAP, EAP-SIM, EAP-AKA, Buttyán Levente, BME HIT 47
48 48 Protocol architecture TLS (RFC 5246) EAP-TLS (RFC 5216) EAP (RFC 5247) EAPOL (802.1X) EAP over RADIUS (RFC 3579) RADIUS (RFC 2865) UDP/IP or else mobile device AP auth server
49 49 Key hierarchy overview 802.1X authentication random generation in AP PMK (pairwise master key) key derivation in STA and AP PTK (pairwise transient keys) - key encryption key - key integrity key - data encryption key - data integrity key protection protection GMK (group master key) key derivation in AP GTK (group transient keys) - group encryption key - group integrity key transport to every STA protection unicast message trans. between STA and AP broadcast messages trans. from AP to STAs
50 50 Four way handshake (simplified) objective: prove that AP also knows the PMK (result of the authentication between STA and Auth Server) exchange random values to be used in the generation of PTK distribution of GTK STA AP ANonce, SeqNum generate ANonce generate SNonce, and compute PTK SNonce, SeqNum, MIC KIK ( ) SeqNum+1, E KEK (GTK), MIC KIK ( ) compute PTK and GTK SeqNum+1, MIC KIK ( ) MIC() and E(): HMAC-MD5 and RC4 or HMAC-SHA and AES
51 51 PTK and GTK computation for TKIP PRF-512( PMK, Pairwise key expansion, MAC1 MAC2 Nonce1 Nonce2 ) = = KEK KIK DEK DIK PRF-256( GMK, Group key expansion, MAC GNonce ) = = GEK GIK see TLS slides for the definition of PRF
52 52 PTK and GTK comp for AES-CCMP PRF-384( PMK, Pairwise key expansion, MAC1 MAC2 Nonce1 Nonce2 ) = = KEK KIK DE&IK PRF-128( GMK, Group key expansion, MAC GNonce ) = = GE&IK
53 53 TKIP runs on old hardware (supporting RC4), but WEP weaknesses are corrected new message integrity protection mechanism called Michael old CRC based ICV is still there IV is used as replay counter too IV length is increased to 48 bits in order to prevent IV reuse per-packet keys are used to prevent attacks similar to that of the FMS attack
54 54 TKIP Michael severe design constraints microprocessor inside most Wi-Fi cards is not powerful enough for strong cryptographic operations moving the MIC computation from the hardware into software (device driver) is an option, but APs do not have powerful CPUs MIC function should still be simple design decisions Michael operates at SDU level (before message is fragmented into PDUs) can be implemented in the device driver (software update) reduced overhead (no MIC computation for each and every PDU) Michael uses simple operations (substitution, rotation, XOR) fits in existing APs Michael is not very strong (equivalent to 20-bit security), hence, vulnerable to brute force attacks if a MIC failure is detected, then a MIC failure report frame is sent if two MIC failures are detected within less than 60 seconds, the communication is shut down, and keys are renegotiated after a 60 second penalty period
55 dummy byte Buttyán Levente, BME HIT 55 TKIP RC4 seed generation 48 bits IV upper 32 bits lower 16 bits data encryption key from PTK 128 bits how to fit bits into a 128 bit RC4 seed supported by the hardware? a crypto hash function would be two expensive special mix function (based on simple operations) key mix (phase 1) source MAC address two phases for efficiency reasons result of the first phase can be used for 2 16 packets key mix (phase 2) MAC address same IV may be used by another device with no problem IV d IV per-packet key RC4 seed dummy byte repeat of the first byte, except that bit 5 is forced to 1 and bit 4 is forced to 0 prevents the generation of the major class of weak RC4 keys 3x8 = 24 bits 104 bit
56 56 Attacks on TKIP in a recent paper (ACM WiSec, Zurich, March ), Beck and Tews published a chopcop attack against WPA background Michael is not a one-way function: given a (message, MIC) pair, it is not difficult to recover the MIC key encryption of the MIC in WPA is essential old CRC-based ICV mechanism is still used last 12 bytes of a plaintext packet is the 8-byte MIC and the 4- byte CRC if ICV is not correct, the packet is discarded silently if ICV is correct, but MIC verification fails, a MIC failure report is sent IV value is not incremented in any of these cases stations can be used as CRC oracles! attacker can break the MIC key and recover a key stream (RC4 output) for some IV (not chosen by the attacker)
57 57 BT attack on WPA details assumptions: IPv4 is used, and the attacker knows most bytes of the used IP range (e.g., X) TKIP re-keying period is sufficiently long attacker observes an encrypted ARP packet (sent by the AP) can identify ARP packets from their characteristic length ARP requests are sent to the broadcast address note that attacker knows large part of the plaintext; what she does not know is the last byte of the IP addresses, and the MIC and the ICV values (12 bytes) attacker chops the last byte, and using a guess for the last plaintext byte, modifies the chopped packet like in the KoreK chopchop attack against WEP modified packet is sent to the station, and response is observed no response means wrong guess (CRC is incorrect) MIC failure means right guess repeat until last byte is figured out (no need to wait between trials!)
58 58 BT attack on WPA details wait 1 minute after the MIC failure, and repeat the procedure with the remaining (chopped) packet this gives the last 12 bytes (MIC and ICV) missing parts of the IP addresses are guessed each candidate is verified against the known CRC at this point, the entire ARP packet, the MIC, and the CRC are recovered this gives the key stream from the (message, MIC) pair, the attacker can also recover the MIC key now, the attacker can craft a message, compute its MIC and ICV, encrypt it with the key stream, and send it to the station (with the previously observed IV) however, key stream is IV specific, which functions as a sequence counter therefore, the attacker must prevent the station from receiving the original ARP packet and any other packet during the attack (e.g., by constant jamming)
59 59 AES-CCMP CCMP means CTR mode and CBC-MAC Protocol authenticated encryption mode integrity protection is based on CBC-MAC (using AES) encryption is based on CTR mode (using AES) CBC-MAC computed over the MAC header, CCMP header, and the MPDU (fragmented data) mutable fields are set to zero input is padded with zeros if length is not multiple of 128 (bits) CBC-MAC initial block: flag (8) priority (8) source address (48) packet number (48) data length (16) final 128-bit block of CBC encryption is truncated to (upper) 64 bits to get the CBC- MAC value CTR mode encryption MPDU and CBC-MAC value is encrypted, MAC and CCMP headers are not format of the counter is similar to the CBC-MAC initial block data length is replaced by counter counter is initialized with 1 and incremented after each encrypted block
60 60 Summary security has always been considered important for WiFi early solution was based on WEP seriously flawed! not recommended to use anymore the new security standard for WiFi is i (WPA and WPA2) access control model is based on 802.1X flexible authentication based on EAP and upper layer authentication protocols (e.g., TLS, GSM authentication) improved key management WPA (TKIP) uses RC4 runs on old hardware, but corrects (most of) WEP s flaws WPA has been recently broken! (paper at ACM WiSec 2009, March 16-18) AES-CCMP uses AES in CCMP mode (an authenticated encryption mode) needs new hardware that supports AES
61 61 Recommended readings J. Edney, W. Arbaugh. Real Security: WiFi Protected Access and i. Addison-Wesley, N. Borisov, I. Goldberg, D. Wagner. Intercepting mobile communications: the insecurity of Proceedings of the 7th ACM Conference on Mobile Computing and Networking, S. Fluhrer, I. Mantin, A. Shamir. Weaknesses in the key scheduling algorithm of RC4. Proceedings of the 8th Workshop on Selected Areas in Cryptography E. Tews, Attacks on the WEP protocol, Diploma Thesis, TU Darmstadt, M. Beck, E. Tews, Practical attacks against WEP and WPA, Proceedings of the ACM Conference on Wireless Network Security, March 16-18, 2009.
WiFi biztonság A jó, a rossz és a csúf
WiFi biztonság A jó, a rossz és a csúf BUTTYÁN LEVENTE, DÓRA LÁSZLÓ BME Híradástechnikai Tanszék, CrySyS Adatbiztonsági Laboratórium {buttyan, doralaca}@crysys.hu Lektorált Kulcsszavak: WLAN, WEP, 802.11i,
A WiFi hálózatok technikai háttere
802.11 biztonság Mire jó a WiFi? Nagy sebesség kábelek nélkül Kényelmes, mobil munka Egyszerű megoldás, amikor rövid időre kell kapcsolat Hatalmas területek lefedésére alkalmas Megoldás lehet oda, ahol
Using the CW-Net in a user defined IP network
Using the CW-Net in a user defined IP network Data transmission and device control through IP platform CW-Net Basically, CableWorld's CW-Net operates in the 10.123.13.xxx IP address range. User Defined
Block cipher modes. Cryptographic Protocols (EIT ICT MSc) Dr. Levente Buttyán
Cryptographic Protocols (IT ICT MSc) Dr. Levente Buttyán associate professor BM Hálózati Rendszerek és Szolgáltatások Tanszék Lab of Cryptography and System Security (CrySyS) buttyan@hit.bme.hu, buttyan@crysys.hu
Block cipher modes. - five standardized modes (operation, properties)
Security Protocols (bmevihim132) Dr. Levente Buttyán associate professor BM Híradástechnikai Tanszék Lab of Cryptography and System Security (CrySyS) buttyan@hit.bme.hu, buttyan@crysys.hu Outline - five
Vezetéknélküli technológia
Vezetéknélküli technológia WiFi (Wireless Fidelity) 802.11 szabványt IEEE definiálta protokollként, 1997 Az ISO/OSI modell 1-2 rétege A sebesség függ: helyszíni viszonyok, zavarok, a titkosítás ki/be kapcsolása
Proxer 7 Manager szoftver felhasználói leírás
Proxer 7 Manager szoftver felhasználói leírás A program az induláskor elkezdi keresni az eszközöket. Ha van olyan eszköz, amely virtuális billentyűzetként van beállítva, akkor azokat is kijelzi. Azokkal
EN United in diversity EN A8-0206/419. Amendment
22.3.2019 A8-0206/419 419 Article 2 paragraph 4 point a point i (i) the identity of the road transport operator; (i) the identity of the road transport operator by means of its intra-community tax identification
Computer Architecture
Computer Architecture Locality-aware programming 2016. április 27. Budapest Gábor Horváth associate professor BUTE Department of Telecommunications ghorvath@hit.bme.hu Számítógép Architektúrák Horváth
Teszt topológia E1/1 E1/0 SW1 E1/0 E1/0 SW3 SW2. Kuris Ferenc - [HUN] Cisco Blog -
VTP Teszt topológia E1/1 E1/0 SW1 E1/0 E1/0 SW2 SW3 2 Alap konfiguráció SW1-2-3 conf t interface e1/0 switchport trunk encapsulation dot1q switchport mode trunk vtp domain CCIE vtp mode transparent vtp
Utasítások. Üzembe helyezés
HASZNÁLATI ÚTMUTATÓ Üzembe helyezés Utasítások Windows XP / Vista / Windows 7 / Windows 8 rendszerben történő telepítéshez 1 Töltse le az AORUS makróalkalmazás telepítőjét az AORUS hivatalos webhelyéről.
On The Number Of Slim Semimodular Lattices
On The Number Of Slim Semimodular Lattices Gábor Czédli, Tamás Dékány, László Ozsvárt, Nóra Szakács, Balázs Udvari Bolyai Institute, University of Szeged Conference on Universal Algebra and Lattice Theory
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Hypothesis Testing. Petra Petrovics.
Hypothesis Testing Petra Petrovics PhD Student Inference from the Sample to the Population Estimation Hypothesis Testing Estimation: how can we determine the value of an unknown parameter of a population
Correlation & Linear Regression in SPSS
Petra Petrovics Correlation & Linear Regression in SPSS 4 th seminar Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Correlation
Csatlakozás a BME eduroam hálózatához Setting up the BUTE eduroam network
Csatlakozás a BME eduroam hálózatához Setting up the BUTE eduroam network Table of Contents Windows 7... 2 Windows 8... 6 Windows Phone... 11 Android... 12 iphone... 14 Linux (Debian)... 20 Sebők Márton
Az intézményi hálózathoz való hozzáférés szabályozása
Az intézményi hálózathoz való hozzáférés szabályozása Budai Károly karoly_budai@hu.ibm.com NETWORKSHOP 2004 - Széchenyi István Egyetem Gyor 2004. április 5. 2003 IBM Corporation Témakörök A jelenlegi helyzet,
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel Timea Farkas Click here if your download doesn"t start
VEZETÉK NÉLKÜLI HÁLÓZATOK BIZTONSÁGI
DEBRECENI EGYETEM INFORMATIKAI KAR VEZETÉK NÉLKÜLI HÁLÓZATOK BIZTONSÁGI KÉRDÉSEI Témavezetı: Dr. Krausz Tamás egyetemi adjunktus Készítette: Tóth János programtervezı matematikus DEBRECEN 2010 0. Bevezetés...
Ethernet/IP címzés - gyakorlat
Ethernet/IP címzés - gyakorlat Moldován István moldovan@tmit.bme.hu BUDAPESTI MŰSZAKI ÉS GAZDASÁGTUDOMÁNYI EGYETEM TÁVKÖZLÉSI ÉS MÉDIAINFORMATIKAI TANSZÉK Áttekintés Ethernet Multicast IP címzés (subnet)
Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz
Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz Kvantumkapuk, áramkörök 2016. március 3. A kvantummechanika posztulátumai (1-2) 1. Állapotleírás Zárt fizikai rendszer aktuális állapota
DWL-G520 AirPlus Xtreme G 2,4GHz Vezeték nélküli PCI Adapter
Ez a termék a következő operációs rendszereket támogatja: Windows XP, Windows 2000, Windows Me, Windows 98SE DWL-G520 AirPlus Xtreme G 2,4GHz Vezeték nélküli PCI Adapter Előfeltételek Legalább az alábbiakkal
Construction of a cube given with its centre and a sideline
Transformation of a plane of projection Construction of a cube given with its centre and a sideline Exercise. Given the center O and a sideline e of a cube, where e is a vertical line. Construct the projections
Széchenyi István Egyetem www.sze.hu/~herno
Oldal: 1/6 A feladat során megismerkedünk a C# és a LabVIEW összekapcsolásának egy lehetőségével, pontosabban nagyon egyszerű C#- ban írt kódból fordítunk DLL-t, amit meghívunk LabVIEW-ból. Az eljárás
Genome 373: Hidden Markov Models I. Doug Fowler
Genome 373: Hidden Markov Models I Doug Fowler Review From Gene Prediction I transcriptional start site G open reading frame transcriptional termination site promoter 5 untranslated region 3 untranslated
Cloud computing. Cloud computing. Dr. Bakonyi Péter.
Cloud computing Cloud computing Dr. Bakonyi Péter. 1/24/2011 1/24/2011 Cloud computing 2 Cloud definició A cloud vagy felhő egy platform vagy infrastruktúra Az alkalmazások és szolgáltatások végrehajtására
Cashback 2015 Deposit Promotion teljes szabályzat
Cashback 2015 Deposit Promotion teljes szabályzat 1. Definitions 1. Definíciók: a) Account Client s trading account or any other accounts and/or registers maintained for Számla Az ügyfél kereskedési számlája
Cloud computing Dr. Bakonyi Péter.
Cloud computing Dr. Bakonyi Péter. 1/24/2011 Cloud computing 1/24/2011 Cloud computing 2 Cloud definició A cloud vagy felhő egy platform vagy infrastruktúra Az alkalmazások és szolgáltatások végrehajtására
(NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV
Kommunikációs rendszerek programozása (NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV (5. mérés) SIP telefonközpont készítése Trixbox-szal 1 Mérés helye: Széchenyi István Egyetem, L-1/7 laboratórium, 9026 Győr, Egyetem
Efficient symmetric key private authentication
Efficient symmetric key private authentication Cryptographic Protocols (EIT ICT MSc) Dr. Levente Buttyán Associate Professor BME Hálózati Rendszerek és Szolgáltatások Tanszék Lab of Cryptography and System
Tavaszi Sporttábor / Spring Sports Camp. 2016. május 27 29. (péntek vasárnap) 27 29 May 2016 (Friday Sunday)
Tavaszi Sporttábor / Spring Sports Camp 2016. május 27 29. (péntek vasárnap) 27 29 May 2016 (Friday Sunday) SZÁLLÁS / ACCOMODDATION on a Hotel Gellért*** szálloda 2 ágyas szobáiban, vagy 2x2 ágyas hostel
Performance Modeling of Intelligent Car Parking Systems
Performance Modeling of Intelligent Car Parking Systems Károly Farkas Gábor Horváth András Mészáros Miklós Telek Technical University of Budapest, Hungary EPEW 2014, Florence, Italy Outline Intelligent
1. Gyakorlat: Telepítés: Windows Server 2008 R2 Enterprise, Core, Windows 7
1. Gyakorlat: Telepítés: Windows Server 2008 R2 Enterprise, Core, Windows 7 1.1. Új virtuális gép és Windows Server 2008 R2 Enterprise alap lemez létrehozása 1.2. A differenciális lemezek és a két új virtuális
Lexington Public Schools 146 Maple Street Lexington, Massachusetts 02420
146 Maple Street Lexington, Massachusetts 02420 Surplus Printing Equipment For Sale Key Dates/Times: Item Date Time Location Release of Bid 10/23/2014 11:00 a.m. http://lps.lexingtonma.org (under Quick
Statistical Inference
Petra Petrovics Statistical Inference 1 st lecture Descriptive Statistics Inferential - it is concerned only with collecting and describing data Population - it is used when tentative conclusions about
3. MINTAFELADATSOR KÖZÉPSZINT. Az írásbeli vizsga időtartama: 30 perc. III. Hallott szöveg értése
Oktatáskutató és Fejlesztő Intézet TÁMOP-3.1.1-11/1-2012-0001 XXI. századi közoktatás (fejlesztés, koordináció) II. szakasz ANGOL NYELV 3. MINTAFELADATSOR KÖZÉPSZINT Az írásbeli vizsga időtartama: 30 perc
Lopocsi Istvánné MINTA DOLGOZATOK FELTÉTELES MONDATOK. (1 st, 2 nd, 3 rd CONDITIONAL) + ANSWER KEY PRESENT PERFECT + ANSWER KEY
Lopocsi Istvánné MINTA DOLGOZATOK FELTÉTELES MONDATOK (1 st, 2 nd, 3 rd CONDITIONAL) + ANSWER KEY PRESENT PERFECT + ANSWER KEY FELTÉTELES MONDATOK 1 st, 2 nd, 3 rd CONDITIONAL I. A) Egészítsd ki a mondatokat!
Mapping Sequencing Reads to a Reference Genome
Mapping Sequencing Reads to a Reference Genome High Throughput Sequencing RN Example applications: Sequencing a genome (DN) Sequencing a transcriptome and gene expression studies (RN) ChIP (chromatin immunoprecipitation)
KN-CP50. MANUAL (p. 2) Digital compass. ANLEITUNG (s. 4) Digitaler Kompass. GEBRUIKSAANWIJZING (p. 10) Digitaal kompas
KN-CP50 MANUAL (p. ) Digital compass ANLEITUNG (s. 4) Digitaler Kompass MODE D EMPLOI (p. 7) Boussole numérique GEBRUIKSAANWIJZING (p. 0) Digitaal kompas MANUALE (p. ) Bussola digitale MANUAL DE USO (p.
Phenotype. Genotype. It is like any other experiment! What is a bioinformatics experiment? Remember the Goal. Infectious Disease Paradigm
It is like any other experiment! What is a bioinformatics experiment? You need to know your data/input sources You need to understand your methods and their assumptions You need a plan to get from point
Cluster Analysis. Potyó László
Cluster Analysis Potyó László What is Cluster Analysis? Cluster: a collection of data objects Similar to one another within the same cluster Dissimilar to the objects in other clusters Cluster analysis
Correlation & Linear Regression in SPSS
Correlation & Linear Regression in SPSS Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise 1 - Correlation File / Open
VoIP (Voice over IP)
VoIP (Voice over IP) Analog Telephone Adapter (ATA) Public Switched Telephone Network (PSTN) Private Branch exchang (PBX) Interactive Voice Response (IVR) Helyi hálózatok tervezése és üzemeltetése 1 Történelem
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY A feladatsor három részbol áll 1. A vizsgáztató társalgást kezdeményez a vizsgázóval. 2. A vizsgázó egy szituációs feladatban vesz részt a
T Á J É K O Z T A T Ó. A 1108INT számú nyomtatvány a http://www.nav.gov.hu webcímen a Letöltések Nyomtatványkitöltő programok fülön érhető el.
T Á J É K O Z T A T Ó A 1108INT számú nyomtatvány a http://www.nav.gov.hu webcímen a Letöltések Nyomtatványkitöltő programok fülön érhető el. A Nyomtatványkitöltő programok fület választva a megjelenő
ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP
ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP CHILD S DATA / GYERMEK ADATAI PLEASE FILL IN THIS INFORMATION WITH DATA BASED ON OFFICIAL DOCUMENTS / KÉRJÜK, TÖLTSE KI A HIVATALOS DOKUMENTUMOKBAN SZEREPLŐ ADATOK
Create & validate a signature
IOTA TUTORIAL 7 Create & validate a signature v.0.0 KNBJDBIRYCUGVWMSKPVA9KOOGKKIRCBYHLMUTLGGAV9LIIPZSBGIENVBQ9NBQWXOXQSJRIRBHYJ9LCTJLISGGBRFRTTWD ABBYUVKPYFDJWTFLICYQQWQVDPCAKNVMSQERSYDPSSXPCZLVKWYKYZMREAEYZOSPWEJLHHFPYGSNSUYRZXANDNQTTLLZA
2. Local communities involved in landscape architecture in Óbuda
Év Tájépítésze pályázat - Wallner Krisztina 2. Közösségi tervezés Óbudán Óbuda jelmondata: Közösséget építünk, ennek megfelelően a formálódó helyi közösségeket bevonva fejlesztik a közterületeket. Békásmegyer-Ófaluban
Lecture 11: Genetic Algorithms
Lecture 11 1 Linear and Combinatorial Optimization Lecture 11: Genetic Algorithms Genetic Algorithms - idea Genetic Algorithms - implementation and examples Lecture 11 2 Genetic algorithms Algorithm is
ANGOL NYELVI SZINTFELMÉRŐ 2013 A CSOPORT. on of for from in by with up to at
ANGOL NYELVI SZINTFELMÉRŐ 2013 A CSOPORT A feladatok megoldására 45 perc áll rendelkezésedre, melyből körülbelül 10-15 percet érdemes a levélírási feladatra szánnod. Sok sikert! 1. Válaszd ki a helyes
Szakmai továbbképzési nap akadémiai oktatóknak. 2012. december 14. HISZK, Hódmezővásárhely / Webex
Szakmai továbbképzési nap akadémiai oktatóknak 2012. december 14. HISZK, Hódmezővásárhely / Webex 14.00-15.00 15.00-15.30 15.30-15.40 Mai program 1. Amit feltétlenül ismernünk kell: az irányítótábla közelebbről.
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Factor Analysis
Factor Analysis Factor analysis is a multiple statistical method, which analyzes the correlation relation between data, and it is for data reduction, dimension reduction and to explore the structure. Aim
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY A feladatsor három részből áll 1. A vizsgáztató társalgást kezdeményez a vizsgázóval. 2. A vizsgázó egy szituációs feladatban vesz részt a
16F628A megszakítás kezelése
16F628A megszakítás kezelése A 'megszakítás' azt jelenti, hogy a program normális, szekvenciális futása valamilyen külső hatás miatt átmenetileg felfüggesztődik, és a vezérlést egy külön rutin, a megszakításkezelő
STUDENT LOGBOOK. 1 week general practice course for the 6 th year medical students SEMMELWEIS EGYETEM. Name of the student:
STUDENT LOGBOOK 1 week general practice course for the 6 th year medical students Name of the student: Dates of the practice course: Name of the tutor: Address of the family practice: Tel: Please read
ANGOL NYELVI SZINTFELMÉRŐ 2012 A CSOPORT. to into after of about on for in at from
ANGOL NYELVI SZINTFELMÉRŐ 2012 A CSOPORT A feladatok megoldására 45 perc áll rendelkezésedre, melyből körülbelül 10-15 percet érdemes a levélírási feladatra szánnod. Sok sikert! 1. Válaszd ki a helyes
Decision where Process Based OpRisk Management. made the difference. Norbert Kozma Head of Operational Risk Control. Erste Bank Hungary
Decision where Process Based OpRisk Management made the difference Norbert Kozma Head of Operational Risk Control Erste Bank Hungary About Erste Group 2010. 09. 30. 2 Erste Bank Hungary Erste Group entered
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében. Dicse Jenő üzletfejlesztési igazgató
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében Dicse Jenő üzletfejlesztési igazgató How to apply modern e-learning to improve the training of firefighters Jenő Dicse Director of
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Correlation & Linear. Petra Petrovics.
Correlation & Linear Regression in SPSS Petra Petrovics PhD Student Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise
Sebastián Sáez Senior Trade Economist INTERNATIONAL TRADE DEPARTMENT WORLD BANK
Sebastián Sáez Senior Trade Economist INTERNATIONAL TRADE DEPARTMENT WORLD BANK Despite enormous challenges many developing countries are service exporters Besides traditional activities such as tourism;
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Nonparametric Tests
Nonparametric Tests Petra Petrovics Hypothesis Testing Parametric Tests Mean of a population Population proportion Population Standard Deviation Nonparametric Tests Test for Independence Analysis of Variance
Számítógépes Hálózatok GY 8.hét
Számítógépes Hálózatok GY 8.hét Laki Sándor ELTE-Ericsson Kommunikációs Hálózatok Laboratórium ELTE IK - Információs Rendszerek Tanszék lakis@elte.hu http://lakis.web.elte.hu Teszt 10 kérdés 10 perc canvas.elte.hu
Kvantum-informatika és kommunikáció 2015/2016 ősz. A kvantuminformatika jelölésrendszere szeptember 11.
Kvantum-informatika és kommunikáció 2015/2016 ősz A kvantuminformatika jelölésrendszere 2015. szeptember 11. Mi lehet kvantumbit? Kvantum eszközök (1) 15=5 3 Bacsárdi Képek forrása: IBM's László, Almaden
USER MANUAL Guest user
USER MANUAL Guest user 1 Welcome in Kutatótér (Researchroom) Top menu 1. Click on it and the left side menu will pop up 2. With the slider you can make left side menu visible 3. Font side: enlarging font
Pletykaalapú gépi tanulás teljesen elosztott környezetben
Pletykaalapú gépi tanulás teljesen elosztott környezetben Hegedűs István Jelasity Márk témavezető Szegedi Tudományegyetem MTA-SZTE Mesterséges Intelligencia Kutatócsopot Motiváció Az adat adatközpontokban
Tudományos Ismeretterjesztő Társulat
Sample letter number 3. Russell Ltd. 57b Great Hawthorne Industrial Estate Hull East Yorkshire HU 19 5BV 14 Bebek u. Budapest H-1105 10 December, 2009 Ref.: complaint Dear Sir/Madam, After seeing your
Határidős accountok WiFi rendszerekhez
Határidős accountok WiFi rendszerekhez Pásztor György pasztor@bibl.u-szeged.hu Szegedi Tudományegyetem - Egyetemi Könyvtár Bán Attila István miham@bibl.u-szeged.hu Szegedi Tudományegyetem - Egyetemi Könyvtár
HBONE+ projekt - campus best practices
HBONE+ projekt - campus best practices 2011. Június 9. Mohácsi János NIIF Intézet A slide-ok GN3 projekt NA3T4 munkacsoportjának vezetőjétől Gunnar Bøe-től származnak a TNC2011 konferencián elhangzott
Wireless LAN a Műegyetemen. Jákó András jako.andras@eik.bme.hu BME EISzK
Wireless LAN a Műegyetemen Jákó András jako.andras@eik.bme.hu BME EISzK Tartalom Peremfeltételek Biztonság Rádiós problémák Networkshop 2004. Wireless LAN a Műegyetemen 2 skálázhatóság több ezer potenciális
ios alkalmazásfejlesztés Koltai Róbert
ios alkalmazásfejlesztés Koltai Róbert robert.koltai@ponte.hu Mi az a block? Utasítások sorozata { }-ek között, amit egy objektumként tuduk kezelni. ios 4.0 és Mac OSX 10.6 óta 2 Egy példa a felépítésére
Dependency preservation
Adatbázis-kezelés. (4 előadás: Relácó felbontásai (dekomponálás)) 1 Getting lossless decomposition is necessary. But of course, we also want to keep dependencies, since losing a dependency means, that
EEA, Eionet and Country visits. Bernt Röndell - SES
EEA, Eionet and Country visits Bernt Röndell - SES Európai Környezetvédelmi Ügynökség Küldetésünk Annak elősegítése, hogy az EU és a tagállamok a szükséges információk alapján hozhassák meg a környezet
Informatikai alkalmazásfejlesztő alkalmazásfejlesztő 54 481 02 0010 54 02 Információrendszer-elemző és - Informatikai alkalmazásfejlesztő
A 10/2007 (II. 27.) SzMM rendelettel módosított 1/2006 (II. 17.) OM rendelet Országos Képzési Jegyzékről és az Országos Képzési Jegyzékbe történő felvétel és törlés eljárási rendjéről alapján. Szakképesítés,
Az Open Data jogi háttere. Dr. Telek Eszter
Az Open Data jogi háttere Dr. Telek Eszter Egy kis ismétlés Open Data/Open Access/Open Knowledge gyökerei Open Source Software FLOSS (Free Libre Open Source Software) Szoftver esetében egyszerű alapok:
Contact us Toll free (800) fax (800)
Table of Contents Thank you for purchasing our product, your business is greatly appreciated. If you have any questions, comments, or concerns with the product you received please contact the factory.
General information for the participants of the GTG Budapest, 2017 meeting
General information for the participants of the GTG Budapest, 2017 meeting Currency is Hungarian Forint (HUF). 1 EUR 310 HUF, 1000 HUF 3.20 EUR. Climate is continental, which means cold and dry in February
Intézményi IKI Gazdasági Nyelvi Vizsga
Intézményi IKI Gazdasági Nyelvi Vizsga Név:... Születési hely:... Születési dátum (év/hó/nap):... Nyelv: Angol Fok: Alapfok 1. Feladat: Olvasáskészséget mérő feladat 20 pont Olvassa el a szöveget és válaszoljon
Tudományos Ismeretterjesztő Társulat
Sample letter number 5. International Culture Festival PO Box 34467 Harrogate HG 45 67F Sonnenbergstraße 11a CH-6005 Luzern Re: Festival May 19, 2009 Dear Ms Atkinson, We are two students from Switzerland
Presenter SNP6000. Register your product and get support at HU Felhasználói kézikönyv
Register your product and get support at www.philips.com/welcome Presenter SNP6000 HU Felhasználói kézikönyv 1 a b c d e 2 3 4 Federal Communication Commission Interference Statement This equipment has
(Asking for permission) (-hatok/-hetek?; Szabad ni? Lehet ni?) Az engedélykérés kifejezésére a következő segédigéket használhatjuk: vagy vagy vagy
(Asking for permission) (-hatok/-hetek?; Szabad ni? Lehet ni?) SEGÉDIGÉKKEL Az engedélykérés kifejezésére a következő segédigéket használhatjuk: vagy vagy vagy A fenti felsorolásban a magabiztosság/félénkség
Mobil webszerverek. Márton Gábor Nokia Research Center. W3C Mobilweb Műhelykonferencia, Budapest 2006. október 18.
Mobil webszerverek Márton Gábor Nokia Research Center W3C Mobilweb Műhelykonferencia, Budapest 2006. október 18. 1 2006 Nokia Mobil webszerverek / 2006-10-18 / JWi, GMa Előzmények Klassz lenne, ha a mobiltelefonon
SQL/PSM kurzorok rész
SQL/PSM kurzorok --- 2.rész Tankönyv: Ullman-Widom: Adatbázisrendszerek Alapvetés Második, átdolgozott kiadás, Panem, 2009 9.3. Az SQL és a befogadó nyelv közötti felület (sormutatók) 9.4. SQL/PSM Sémában
Előszó.2. Starter exercises. 3. Exercises for kids.. 9. Our comic...17
2011. december Tartalom Előszó.2 Starter exercises. 3 Exercises for kids.. 9 Our comic....17 1 Előszó Kedves angolul tanulók! A 2010/2011- es tanévben elkezdett újságunkat szeretnénk továbbra is szerkeszteni
EN United in diversity EN A8-0206/482. Amendment
21.3.2019 A8-0206/482 482 Recital 13 g (new) (13g) In recognition of the need for specific treatment for the transport sector, in which movement is the very essence of the work undertaken by drivers, the
EN United in diversity EN A8-0206/473. Amendment
21.3.2019 A8-0206/473 473 Recital 12 d (new) (12d) Since there is no sufficient link of a driver with a territory of a Member State of transit, transit operations should not be considered as posting situations.
Web Services. (webszolgáltatások): egy osztott alkalmazásfejlesztési plattform
(webszolgáltatások): egy osztott alkalmazásfejlesztési plattform Ficsor Lajos Általános Informatikai Tanszék Miskolci Egyetem A Web Service Web Service definíciója Számos definíció létezik. IBM [4] A Web
Random number generation
Security Protocols (bmevihim132) Dr. Levente Buttyán associate professor BME Hálózati Rendszerek és Szolgáltatások Tanszék Lab of Cryptography and System Security (CrySyS) buttyan@hit.bme.hu, buttyan@crysys.hu
Hogyan használja az OROS online pótalkatrész jegyzéket?
Hogyan használja az OROS online pótalkatrész jegyzéket? Program indítása/program starts up Válassza ki a weblap nyelvét/choose the language of the webpage Látogasson el az oros.hu weboldalra, majd klikkeljen
Számítógépes hálózatok
Számítógépes hálózatok Negyedik gyakorlat SSL/TLS, DNS, CRC, TCP Laki Sándor Szűrési feladatok 1 - Neptun A neptun_out.pcapng felhasználásával állomány felhasználásával válaszolja meg az alábbi kérdéseket:
IP/09/473. Brüsszel, 2009. március 25
IP/09/473 Brüsszel, 2009. március 25 A mobiltelefon-használat nő, míg a fogyasztói árak csökkennek: a Bizottság jelentése szerint az európai távközlési ágazat ellenáll a gazdasági lassulásnak 2008-ban
PIACI HIRDETMÉNY / MARKET NOTICE
PIACI HIRDETMÉNY / MARKET NOTICE HUPX DAM Másnapi Aukció / HUPX DAM Day-Ahead Auction Iktatási szám / Notice #: Dátum / Of: 18/11/2014 HUPX-MN-DAM-2014-0023 Tárgy / Subject: Változások a HUPX másnapi piac
Utolsó frissítés / Last update: február Szerkesztő / Editor: Csatlós Árpádné
Utolsó frissítés / Last update: 2016. február Szerkesztő / Editor: Csatlós Árpádné TARTALOM / Contents BEVEZETŐ / Introduction... 2 FELNŐTT TAGBÉLYEGEK / Adult membership stamps... 3 IFJÚSÁGI TAGBÉLYEGEK
Travel Getting Around
- Location I am lost. Not knowing where you are Can you show me where it is on the map? Asking for a specific location on a map Where can I find? Asking for a specific Eltévedtem. Meg tudná nekem mutatni
Csima Judit április 9.
Osztályozókról még pár dolog Csima Judit BME, VIK, Számítástudományi és Információelméleti Tanszék 2018. április 9. Csima Judit Osztályozókról még pár dolog 1 / 19 SVM (support vector machine) ez is egy
Ellenőrző lista. 2. Hálózati útvonal beállítások, kapcsolatok, névfeloldások ellenőrzése: WebEC és BKPR URL-k kliensről történő ellenőrzése.
Ellenőrző lista 1. HW/SW rendszer követelmények meglétének ellenőrzése: A telepítési segédlet által megjelölt elemek meglétének, helyes üzemének ellenőrzése. 2. Hálózati útvonal beállítások, kapcsolatok,
Választási modellek 3
Választási modellek 3 Prileszky István Doktori Iskola 2018 http://www.sze.hu/~prile Forrás: A Self Instructing Course in Mode Choice Modeling: Multinomial and Nested Logit Models Prepared For U.S. Department
Statistical Dependence
Statistical Dependence Petra Petrovics Statistical Dependence Deinition: Statistical dependence exists when the value o some variable is dependent upon or aected by the value o some other variable. Independent
TP-LINK Business Wireless Az EAP Kontrolleres Wi-Fi termékcsalád bemutatása - bevezető SMB Product Line
TP-LINK Business Wireless Az EAP Kontrolleres Wi-Fi termékcsalád bemutatása - bevezető SMB Product Line Dr. Kilbertus Viktor SMB Sales Manager TP-LINK Networks Hungary viktor.kilbertus@tp-link.com 2016
7 th Iron Smelting Symposium 2010, Holland
7 th Iron Smelting Symposium 2010, Holland Október 13-17 között került megrendezésre a Hollandiai Alphen aan den Rijn városában található Archeon Skanzenben a 7. Vasolvasztó Szimpózium. Az öt napos rendezvényen
discosnp demo - Peterlongo Pierre 1 DISCOSNP++: Live demo
discosnp demo - Peterlongo Pierre 1 DISCOSNP++: Live demo Download and install discosnp demo - Peterlongo Pierre 3 Download web page: github.com/gatb/discosnp Chose latest release (2.2.10 today) discosnp
Emelt szint SZÓBELI VIZSGA VIZSGÁZTATÓI PÉLDÁNY VIZSGÁZTATÓI. (A részfeladat tanulmányozására a vizsgázónak fél perc áll a rendelkezésére.
Emelt szint SZÓBELI VIZSGA VIZSGÁZTATÓI PÉLDÁNY VIZSGÁZTATÓI PÉLDÁNY A feladatsor három részből áll 1. A vizsgáztató társalgást kezdeményez a vizsgázóval. 2. A vizsgázó egy vita feladatban vesz részt a