Efficient symmetric key private authentication
|
|
- Krisztina Törökné
- 9 évvel ezelőtt
- Látták:
Átírás
1 Efficient symmetric key private authentication Cryptographic Protocols (EIT ICT MSc) Dr. Levente Buttyán Associate Professor BME Hálózati Rendszerek és Szolgáltatások Tanszék Lab of Cryptography and System Security (CrySyS)
2 2 Outline - the problem - key-tree based approach - group based approach - privacy metrics and their comparison - computing the level of privacy for key-trees and groups
3 3 Private authentication the problem authentication protocols often reveal the identity of the authenticating party (prover) to an eavesdropper when devices move around and authenticate themselves frequently, the location of them can be tracked typical examples are RFID tags and contactless smart card based systems
4 4 An example ISO the protocol: (1) B A: r B (2) A B: E(K, r B B*) where K is a shared key between A and B, and E(.) denotes encryption it is assumed that the parties are aware of the claimed identity of the other either by context or by additional cleartext data fields (0) A B : A
5 5 Solutions based on public-key crypto encrypt identity information of the authenticating party with the public key of the verifier setup a confidential channel between the parties using the basic Diffie-Hellman protocol and send identity information through that channel IKE in main mode works in this way common disadvantage: public key operations may not be affordable in devices with limited resources (e.g., public transport cards, RFID tags)
6 6 Naïve solutions for low-cost tags encrypt (hash) identity information with a single common key drawback: compromise of a single member of the system has fatal consequences encrypt (hash) identity information with a unique key drawback: number of keys need to be tested by the verifier grows linearly with the number of potential provers doesn t scale (potentially long authentication delay in large systems)
7 7 Better solutions for low cost tags tree-based approach proposed by Molnar and Wagner in 2004 improved by Buttyan, Holczer, and Vajda in 2006 advantage: authentication delay is logarithmic in the number of members drawback: increased overhead (at the prover s side) level of privacy quickly decreasing as the number of compromised members increases group-based approach proposed by Avoine, Buttyan, Holczer, Vajda in 2007 advantage: higher level of privacy and smaller overhead than in the tree-based approach drawback:???
8 8 The tree-based approach k 1 try all these keys until one of them works k 11 k 111 k 1, k 11, k 111 tag R E(k 1, R R), E(k 11, R R), E(k 111, R R) reader k 1, k 11, k 111 tag ID
9 9 A problem k 1 k 11 k 111 P 0 P 1 P 2 P 3 if a member is compromised, its keys are learned by the adversary however, most of those keys are used by other members too the adversary can recognize the usage of those compromised keys consequently, the level of privacy provided by the system to noncompromised members is decreased this decrease can be minimized by careful design of the tree!
10 10 Anonymity sets k 1 k 11 k 111 P 0 P 1 P 2 P 3 compromised tags partition the set of all tags tags in a given partition are indistinguishable tags in different partitions can be distinguished each partition is the anonymity set of its members
11 11 Normalized Average Anonymity Set Size (NAASS) k 1 k 11 k 111 P 0 P 1 P 2 P 3 the level of privacy provided by the system to a randomly selected member is characterized by the average anonymity set size: where N is the total number of members we normalize this to obtain a value between 0 and 1:
12 12 Computing NAASS when a single tag is compromised k 1 k 11 k 111 P 0 P 1 P 2 P 3
13 13 A trade-off between privacy and efficiency efficiency of the system is characterized by the maximum authentication delay: examples: naïve linear key search ( l = 1 ) R = 1 2(N-1)/N 2 1 2/N 1 D = N (if N is large) binary key-tree ( l = log N ) R = 1/3 + 2/(3N 2 ) 1/3 (if N is large) D = 2 log N how to maximize R while keeping D below a threshold?
14 14 The optimization problem Given the total number N of tags and the upper bound D max on the maximum authentication delay, find a branching factor vector B = ( b 1, b 2,... b l ) such that is maximal, subject to the following constraints:
15 15 Analysis of the optimization problem Lemma 1: we can always improve a branching factor vector by ordering its elements in decreasing order Lemma 2: lower and upper bounds on R(B) (where B is ordered): Lemma 3: given two branching factor vectors (that satisfy the constraints), the one with the larger first element is always at least as good as the other Lemma 4: given two branching factor vectors the first j elements of which are equal, the vector with the larger (j+1)-st element is always at least as good as the other
16 16 A solution let P be the ordered vector of prime factors of N if P doesn t satisfy the conditions, then no solution exists otherwise, let P be a subset of P such that if we multiply the prime factors in P (let the product be Q), then the vector (Q, P\P ) still satisfies the constraints, and Q is maximal the first element of the optimal branching factor vector is Q if all prime factors are used (P\P = ), then stop else repeat the procedure recursively with the remaining primes
17 17 Operation of the algorithm illsutrated let N = and D max = 90 P P Q the optimal tree for these parameters is (72, 5, 5, 5, 3) R D = 90
18 18 Proof sketch of the algorithm let B* = (b* 1,, b* L ) be the output of the algorithm assume that there s a B = (b 1,, b K ) B* such that R(B ) > R(B*) B* is obtained by maximizing b* 1 b* 1 b 1 if b* 1 > b 1 then R(B*) R(B ) by Lemma 3 b* 1 = b 1 must hold B* is obtained by maximizing b* 2 (once b* 1 is determined) b* 2 b 2 if b* 2 > b 2 then R(B*) R(B ) by Lemma 4 b* 2 = b 2 must hold B* = B must hold, which is a contradiction
19 19 The general case (any tags can be compromised) <-> <1> <2> <3> <11> <12> <13> <21> <22> <23> <31> <32> <33> number and size of partitions depend on which tags are compromised
20 20 Approximation of NAASS for key-trees let the branching factors of the tree be b 1, b 2,, b L select a tag T randomly (without loss of generality, we assume that the left most tag of the tree is selected) we want to compute the expected size of T s anonymity set when some tags are compromised we assume that each tag is compromised with probability p = C/N the probability that a given edge (key) is compromised at level i is q i = 1 (1 - p) N i where N i = N/(b 1 b 2 b i ) is the number of tags below that edge
21 21 Approximation of NAASS for key-trees b L T the probability that T s anonymity set size is exactly k (k = 1, 2,, b L -1) is:
22 22 Approximation of NAASS for key-trees b L-1 b L T the probability that T s anonymity set size is kb L (k = 1, 2,, b L-1-1) is:
23 23 Approximation of NAASS for key-trees in general, the probability that T s anonymity set size is kb L b L-1 b i+1 = kn i (i = 1, 2,, L and k = 1, 2,, b i -1) is: from this, the expected size of T s anonymity set is:
24 24 Verification of the approximation B = [ ]
25 25 Comparison of key-trees conclusion: first element of the branching factor vector determines the level of privacy in the general case too
26 28 Norm. entropy based anonymity set size (NEASS) main idea: assume that a tag is compromised and this results in two equal size (N/2) partitions the adversary can tell each tag in either one of the partitions 1 bit of information has been disclosed in general, the amount of information that is disclosed due to tag compromise is (normalized) entropy based anonymity set size:
27 Comparison of NAASS and NEASS (simulation) Buttyán Levente, HIT 29 B = [ ]
28 30 The group-based approach k 1 k 2 K 1 K 2 K g k n k N k 1, K 1 tag R E(K 1, ID R R), E(k 1, R R) reader immediate advantage: each tag stores and uses only two keys 1.) try all group keys until one of them works 2.) authenticate the tag by using its individual key
29 31 Computing NAASS for the group-based appr partitioning depends on the number C of compromised groups NAASS can be computed as: if tags are compromised randomly, then C is a random variable we are interested in the expected value of S/N for this we need to compute E[C] and E[C 2 ]
30 32 Computing NAASS for the group-based appr. let c be the number of compromised tags let A i be the event that at least one tag is compromised from the i-th group the probability of A i can be computed as:
31 33 Computing NAASS for the group-based appr. let I Ai be the indicator function of A i E[C] =? E[C 2 ] =?
32 Computing NAASS for the group-based appr. Buttyán Levente, HIT 34
33 35 Verification of the approximation N = g = 90
34 36 Comparison of approaches select a privacy metric (NAASS or NEASS) for a given set of parameters (number N of tags, max authentication delay D), determine the optimal key-tree compute the privacy metric for the optimal tree (function of c) determine the corresponding parameters for the group based approach (g = D-1) compute the privacy metric for the groups (function of c)
35 37 Comparison in NAASS N = 2 14 D = 65 [ ] 64 x 256
36 38 Comparison in NEASS N = 2 14 D = 65 [ ] 64 x 256
37 Summary we studied the problem of (efficient) symmetric-key private authentication we presented two approaches: key-trees and groups we gave an overview of proposed privacy metrics NAASS, NEASS, prob. of traceability we showed some relationships between the metrics prob. of traceability ~ NAASS, NEASS < NAASS we gave precise approximations of the NAASS for trees and for groups we compared the tree and the group based approaches using NAASS and NEASS Buttyán Levente, HIT 39
38 40 Conclusions we obtained controversial results group-based approach achieves better privacy if we use NAASS tree-based approach achieves better privacy if we use NEASS be cautious which metric you use! yet, the difference between trees and groups does not seem to be large in terms of privacy groups may be a better trade-off, due to the smaller overhead the group-based approach is a serious alternative to the tree-based approach
39 41 Open problems 1. Closed form approximation of the NEASS (both for trees and groups)? 2. How to find the optimal tree when the metric is the NEASS? 3. How to preserve the efficiency of the tree and the groupbased approaches and eliminate the exponential decrease of the level of privacy at the same time???
Performance Modeling of Intelligent Car Parking Systems
Performance Modeling of Intelligent Car Parking Systems Károly Farkas Gábor Horváth András Mészáros Miklós Telek Technical University of Budapest, Hungary EPEW 2014, Florence, Italy Outline Intelligent
On The Number Of Slim Semimodular Lattices
On The Number Of Slim Semimodular Lattices Gábor Czédli, Tamás Dékány, László Ozsvárt, Nóra Szakács, Balázs Udvari Bolyai Institute, University of Szeged Conference on Universal Algebra and Lattice Theory
Széchenyi István Egyetem www.sze.hu/~herno
Oldal: 1/6 A feladat során megismerkedünk a C# és a LabVIEW összekapcsolásának egy lehetőségével, pontosabban nagyon egyszerű C#- ban írt kódból fordítunk DLL-t, amit meghívunk LabVIEW-ból. Az eljárás
Statistical Inference
Petra Petrovics Statistical Inference 1 st lecture Descriptive Statistics Inferential - it is concerned only with collecting and describing data Population - it is used when tentative conclusions about
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Nonparametric Tests
Nonparametric Tests Petra Petrovics Hypothesis Testing Parametric Tests Mean of a population Population proportion Population Standard Deviation Nonparametric Tests Test for Independence Analysis of Variance
A logaritmikus legkisebb négyzetek módszerének karakterizációi
A logaritmikus legkisebb négyzetek módszerének karakterizációi Csató László laszlo.csato@uni-corvinus.hu MTA Számítástechnikai és Automatizálási Kutatóintézet (MTA SZTAKI) Operációkutatás és Döntési Rendszerek
Csima Judit április 9.
Osztályozókról még pár dolog Csima Judit BME, VIK, Számítástudományi és Információelméleti Tanszék 2018. április 9. Csima Judit Osztályozókról még pár dolog 1 / 19 SVM (support vector machine) ez is egy
Dependency preservation
Adatbázis-kezelés. (4 előadás: Relácó felbontásai (dekomponálás)) 1 Getting lossless decomposition is necessary. But of course, we also want to keep dependencies, since losing a dependency means, that
Supporting Information
Supporting Information Cell-free GFP simulations Cell-free simulations of degfp production were consistent with experimental measurements (Fig. S1). Dual emmission GFP was produced under a P70a promoter
Create & validate a signature
IOTA TUTORIAL 7 Create & validate a signature v.0.0 KNBJDBIRYCUGVWMSKPVA9KOOGKKIRCBYHLMUTLGGAV9LIIPZSBGIENVBQ9NBQWXOXQSJRIRBHYJ9LCTJLISGGBRFRTTWD ABBYUVKPYFDJWTFLICYQQWQVDPCAKNVMSQERSYDPSSXPCZLVKWYKYZMREAEYZOSPWEJLHHFPYGSNSUYRZXANDNQTTLLZA
Cluster Analysis. Potyó László
Cluster Analysis Potyó László What is Cluster Analysis? Cluster: a collection of data objects Similar to one another within the same cluster Dissimilar to the objects in other clusters Cluster analysis
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Hypothesis Testing. Petra Petrovics.
Hypothesis Testing Petra Petrovics PhD Student Inference from the Sample to the Population Estimation Hypothesis Testing Estimation: how can we determine the value of an unknown parameter of a population
Correlation & Linear Regression in SPSS
Petra Petrovics Correlation & Linear Regression in SPSS 4 th seminar Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Correlation
Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz
Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz Kvantumkapuk, áramkörök 2016. március 3. A kvantummechanika posztulátumai (1-2) 1. Állapotleírás Zárt fizikai rendszer aktuális állapota
Computer Architecture
Computer Architecture Locality-aware programming 2016. április 27. Budapest Gábor Horváth associate professor BUTE Department of Telecommunications ghorvath@hit.bme.hu Számítógép Architektúrák Horváth
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Nonparametric Tests. Petra Petrovics.
Nonparametric Tests Petra Petrovics PhD Student Hypothesis Testing Parametric Tests Mean o a population Population proportion Population Standard Deviation Nonparametric Tests Test or Independence Analysis
Construction of a cube given with its centre and a sideline
Transformation of a plane of projection Construction of a cube given with its centre and a sideline Exercise. Given the center O and a sideline e of a cube, where e is a vertical line. Construct the projections
EN United in diversity EN A8-0206/419. Amendment
22.3.2019 A8-0206/419 419 Article 2 paragraph 4 point a point i (i) the identity of the road transport operator; (i) the identity of the road transport operator by means of its intra-community tax identification
Ensemble Kalman Filters Part 1: The basics
Ensemble Kalman Filters Part 1: The basics Peter Jan van Leeuwen Data Assimilation Research Centre DARC University of Reading p.j.vanleeuwen@reading.ac.uk Model: 10 9 unknowns P[u(x1),u(x2),T(x3),.. Observations:
Phenotype. Genotype. It is like any other experiment! What is a bioinformatics experiment? Remember the Goal. Infectious Disease Paradigm
It is like any other experiment! What is a bioinformatics experiment? You need to know your data/input sources You need to understand your methods and their assumptions You need a plan to get from point
Sebastián Sáez Senior Trade Economist INTERNATIONAL TRADE DEPARTMENT WORLD BANK
Sebastián Sáez Senior Trade Economist INTERNATIONAL TRADE DEPARTMENT WORLD BANK Despite enormous challenges many developing countries are service exporters Besides traditional activities such as tourism;
Statistical Dependence
Statistical Dependence Petra Petrovics Statistical Dependence Deinition: Statistical dependence exists when the value o some variable is dependent upon or aected by the value o some other variable. Independent
discosnp demo - Peterlongo Pierre 1 DISCOSNP++: Live demo
discosnp demo - Peterlongo Pierre 1 DISCOSNP++: Live demo Download and install discosnp demo - Peterlongo Pierre 3 Download web page: github.com/gatb/discosnp Chose latest release (2.2.10 today) discosnp
Lecture 11: Genetic Algorithms
Lecture 11 1 Linear and Combinatorial Optimization Lecture 11: Genetic Algorithms Genetic Algorithms - idea Genetic Algorithms - implementation and examples Lecture 11 2 Genetic algorithms Algorithm is
Genome 373: Hidden Markov Models I. Doug Fowler
Genome 373: Hidden Markov Models I Doug Fowler Review From Gene Prediction I transcriptional start site G open reading frame transcriptional termination site promoter 5 untranslated region 3 untranslated
A rosszindulatú daganatos halálozás változása 1975 és 2001 között Magyarországon
A rosszindulatú daganatos halálozás változása és között Eredeti közlemény Gaudi István 1,2, Kásler Miklós 2 1 MTA Számítástechnikai és Automatizálási Kutató Intézete, Budapest 2 Országos Onkológiai Intézet,
Cloud computing. Cloud computing. Dr. Bakonyi Péter.
Cloud computing Cloud computing Dr. Bakonyi Péter. 1/24/2011 1/24/2011 Cloud computing 2 Cloud definició A cloud vagy felhő egy platform vagy infrastruktúra Az alkalmazások és szolgáltatások végrehajtására
Pletykaalapú gépi tanulás teljesen elosztott környezetben
Pletykaalapú gépi tanulás teljesen elosztott környezetben Hegedűs István Jelasity Márk témavezető Szegedi Tudományegyetem MTA-SZTE Mesterséges Intelligencia Kutatócsopot Motiváció Az adat adatközpontokban
Választási modellek 3
Választási modellek 3 Prileszky István Doktori Iskola 2018 http://www.sze.hu/~prile Forrás: A Self Instructing Course in Mode Choice Modeling: Multinomial and Nested Logit Models Prepared For U.S. Department
Proxer 7 Manager szoftver felhasználói leírás
Proxer 7 Manager szoftver felhasználói leírás A program az induláskor elkezdi keresni az eszközöket. Ha van olyan eszköz, amely virtuális billentyűzetként van beállítva, akkor azokat is kijelzi. Azokkal
Mapping Sequencing Reads to a Reference Genome
Mapping Sequencing Reads to a Reference Genome High Throughput Sequencing RN Example applications: Sequencing a genome (DN) Sequencing a transcriptome and gene expression studies (RN) ChIP (chromatin immunoprecipitation)
FAMILY STRUCTURES THROUGH THE LIFE CYCLE
FAMILY STRUCTURES THROUGH THE LIFE CYCLE István Harcsa Judit Monostori A magyar társadalom 2012-ben: trendek és perspektívák EU összehasonlításban Budapest, 2012 november 22-23 Introduction Factors which
Local fluctuations of critical Mandelbrot cascades. Konrad Kolesko
Local fluctuations of critical Mandelbrot cascades Konrad Kolesko joint with D. Buraczewski and P. Dyszewski Warwick, 18-22 May, 2015 Random measures µ µ 1 µ 2 For given random variables X 1, X 2 s.t.
Utasítások. Üzembe helyezés
HASZNÁLATI ÚTMUTATÓ Üzembe helyezés Utasítások Windows XP / Vista / Windows 7 / Windows 8 rendszerben történő telepítéshez 1 Töltse le az AORUS makróalkalmazás telepítőjét az AORUS hivatalos webhelyéről.
Cloud computing Dr. Bakonyi Péter.
Cloud computing Dr. Bakonyi Péter. 1/24/2011 Cloud computing 1/24/2011 Cloud computing 2 Cloud definició A cloud vagy felhő egy platform vagy infrastruktúra Az alkalmazások és szolgáltatások végrehajtására
Dense Matrix Algorithms (Chapter 8) Alexandre David B2-206
Dense Matrix Algorithms (Chapter 8) Alexandre David B2-206 Dense Matrix Algorithm Dense or full matrices: few known zeros. Other algorithms for sparse matrix. Square matrices for pedagogical purposes only
PIACI HIRDETMÉNY / MARKET NOTICE
PIACI HIRDETMÉNY / MARKET NOTICE HUPX DAM Másnapi Aukció / HUPX DAM Day-Ahead Auction Iktatási szám / Notice #: Dátum / Of: 18/11/2014 HUPX-MN-DAM-2014-0023 Tárgy / Subject: Változások a HUPX másnapi piac
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Factor Analysis
Factor Analysis Factor analysis is a multiple statistical method, which analyzes the correlation relation between data, and it is for data reduction, dimension reduction and to explore the structure. Aim
MATEMATIKA ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2016. október 18. MATEMATIKA ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2016. október 18. 8:00 I. Időtartam: 45 perc Pótlapok száma Tisztázati Piszkozati EMBERI ERŐFORRÁSOK MINISZTÉRIUMA
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel Timea Farkas Click here if your download doesn"t start
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében. Dicse Jenő üzletfejlesztési igazgató
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében Dicse Jenő üzletfejlesztési igazgató How to apply modern e-learning to improve the training of firefighters Jenő Dicse Director of
(c) 2004 F. Estrada & A. Jepson & D. Fleet Canny Edges Tutorial: Oct. 4, '03 Canny Edges Tutorial References: ffl imagetutorial.m ffl cannytutorial.m
Canny Edges Tutorial: Oct. 4, '03 Canny Edges Tutorial References: ffl imagetutorial.m ffl cannytutorial.m ffl ~jepson/pub/matlab/isetoolbox/tutorials ffl ~jepson/pub/matlab/utvistoolbox/tutorials ffl
Cashback 2015 Deposit Promotion teljes szabályzat
Cashback 2015 Deposit Promotion teljes szabályzat 1. Definitions 1. Definíciók: a) Account Client s trading account or any other accounts and/or registers maintained for Számla Az ügyfél kereskedési számlája
Budapest, 2011. május 04. Mit tehet a munkahely a dolgozók egészségéért?
Budapest, 2011. május 04. Mit tehet a munkahely a dolgozók egészségéért? Egészséges munkahely Vállalati kultúra és filozófia Vezetés hozzáállása 1 Egészséges munkahely A program beindításának és sikeres
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Correlation & Linear. Petra Petrovics.
Correlation & Linear Regression in SPSS Petra Petrovics PhD Student Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise
GEOGRAPHICAL ECONOMICS B
GEOGRAPHICAL ECONOMICS B ELTE Faculty of Social Sciences, Department of Economics Geographical Economics "B" KRUGMAN (1991) MODEL: EXTENSIONS Authors: Gábor Békés, Sarolta Rózsás Supervised by Gábor
Correlation & Linear Regression in SPSS
Correlation & Linear Regression in SPSS Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise 1 - Correlation File / Open
Rezgésdiagnosztika. Diagnosztika 02 --- 1
Rezgésdiagnosztika Diagnosztika 02 --- 1 Diagnosztika 02 --- 2 A rezgéskép elemzésével kimutatható gépészeti problémák Minden gép, mely tartalmaz forgó részt (pl. motor, generátor, szivattyú, ventilátor,
A controlling és az értékelemzés összekapcsolása, különös tekintettel a felsőoktatási és a gyakorlati alkalmazhatóságra
A controlling és az értékelemzés összekapcsolása, különös tekintettel a felsőoktatási és a gyakorlati alkalmazhatóságra Dr. Szóka Károly Nyugat-magyarországi Egyetem Közgazdaságtudományi Kar Egyetemi docens
INDEXSTRUKTÚRÁK III.
2MU05_Bitmap.pdf camü_ea INDEXSTRUKTÚRÁK III. Molina-Ullman-Widom: Adatbázisrendszerek megvalósítása Panem, 2001könyv 5.4. Bittérkép indexek fejezete alapján Oracle: Indexek a gyakorlatban Oracle Database
ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP
ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP CHILD S DATA / GYERMEK ADATAI PLEASE FILL IN THIS INFORMATION WITH DATA BASED ON OFFICIAL DOCUMENTS / KÉRJÜK, TÖLTSE KI A HIVATALOS DOKUMENTUMOKBAN SZEREPLŐ ADATOK
Számítógéppel irányított rendszerek elmélete. Gyakorlat - Mintavételezés, DT-LTI rendszermodellek
Számítógéppel irányított rendszerek elmélete Gyakorlat - Mintavételezés, DT-LTI rendszermodellek Hangos Katalin Villamosmérnöki és Információs Rendszerek Tanszék e-mail: hangos.katalin@virt.uni-pannon.hu
KIEGÉSZÍTŽ FELADATOK. Készlet Bud. Kap. Pápa Sopr. Veszp. Kecsk. 310 4 6 8 10 5 Pécs 260 6 4 5 6 3 Szomb. 280 9 5 4 3 5 Igény 220 200 80 180 160
KIEGÉSZÍTŽ FELADATOK (Szállítási probléma) Árut kell elszállítani három telephelyr l (Kecskemét, Pécs, Szombathely) öt területi raktárba, melyek Budapesten, Kaposváron, Pápán, Sopronban és Veszprémben
INTELLIGENT ENERGY EUROPE PROGRAMME BUILD UP SKILLS TRAINBUD. Quality label system
INTELLIGENT ENERGY EUROPE PROGRAMME BUILD UP SKILLS TRAINBUD WP4: Deliverable 4.5 Development of voluntary qualification system Quality label system 1 INTELLIGENT ENERGY EUROPE PROGRAMME BUILD UP SKILLS
Using the CW-Net in a user defined IP network
Using the CW-Net in a user defined IP network Data transmission and device control through IP platform CW-Net Basically, CableWorld's CW-Net operates in the 10.123.13.xxx IP address range. User Defined
EEA, Eionet and Country visits. Bernt Röndell - SES
EEA, Eionet and Country visits Bernt Röndell - SES Európai Környezetvédelmi Ügynökség Küldetésünk Annak elősegítése, hogy az EU és a tagállamok a szükséges információk alapján hozhassák meg a környezet
Klaszterezés, 2. rész
Klaszterezés, 2. rész Csima Judit BME, VIK, Számítástudományi és Információelméleti Tanszék 208. április 6. Csima Judit Klaszterezés, 2. rész / 29 Hierarchikus klaszterezés egymásba ágyazott klasztereket
Abigail Norfleet James, Ph.D.
Abigail Norfleet James, Ph.D. Left side of brain develops first in girls, right in boys o Probably source of girls verbal skills o And source of boys spatial skills Pre-frontal lobes Control impulses and
Véges szavak általánosított részszó-bonyolultsága
Véges szavak általánosított részszó-bonyolultsága KÁSA Zoltán Sapientia Erdélyi Magyar Tudományegyetem Kolozsvár Marosvásárhely Csíkszereda Matematika-Informatika Tanszék, Marosvásárhely Budapest, 2010.
Probabilistic Analysis and Randomized Algorithms. Alexandre David B2-206
Probabilistic Analysis and Randomized Algorithms Alexandre David B2-206 Today Counting. Basic probability. Appendix C Introduction to randomized algorithms. Chapter 5 27-10-2006 AA1 2 Counting Rule of
A BÜKKI KARSZTVÍZSZINT ÉSZLELŐ RENDSZER KERETÉBEN GYŰJTÖTT HIDROMETEOROLÓGIAI ADATOK ELEMZÉSE
KARSZTFEJLŐDÉS XIX. Szombathely, 2014. pp. 137-146. A BÜKKI KARSZTVÍZSZINT ÉSZLELŐ RENDSZER KERETÉBEN GYŰJTÖTT HIDROMETEOROLÓGIAI ADATOK ELEMZÉSE ANALYSIS OF HYDROMETEOROLIGYCAL DATA OF BÜKK WATER LEVEL
Csatlakozás a BME eduroam hálózatához Setting up the BUTE eduroam network
Csatlakozás a BME eduroam hálózatához Setting up the BUTE eduroam network Table of Contents Windows 7... 2 Windows 8... 6 Windows Phone... 11 Android... 12 iphone... 14 Linux (Debian)... 20 Sebők Márton
MATEMATIKA ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2014. október 14. MATEMATIKA ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2014. október 14. 8:00 I. Időtartam: 45 perc Pótlapok száma Tisztázati Piszkozati EMBERI ERŐFORRÁSOK MINISZTÉRIUMA
Kvantum-informatika és kommunikáció 2015/2016 ősz. A kvantuminformatika jelölésrendszere szeptember 11.
Kvantum-informatika és kommunikáció 2015/2016 ősz A kvantuminformatika jelölésrendszere 2015. szeptember 11. Mi lehet kvantumbit? Kvantum eszközök (1) 15=5 3 Bacsárdi Képek forrása: IBM's László, Almaden
Vállalati kockázatkezelés jelentősége
www.pwc.com/hu Vállalati kockázatkezelés jelentősége Fedor Péter 2013. szeptember 19. Miről lesz szó 1. Mi is az az ERM? 2. Miért fontos? 3. Gyakorlati sajátosságok PwC Magyarország Mi is az az ERM? PwC
Tavaszi Sporttábor / Spring Sports Camp. 2016. május 27 29. (péntek vasárnap) 27 29 May 2016 (Friday Sunday)
Tavaszi Sporttábor / Spring Sports Camp 2016. május 27 29. (péntek vasárnap) 27 29 May 2016 (Friday Sunday) SZÁLLÁS / ACCOMODDATION on a Hotel Gellért*** szálloda 2 ágyas szobáiban, vagy 2x2 ágyas hostel
MATEMATIKA ANGOL NYELVEN
ÉRETTSÉGI VIZSGA MATEMATIKA ANGOL NYELVEN EMELT SZINTŰ ÍRÁSBELI VIZSGA 8:00 Az írásbeli vizsga időtartama: 240 perc Pótlapok száma Tisztázati Piszkozati OKTATÁSI ÉS KULTURÁLIS MINISZTÉRIUM Matematika angol
Új fenomén a magyar biztosítási jogban: a biztosítottak közvetlen perlési joga a viszontbiztosítóval szemben a direkt biztosító csődje esetén
Új fenomén a magyar biztosítási jogban: a biztosítottak közvetlen perlési joga a viszontbiztosítóval szemben a direkt biztosító csődje esetén Dr. Molnár István ügyvéd Berke & Molnár Ügyvédi Iroda Istvan.molnar@berkemolnarlawfirm.hu
MATEMATIKA ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2014. május 6. MATEMATIKA ANGOL NYELVEN EMELT SZINTŰ ÍRÁSBELI VIZSGA 2014. május 6. 8:00 Az írásbeli vizsga időtartama: 240 perc Pótlapok száma Tisztázati Piszkozati EMBERI ERŐFORRÁSOK
KELER KSZF Zrt. bankgarancia-befogadási kondíciói. Hatályos: 2014. július 8.
KELER KSZF Zrt. bankgarancia-befogadási kondíciói Hatályos: 2014. július 8. A KELER KSZF a nem-pénzügyi klíringtagjaitól, és az energiapiaci alklíringtagjaitól a KELER KSZF Általános Üzletszabályzata szerinti
Számítógépes Hálózatok GY 8.hét
Számítógépes Hálózatok GY 8.hét Laki Sándor ELTE-Ericsson Kommunikációs Hálózatok Laboratórium ELTE IK - Információs Rendszerek Tanszék lakis@elte.hu http://lakis.web.elte.hu Teszt 10 kérdés 10 perc canvas.elte.hu
STUDENT LOGBOOK. 1 week general practice course for the 6 th year medical students SEMMELWEIS EGYETEM. Name of the student:
STUDENT LOGBOOK 1 week general practice course for the 6 th year medical students Name of the student: Dates of the practice course: Name of the tutor: Address of the family practice: Tel: Please read
SQL/PSM kurzorok rész
SQL/PSM kurzorok --- 2.rész Tankönyv: Ullman-Widom: Adatbázisrendszerek Alapvetés Második, átdolgozott kiadás, Panem, 2009 9.3. Az SQL és a befogadó nyelv közötti felület (sormutatók) 9.4. SQL/PSM Sémában
Block cipher modes. Cryptographic Protocols (EIT ICT MSc) Dr. Levente Buttyán
Cryptographic Protocols (IT ICT MSc) Dr. Levente Buttyán associate professor BM Hálózati Rendszerek és Szolgáltatások Tanszék Lab of Cryptography and System Security (CrySyS) buttyan@hit.bme.hu, buttyan@crysys.hu
First experiences with Gd fuel assemblies in. Tamás Parkó, Botond Beliczai AER Symposium 2009.09.21 25.
First experiences with Gd fuel assemblies in the Paks NPP Tams Parkó, Botond Beliczai AER Symposium 2009.09.21 25. Introduction From 2006 we increased the heat power of our units by 8% For reaching this
A jövedelem alakulásának vizsgálata az észak-alföldi régióban az 1997-99. évi adatok alapján
A jövedelem alakulásának vizsgálata az észak-alföldi régióban az 1997-99. évi adatok alapján Rózsa Attila Debreceni Egyetem Agrártudományi Centrum, Agrárgazdasági és Vidékfejlesztési Intézet, Számviteli
Block cipher modes. - five standardized modes (operation, properties)
Security Protocols (bmevihim132) Dr. Levente Buttyán associate professor BM Híradástechnikai Tanszék Lab of Cryptography and System Security (CrySyS) buttyan@hit.bme.hu, buttyan@crysys.hu Outline - five
COOPERATION IN THE CEREAL SECTOR OF THE SOUTH PLAINS REGIONS STRÉN, BERTALAN. Keywords: cooperation, competitiveness, cereal sector, region, market.
COOPERATION IN THE CEREAL SECTOR OF THE SOUTH PLAINS REGIONS STRÉN, BERTALAN Keywords: cooperation, competitiveness, cereal sector, region, market. Using a questionnaire, we determined the nature and strength
General information for the participants of the GTG Budapest, 2017 meeting
General information for the participants of the GTG Budapest, 2017 meeting Currency is Hungarian Forint (HUF). 1 EUR 310 HUF, 1000 HUF 3.20 EUR. Climate is continental, which means cold and dry in February
Rotary District 1911 DISTRICT TÁMOGATÁS IGÉNYLŐ LAP District Grants Application Form
1 A Future Vision pilot célja a Future Vision Plan (Jövőkép terv) egyszerűsített támogatási modelljének tesztelése, és a Rotaristák részvételének növelése a segélyezési folyamatokban. A teszt során a districteknek
Néhány folyóiratkereső rendszer felsorolása és példa segítségével vázlatos bemutatása Sasvári Péter
Néhány folyóiratkereső rendszer felsorolása és példa segítségével vázlatos bemutatása Sasvári Péter DOI: http://doi.org/10.13140/rg.2.2.28994.22721 A tudományos közlemények írása minden szakma művelésének
BKI13ATEX0030/1 EK-Típus Vizsgálati Tanúsítvány/ EC-Type Examination Certificate 1. kiegészítés / Amendment 1 MSZ EN 60079-31:2014
(1) EK-TípusVizsgálati Tanúsítvány (2) A potenciálisan robbanásveszélyes környezetben történő alkalmazásra szánt berendezések, védelmi rendszerek 94/9/EK Direktíva / Equipment or Protective Systems Intended
FÖLDRAJZ ANGOL NYELVEN
Földrajz angol nyelven középszint 1112 ÉRETTSÉGI VIZSGA 2014. május 15. FÖLDRAJZ ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI ÉRETTSÉGI VIZSGA JAVÍTÁSI-ÉRTÉKELÉSI ÚTMUTATÓ EMBERI ERŐFORRÁSOK MINISZTÉRIUMA Paper
Alternating Permutations
Alternating Permutations Richard P. Stanley M.I.T. Definitions A sequence a 1, a 2,..., a k of distinct integers is alternating if a 1 > a 2 < a 3 > a 4 a 3
PIACI HIRDETMÉNY / MARKET NOTICE
PIACI HIRDETMÉNY / MARKET NOTICE HUPX Fizikai Futures (PhF) / HUPX Physical Futures (PhF) Iktatási szám / Notice #: HUPX-MN-PhF-2015-0003 Dátum / Of: 20/04/2015 Tárgy / Subject: Hatályos díjszabás és kedvezmények
EN United in diversity EN A8-0206/482. Amendment
21.3.2019 A8-0206/482 482 Recital 13 g (new) (13g) In recognition of the need for specific treatment for the transport sector, in which movement is the very essence of the work undertaken by drivers, the
A TÓGAZDASÁGI HALTERMELÉS SZERKEZETÉNEK ELEMZÉSE. SZATHMÁRI LÁSZLÓ d r.- TENK ANTAL dr. ÖSSZEFOGLALÁS
A TÓGAZDASÁGI HALTERMELÉS SZERKEZETÉNEK ELEMZÉSE SZATHMÁRI LÁSZLÓ d r.- TENK ANTAL dr. ÖSSZEFOGLALÁS A hazai tógazdasági haltermelés a 90-es évek közepén tapasztalt mélypontról elmozdult és az utóbbi három
Lexington Public Schools 146 Maple Street Lexington, Massachusetts 02420
146 Maple Street Lexington, Massachusetts 02420 Surplus Printing Equipment For Sale Key Dates/Times: Item Date Time Location Release of Bid 10/23/2014 11:00 a.m. http://lps.lexingtonma.org (under Quick
MATEMATIKA ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2016. május 3. MATEMATIKA ANGOL NYELVEN EMELT SZINTŰ ÍRÁSBELI VIZSGA 2016. május 3. 8:00 Az írásbeli vizsga időtartama: 240 perc Pótlapok száma Tisztázati Piszkozati EMBERI ERŐFORRÁSOK
MATEMATIKA ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2018. május 8. MATEMATIKA ANGOL NYELVEN EMELT SZINTŰ ÍRÁSBELI VIZSGA 2018. május 8. 8:00 Időtartam: 300 perc Pótlapok száma Tisztázati Piszkozati EMBERI ERŐFORRÁSOK MINISZTÉRIUMA Matematika
Társadalmi-gazdasági szempontok Az ipari termelési folyamatok kedvezőbbé tétele és az ipari együttműködési láncok sűrűsége pozitív társadalmi és gazdasági eredmények létrejöttéhez is hozzájárul. A társadalmi
(NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV
Kommunikációs rendszerek programozása (NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV (5. mérés) SIP telefonközpont készítése Trixbox-szal 1 Mérés helye: Széchenyi István Egyetem, L-1/7 laboratórium, 9026 Győr, Egyetem
Gyártórendszerek modellezése: MILP modell PNS feladatokhoz
Gyártórendszerek modellezése MILP modell PNS feladatokhoz 1 Pannon Egyetem M szaki Informatikai Kar Számítástudomány Alkalmazása Tanszék Utolsó frissítés: 2008. november 16. 1 hegyhati@dcs.uni-pannon.hu
MATEMATIKA ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2011. május 3. MATEMATIKA ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2011. május 3. 8:00 I. Időtartam: 45 perc Pótlapok száma Tisztázati Piszkozati NEMZETI ERŐFORRÁS MINISZTÉRIUM Matematika
THS710A, THS720A, THS730A & THS720P TekScope Reference
THS710A, THS720A, THS730A & THS720P TekScope Reference 070-9741-01 Getting Started 1 Connect probes or leads. 2 Choose SCOPE 3 or METER mode. Press AUTORANGE. Copyright Tektronix, Inc. Printed in U.S.A.
Budapest By Vince Kiado, Klösz György
Budapest 1900 2000 By Vince Kiado, Klösz György Download Ebook : budapest 1900 2000 in PDF Format. also available for mobile reader If you are looking for a book Budapest 1900-2000 by Vince Kiado;Klosz
16F628A megszakítás kezelése
16F628A megszakítás kezelése A 'megszakítás' azt jelenti, hogy a program normális, szekvenciális futása valamilyen külső hatás miatt átmenetileg felfüggesztődik, és a vezérlést egy külön rutin, a megszakításkezelő
USER MANUAL Guest user
USER MANUAL Guest user 1 Welcome in Kutatótér (Researchroom) Top menu 1. Click on it and the left side menu will pop up 2. With the slider you can make left side menu visible 3. Font side: enlarging font
Teszt topológia E1/1 E1/0 SW1 E1/0 E1/0 SW3 SW2. Kuris Ferenc - [HUN] Cisco Blog -
VTP Teszt topológia E1/1 E1/0 SW1 E1/0 E1/0 SW2 SW3 2 Alap konfiguráció SW1-2-3 conf t interface e1/0 switchport trunk encapsulation dot1q switchport mode trunk vtp domain CCIE vtp mode transparent vtp
There is/are/were/was/will be
There is/are/were/was/will be Forms - Képzése: [There + to be] [There + létige ragozott alakja] USE - HASZNÁLAT If you simply want to say that something exists or somebody is doing something then you start