Random number generation
|
|
- Etelka Nemes
- 7 évvel ezelőtt
- Látták:
Átírás
1 Security Protocols (bmevihim132) Dr. Levente Buttyán associate professor BME Hálózati Rendszerek és Szolgáltatások Tanszék Lab of Cryptography and System Security (CrySyS) Outline - motivations and definitions - attacks on an early version of the Netscape PRNG - true random sources and entropy estimation - cryptographic pseudo-random number generators (PRNGs) - general structure - attacker models - attacks on known PRNGs - the Yarrow-160 PRNG 2 1
2 Motivation random numbers (bits) are needed for various purposes, including for generating cryptographic keys (both symmetric and asymmetric) and other cryptographic parameters (e.g., unpredictable IVs, nonces, blinding parameters, etc.) random number generators used for simulation purposes are not good for cryptographic purposes example: s i+1 = (a s i + b) mod n has nice statistical properties but it is predictable weakly designed random number generators can easily destroy security even if very strong cryptographic primitives (ciphers, MACs, etc.) are used eg., early version of Netscape PRNG (to be used for SSL) 3 Early version of Netscape s PRNG RNG_CreateContext() (seconds, microseconds) = time of day; pid = process ID; ppid = parent process ID; a = mklcpr(microseconds); b = mklcpr(pid + seconds + (ppid << 12) ); seed = MD5(a, b); mklcpr(x) return((0xdeece66d*x + 0x2BBB62DC) >> 1) RNG_GenerateRandomBytes() x = MD5(seed); seed = seed+1; return x; create_key() RNG_CreateContext(); RNG_GenerateRandomBytes(); RNG_GenerateRandomBytes(); challenge = RNG_GenerateRandomBytes(); secret_key = RNG_GenerateRandomBytes(); 4 2
3 Attacking the Netscape PRNG if an attacker has an account on the UNIX machine running the browser ps command lists running processes attacker learns pid, ppid the attacker can guess the time of day with seconds precision only unknown is the value of microseconds ~2 20 possibilities each possibility can be tested easily against the challenge sent in clear within SSL if the attacker has no account on the machine running the browser a has 20 bits of randomness, b has 27 bits of randomness seed has 47 bits of randomness (compared to 128 bit advertised security) ppid is often 1, or a bit smaller than pid sendmail generates message IDs from its pid send mail to an unknown user on the attacked machine mail will bounce back with a message ID generated by sendmail attacker learns the last process ID generated on the attacked machine this may reduce possibilities for pid 5 Definitions a random number is a number that cannot be predicted by an observer before it is generated if the number is generated within the range [0, N-1], then its value cannot be predicted with any better probability than 1/N the above is true even if the observer is given all previously generated numbers a cryptographic pseudo-random number generator (PRNG) is a mechanism that processes somewhat unpredictable inputs and generates pseudo-random outputs if designed, implemented, and used properly, then even an adversary with enormous computational power should not be able to distinguish the PRNG output from a real random sequence unpredictable input samples (from physical processes) internal state pseudo-random bits indistinguishable from real random bits 6 3
4 Harvesting true random bits gathering bits unknown to and unguessable by the adversary possible sources: keystroke timings mouse movement disc access time noisy diodes or noisy resistors (quantum effects) /dev/random a UNIX device available under some systems which gathers entropy from system tables and events not available to any user even if the adversary happens to be running a process on the machine, the bits provided by /dev/random are still secret collected bits are not necessarily all independent, the adversary might even know entire subsequences of the bits what is important is that the harvested bits contain information (entropy) which is unavailable to the adversary 7 Entropy estimation determining how many unguessable bits were harvested relevant concepts: entropy: where x is a possible value in a stream of values and p x is its probability of occurrence (from an infinite population of x values not just a finite sample) entropy per source bit: where x is the size of the symbol x in bits absolute entropy: minimum entropy regardless of the symbol size: 8 4
5 Exercises for entropy estimation exercise 1: consider a source that repeatedly outputs 00 and 11 (2 bits/round) with equal probability compute H and J when x is 1 bit long (i.e. x is in {0, 1}) x is 2 bits long (i.e., x is in {00, 01, 10, 11}) x is 3 bits long x is n bits long what is the value of E for this source? exercise 2: what is the value of E for a source that produces a periodic sequence? 9 Estimating E in practice determine compression ratio achieved for the harvested bits by the best available compression algorithm this must be further reduced with the fraction of bits that an adversary might have acquired by guessing, measurement, or creating some bias in the generator process e.g., if one uses the system date and time as a source of random bits, then one can expect the adversary to know the date, and to probably know the hour, and maybe the minutes e.g., if one uses a mouse drawn signature as an entropy source, then only the noisy deviations from the usual signature count as entropy, as the adversary may know the usual signature 10 5
6 Reduction to independent bits compute a hash of the harvested bits to reduce them to independent random bits the hash function needs to have each output bit functionally dependent on all input bits and functionally independent of all other output bits in practice, cryptographic hash functions, such as SHA will do if the output size of the hash function is n, then feed it with at least n/e harvested input bits (and not much more) 11 PRNGs often, one needs more random bits than the available sources of entropy can provide one needs a PRNG that produces pseudorandom numbers (bits) from a certain amount of true randomness (seed) computationally limited adversaries will not be able to distinguish this pseudo-random sequence from a truly random sequence if the PRNG is well-designed, then computationally limited adversaries will not be able to predict the PRNG s output general structure: unpredictable (true random) input collect state generate pseudo-random output 12 6
7 Classification of attacks various ways to compromise the PRNG s state cryptanalytic attacks between receiving input samples the PRNG works as a stream cipher a cryptographic weakness in this stream cipher might be exploited to recover its internal state input based attacks known-input attacks: an attacker is able to observe (some of) the PRNG inputs chosen-input attacks: an attacker is able to control (some of) the PRNG inputs implementation attacks mishandling of seed files side-channel attacks additional information about the actual implementation of the PRNG may be exploited e.g., measuring the time needed to produce a new output may leak information about the current state of the PRNG (timing attacks) various ways to extend state compromise iterative guessing attacks figure out PRNG outputs produced after the state compromise backtracking figure out PRNG outputs produced before the state compromise 13 ANSI X9.17 state: K, seed i output generation: T i = E K (current timestamp) output i = E K (T i seed i ) seed i+1 = E K (T i output i ) seed i current timestamp E K T i E K output i E K seed i
8 Attacks on X9.17 cryptanalytic attacks it seems that they require to break the block cipher E however, this has never been proven formally weaknesses leading to state compromise extensions part of the state (K) never changes if K is compromised, then the PRNG can never fully recover seed i+1 depends on seed i only via output i if K is known from a previous state compromise and output i is observable, then finding seed i+1 is not so difficult (timestamps can usually be assumed to have only bits of entropy) 15 Attacks on X9.17 iterative guessing attack if an attacker knows K and seed i and sees (some public function f of) output i, then he can determine seed i+1 easily let f(output i ) = v try all possible values t for T i, and form a list of values v t = f(e K (t seed i )) select t* such that v t* = v seed i+1 = E K (t* E K (t* seed i )) backtracking if an attacker knows K and seed i+1 and sees (some public function f of) output i, then he can determine output i and seed i easily (EXERCISE) timer entropy issues if larger amount of random bytes are needed (e.g., RSA key pair generation), then the PRNG is called repeatedly within a very short time consecutive T i values have much less entropy than bits 16 8
9 DSA PRNG state: X i optional input: W i (W i = 0 if not supplied) output generation: output i = hash((w i + X i ) mod ) X i+1 = (X i + output i + 1) mod X i W i + hash output i 1 + X i+1 17 Attacks on the DSA PRNG cryptanalytic attacks if the hash function is good, then the PRNG output is hard to be distinguished from a real random sequence no formal proof input based attacks assume the attacker can control W i setting W i = (W i-1 output i-1 1) mod will force the PRNG to repeat its output output i = hash((w i + X i ) mod ) = = hash(((w i-1 output i-1 1) + (X i-1 + output i-1 + 1)) mod ) = = hash((w i-1 + X i-1 ) mod ) = = output i-1 this works only if input samples are sent directly into the PRNG in practice, they are often hashed before sent in 18 9
10 Attacks on the DSA PRNG a weakness that may make state compromise extensions easier X i+1 depends on W i only via output i if an attacker compromised X i and can observe output i, then he knows X i+1 no matter how much entropy has been fed into the PRNG by W i iterative guessing attack if an attacker knows X i and observes a public function f of output i, then he can find X i+1 let f(output i ) = v assume that W i has only 20 bits of entropy (e.g., it is obtained from a timestamp of microsecond precision) the attacker can try all possible values w for W i, and compute v w = f(hash((w + X i ) mod )) let w* be the value such that v = v w* X i+1 = (X i + hash((w* + X i ) mod ) + 1) mod filling the gaps if an attacker knows X i and X i+2, and observes output i+1, then he can compute output i as output i =??? (EXERCISE) 19 Some guidelines for using PRNGs use a hash function at the output to protect the PRNG from direct cryptanalytic attacks hash all inputs together with a counter or timestamp before feeding into the PRNG to make chosen-input attacks harder pay special attention to PRNG starting points and seed files to make it harder to compromise the PRNG state occasionally generate a new starting state and restart the PRNG to limit the scope of state compromise extensions 20 10
11 The Yarrow-160 PRNG design philosophy accumulate entropy from as many different sources as possible reseed (re-generate state) when enough entropy has been collected (this puts the PRNG in an unguessable state at each reseed) between reseeds, use strong crypto algorithms to generate outputs from the internal state (like a stream cipher) four major components entropy accumulator collects samples from entropy sources into two entropy pools (slow and fast pool) reseed control determines when a reseed should be performed reseed mechanism reseeds the key with new entropy from the pools generation mechanism generates PRNG output from the state 21 Entropy accumulator inputs from each source are fed alternately into two entropy pools fast pool provides frequent reseeds ensures that state compromises has as short a duration as possible slow pool rare reseeds entropy is estimated conservatively rationale: even if entropy estimation of the fast pool is inaccurate, the PRNG still eventually gets a secure reseed from the slow pool entropy estimation entropy of each sample is measured in three ways: a: programmer supplies an estimate for the entropy source b: a statistical estimator is used to estimate the entropy of the sample c: length of the sample multiplied by ½ entropy estimate of the sample is min(a, b, c) entropy contribution of a source is the sum of entropy estimates of all samples collected so far from that source entropy contribution of each source is maintained separately 22 11
12 Reseed control periodic reseed the fast pool is used to reseed when any of the sources reaches an estimated entropy contribution of 100 bits the slow pool is used to reseed when at least two sources reach an estimated entropy contribution of 160 bits explicit reseed an application may explicitly ask for a reseed operation (from both pools) should be used only when a high-valued random secret is to be generated 23 Reseed mechanism reseed from the fast pool (h is SHA1, E is 3DES): v 0 := h(fast pool) v i := h(v i-1 v 0 i) for i = 1, 2,, P t K := h (h(v Pt K), k) C := E K (0) where h is a size adaptor h (m, k) = first k bits of s 0 s 1 s 2 s 0 = m s i = h(s 0 s i-1 ) i = 1, 2, + reset all entropy estimates to 0 + clear the memory of all intermediate values reseed from the slow pool: feed h(slow pool) into fast pool reseed from fast pool as described above 24 12
13 Reseed mechanism observations new value of K directly depends on previous value of K and current pool content (pool v 0 v Pt ) if an attacker has some knowledge of the previous value of K, but does not know most of the pool content, then he cannot guess the new K if an attacker does not know the previous value of K, but observed many inputs of the pool, then he still cannot guess the new K execution time depends on security parameter P t this makes the time needed for iterative guessing attacks longer 25 Generation mechanism algorithm (E is 3DES): C := (C+1) mod 2 n R := E K (C) output: R // n is the block size of E generator gate after P g output has been generated, a new key is generated K := next k bits of PRNG output P g is a security parameter currently set to 10 rationale: if a key is compromised, then only 10 previous output can be computed by the attacker (prevention of backtracking attacks) 26 13
14 Protecting the entropy pool the pool may be swapped into swap files and stored on disk several operating systems allow to lock pages into memory mlock() (UNIX), VirtualLock() (Windows), HoldMemory() (Macintosh) memory mapped files can be used as private swap files the files should have the strictest possible access permissions file buffering should be disabled to avoid that the buffer is swapped allocated memory blocks can be scanned through by other processes entropy pool is often allocated at the beginning when the security subsystem is started pool is often at the head of allocated memory blocks the pool can be embedded in a larger allocated memory block its location can be changed periodically (by allocating new space and moving the pool) in the background this background process can also be used to prevent the pool from being swapped (touched pages are kept in memory with higher probability) 27 Summary random numbers for cryptographic purposes need special attention simple congruential generators are predictable naïve design will not do (cf. early Netscape PRNG) random sources and entropy estimation cryptographic pseudo-random number generators (PRNGs) attacker models some standardized PRNGs have weaknesses e.g., ANSI X9.17, DSA PRNG, RSAREF 2.0, vulnerable PRNGs can be made stronger by adding some simple extensions (e.g., hash all inputs before sending into the PRNG) the Yarow-160 PRNG careful design that seems to resist various attacks 28 14
15 Recommended readings Ellison. P1363 Appendix E: Cryptographic Random Numbers,1995. Kelsey, Schneier, Wagner, Hall. Cryptographic attacks on PRNGs. Workshop on Fast Software Encryption, Kelsey, Schneier, Ferguson. Yarrow-160: Notes on the design and analysis of the Yarrow cryptographic PRNG
Correlation & Linear Regression in SPSS
Petra Petrovics Correlation & Linear Regression in SPSS 4 th seminar Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Correlation
Using the CW-Net in a user defined IP network
Using the CW-Net in a user defined IP network Data transmission and device control through IP platform CW-Net Basically, CableWorld's CW-Net operates in the 10.123.13.xxx IP address range. User Defined
Correlation & Linear Regression in SPSS
Correlation & Linear Regression in SPSS Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise 1 - Correlation File / Open
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Correlation & Linear. Petra Petrovics.
Correlation & Linear Regression in SPSS Petra Petrovics PhD Student Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise
Genome 373: Hidden Markov Models I. Doug Fowler
Genome 373: Hidden Markov Models I Doug Fowler Review From Gene Prediction I transcriptional start site G open reading frame transcriptional termination site promoter 5 untranslated region 3 untranslated
Statistical Inference
Petra Petrovics Statistical Inference 1 st lecture Descriptive Statistics Inferential - it is concerned only with collecting and describing data Population - it is used when tentative conclusions about
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Nonparametric Tests
Nonparametric Tests Petra Petrovics Hypothesis Testing Parametric Tests Mean of a population Population proportion Population Standard Deviation Nonparametric Tests Test for Independence Analysis of Variance
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Hypothesis Testing. Petra Petrovics.
Hypothesis Testing Petra Petrovics PhD Student Inference from the Sample to the Population Estimation Hypothesis Testing Estimation: how can we determine the value of an unknown parameter of a population
Computer Architecture
Computer Architecture Locality-aware programming 2016. április 27. Budapest Gábor Horváth associate professor BUTE Department of Telecommunications ghorvath@hit.bme.hu Számítógép Architektúrák Horváth
Cluster Analysis. Potyó László
Cluster Analysis Potyó László What is Cluster Analysis? Cluster: a collection of data objects Similar to one another within the same cluster Dissimilar to the objects in other clusters Cluster analysis
EN United in diversity EN A8-0206/419. Amendment
22.3.2019 A8-0206/419 419 Article 2 paragraph 4 point a point i (i) the identity of the road transport operator; (i) the identity of the road transport operator by means of its intra-community tax identification
Construction of a cube given with its centre and a sideline
Transformation of a plane of projection Construction of a cube given with its centre and a sideline Exercise. Given the center O and a sideline e of a cube, where e is a vertical line. Construct the projections
Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz
Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz Kvantumkapuk, áramkörök 2016. március 3. A kvantummechanika posztulátumai (1-2) 1. Állapotleírás Zárt fizikai rendszer aktuális állapota
Block cipher modes. - five standardized modes (operation, properties)
Security Protocols (bmevihim132) Dr. Levente Buttyán associate professor BM Híradástechnikai Tanszék Lab of Cryptography and System Security (CrySyS) buttyan@hit.bme.hu, buttyan@crysys.hu Outline - five
Mapping Sequencing Reads to a Reference Genome
Mapping Sequencing Reads to a Reference Genome High Throughput Sequencing RN Example applications: Sequencing a genome (DN) Sequencing a transcriptome and gene expression studies (RN) ChIP (chromatin immunoprecipitation)
Block cipher modes. Cryptographic Protocols (EIT ICT MSc) Dr. Levente Buttyán
Cryptographic Protocols (IT ICT MSc) Dr. Levente Buttyán associate professor BM Hálózati Rendszerek és Szolgáltatások Tanszék Lab of Cryptography and System Security (CrySyS) buttyan@hit.bme.hu, buttyan@crysys.hu
FAMILY STRUCTURES THROUGH THE LIFE CYCLE
FAMILY STRUCTURES THROUGH THE LIFE CYCLE István Harcsa Judit Monostori A magyar társadalom 2012-ben: trendek és perspektívák EU összehasonlításban Budapest, 2012 november 22-23 Introduction Factors which
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Nonparametric Tests. Petra Petrovics.
Nonparametric Tests Petra Petrovics PhD Student Hypothesis Testing Parametric Tests Mean o a population Population proportion Population Standard Deviation Nonparametric Tests Test or Independence Analysis
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel Timea Farkas Click here if your download doesn"t start
Efficient symmetric key private authentication
Efficient symmetric key private authentication Cryptographic Protocols (EIT ICT MSc) Dr. Levente Buttyán Associate Professor BME Hálózati Rendszerek és Szolgáltatások Tanszék Lab of Cryptography and System
Create & validate a signature
IOTA TUTORIAL 7 Create & validate a signature v.0.0 KNBJDBIRYCUGVWMSKPVA9KOOGKKIRCBYHLMUTLGGAV9LIIPZSBGIENVBQ9NBQWXOXQSJRIRBHYJ9LCTJLISGGBRFRTTWD ABBYUVKPYFDJWTFLICYQQWQVDPCAKNVMSQERSYDPSSXPCZLVKWYKYZMREAEYZOSPWEJLHHFPYGSNSUYRZXANDNQTTLLZA
Cashback 2015 Deposit Promotion teljes szabályzat
Cashback 2015 Deposit Promotion teljes szabályzat 1. Definitions 1. Definíciók: a) Account Client s trading account or any other accounts and/or registers maintained for Számla Az ügyfél kereskedési számlája
INDEXSTRUKTÚRÁK III.
2MU05_Bitmap.pdf camü_ea INDEXSTRUKTÚRÁK III. Molina-Ullman-Widom: Adatbázisrendszerek megvalósítása Panem, 2001könyv 5.4. Bittérkép indexek fejezete alapján Oracle: Indexek a gyakorlatban Oracle Database
Proxer 7 Manager szoftver felhasználói leírás
Proxer 7 Manager szoftver felhasználói leírás A program az induláskor elkezdi keresni az eszközöket. Ha van olyan eszköz, amely virtuális billentyűzetként van beállítva, akkor azokat is kijelzi. Azokkal
Lexington Public Schools 146 Maple Street Lexington, Massachusetts 02420
146 Maple Street Lexington, Massachusetts 02420 Surplus Printing Equipment For Sale Key Dates/Times: Item Date Time Location Release of Bid 10/23/2014 11:00 a.m. http://lps.lexingtonma.org (under Quick
Cloud computing. Cloud computing. Dr. Bakonyi Péter.
Cloud computing Cloud computing Dr. Bakonyi Péter. 1/24/2011 1/24/2011 Cloud computing 2 Cloud definició A cloud vagy felhő egy platform vagy infrastruktúra Az alkalmazások és szolgáltatások végrehajtására
Széchenyi István Egyetem www.sze.hu/~herno
Oldal: 1/6 A feladat során megismerkedünk a C# és a LabVIEW összekapcsolásának egy lehetőségével, pontosabban nagyon egyszerű C#- ban írt kódból fordítunk DLL-t, amit meghívunk LabVIEW-ból. Az eljárás
(NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV
Kommunikációs rendszerek programozása (NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV (5. mérés) SIP telefonközpont készítése Trixbox-szal 1 Mérés helye: Széchenyi István Egyetem, L-1/7 laboratórium, 9026 Győr, Egyetem
Utasítások. Üzembe helyezés
HASZNÁLATI ÚTMUTATÓ Üzembe helyezés Utasítások Windows XP / Vista / Windows 7 / Windows 8 rendszerben történő telepítéshez 1 Töltse le az AORUS makróalkalmazás telepítőjét az AORUS hivatalos webhelyéről.
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében. Dicse Jenő üzletfejlesztési igazgató
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében Dicse Jenő üzletfejlesztési igazgató How to apply modern e-learning to improve the training of firefighters Jenő Dicse Director of
Lecture 11: Genetic Algorithms
Lecture 11 1 Linear and Combinatorial Optimization Lecture 11: Genetic Algorithms Genetic Algorithms - idea Genetic Algorithms - implementation and examples Lecture 11 2 Genetic algorithms Algorithm is
KN-CP50. MANUAL (p. 2) Digital compass. ANLEITUNG (s. 4) Digitaler Kompass. GEBRUIKSAANWIJZING (p. 10) Digitaal kompas
KN-CP50 MANUAL (p. ) Digital compass ANLEITUNG (s. 4) Digitaler Kompass MODE D EMPLOI (p. 7) Boussole numérique GEBRUIKSAANWIJZING (p. 0) Digitaal kompas MANUALE (p. ) Bussola digitale MANUAL DE USO (p.
Cloud computing Dr. Bakonyi Péter.
Cloud computing Dr. Bakonyi Péter. 1/24/2011 Cloud computing 1/24/2011 Cloud computing 2 Cloud definició A cloud vagy felhő egy platform vagy infrastruktúra Az alkalmazások és szolgáltatások végrehajtására
On The Number Of Slim Semimodular Lattices
On The Number Of Slim Semimodular Lattices Gábor Czédli, Tamás Dékány, László Ozsvárt, Nóra Szakács, Balázs Udvari Bolyai Institute, University of Szeged Conference on Universal Algebra and Lattice Theory
A jövedelem alakulásának vizsgálata az észak-alföldi régióban az 1997-99. évi adatok alapján
A jövedelem alakulásának vizsgálata az észak-alföldi régióban az 1997-99. évi adatok alapján Rózsa Attila Debreceni Egyetem Agrártudományi Centrum, Agrárgazdasági és Vidékfejlesztési Intézet, Számviteli
Kvantum-informatika és kommunikáció 2015/2016 ősz. A kvantuminformatika jelölésrendszere szeptember 11.
Kvantum-informatika és kommunikáció 2015/2016 ősz A kvantuminformatika jelölésrendszere 2015. szeptember 11. Mi lehet kvantumbit? Kvantum eszközök (1) 15=5 3 Bacsárdi Képek forrása: IBM's László, Almaden
Phenotype. Genotype. It is like any other experiment! What is a bioinformatics experiment? Remember the Goal. Infectious Disease Paradigm
It is like any other experiment! What is a bioinformatics experiment? You need to know your data/input sources You need to understand your methods and their assumptions You need a plan to get from point
Operációs rendszerek Memóriakezelés 1.1
Operációs rendszerek Memóriakezelés 1.1 Pere László (pipas@linux.pte.hu) PÉCSI TUDOMÁNYEGYETEM TERMÉSZETTUDOMÁNYI KAR INFORMATIKA ÉS ÁLTALÁNOS TECHNIKA TANSZÉK Operációs rendszerek p. A memóriakezelő A
2. Local communities involved in landscape architecture in Óbuda
Év Tájépítésze pályázat - Wallner Krisztina 2. Közösségi tervezés Óbudán Óbuda jelmondata: Közösséget építünk, ennek megfelelően a formálódó helyi közösségeket bevonva fejlesztik a közterületeket. Békásmegyer-Ófaluban
Néhány folyóiratkereső rendszer felsorolása és példa segítségével vázlatos bemutatása Sasvári Péter
Néhány folyóiratkereső rendszer felsorolása és példa segítségével vázlatos bemutatása Sasvári Péter DOI: http://doi.org/10.13140/rg.2.2.28994.22721 A tudományos közlemények írása minden szakma művelésének
T Á J É K O Z T A T Ó. A 1108INT számú nyomtatvány a http://www.nav.gov.hu webcímen a Letöltések Nyomtatványkitöltő programok fülön érhető el.
T Á J É K O Z T A T Ó A 1108INT számú nyomtatvány a http://www.nav.gov.hu webcímen a Letöltések Nyomtatványkitöltő programok fülön érhető el. A Nyomtatványkitöltő programok fület választva a megjelenő
4-42 ELECTRONICS WX210 - WX240
4-42 ELECTRONICS WX210 - WX240 PCS 40000499-en Fig. 8 WX210 - WX240 ELECTRONICS 4-43 PCS COMPONENTS 40000471-en Load-limit regulator Legend Fig. 1 Fig. 2 1 Power supply 2 PWM1 output, proportional valve
± ± ± ƒ ± ± ± ± ± ± ± ƒ. ± ± ƒ ± ± ± ± ƒ. ± ± ± ± ƒ
± ± ± ± ƒ ± ± ± ƒ ± ± ƒ ± ç å ± ƒ ± ± ± ± ± ± ± ± ± ± ± ƒ ± ± ± ä ± ± ± ± ƒ ± ± ± ± ƒ ± ± ± ± ƒ ± ± ± ± ƒ ± ± ± ± ± ± ± ± ± ± ± ± ± ± ƒ ± ± ± ± ± ƒ ± ± ± ± ƒ ± ± ± ƒ ± ± ƒ ± ± ± ± ± ± ± ± ± ± ± ± ± ±
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Factor Analysis
Factor Analysis Factor analysis is a multiple statistical method, which analyzes the correlation relation between data, and it is for data reduction, dimension reduction and to explore the structure. Aim
Csatlakozás a BME eduroam hálózatához Setting up the BUTE eduroam network
Csatlakozás a BME eduroam hálózatához Setting up the BUTE eduroam network Table of Contents Windows 7... 2 Windows 8... 6 Windows Phone... 11 Android... 12 iphone... 14 Linux (Debian)... 20 Sebők Márton
discosnp demo - Peterlongo Pierre 1 DISCOSNP++: Live demo
discosnp demo - Peterlongo Pierre 1 DISCOSNP++: Live demo Download and install discosnp demo - Peterlongo Pierre 3 Download web page: github.com/gatb/discosnp Chose latest release (2.2.10 today) discosnp
Performance Modeling of Intelligent Car Parking Systems
Performance Modeling of Intelligent Car Parking Systems Károly Farkas Gábor Horváth András Mészáros Miklós Telek Technical University of Budapest, Hungary EPEW 2014, Florence, Italy Outline Intelligent
STUDENT LOGBOOK. 1 week general practice course for the 6 th year medical students SEMMELWEIS EGYETEM. Name of the student:
STUDENT LOGBOOK 1 week general practice course for the 6 th year medical students Name of the student: Dates of the practice course: Name of the tutor: Address of the family practice: Tel: Please read
3. MINTAFELADATSOR KÖZÉPSZINT. Az írásbeli vizsga időtartama: 30 perc. III. Hallott szöveg értése
Oktatáskutató és Fejlesztő Intézet TÁMOP-3.1.1-11/1-2012-0001 XXI. századi közoktatás (fejlesztés, koordináció) II. szakasz ANGOL NYELV 3. MINTAFELADATSOR KÖZÉPSZINT Az írásbeli vizsga időtartama: 30 perc
1. Gyakorlat: Telepítés: Windows Server 2008 R2 Enterprise, Core, Windows 7
1. Gyakorlat: Telepítés: Windows Server 2008 R2 Enterprise, Core, Windows 7 1.1. Új virtuális gép és Windows Server 2008 R2 Enterprise alap lemez létrehozása 1.2. A differenciális lemezek és a két új virtuális
7 th Iron Smelting Symposium 2010, Holland
7 th Iron Smelting Symposium 2010, Holland Október 13-17 között került megrendezésre a Hollandiai Alphen aan den Rijn városában található Archeon Skanzenben a 7. Vasolvasztó Szimpózium. Az öt napos rendezvényen
Tavaszi Sporttábor / Spring Sports Camp. 2016. május 27 29. (péntek vasárnap) 27 29 May 2016 (Friday Sunday)
Tavaszi Sporttábor / Spring Sports Camp 2016. május 27 29. (péntek vasárnap) 27 29 May 2016 (Friday Sunday) SZÁLLÁS / ACCOMODDATION on a Hotel Gellért*** szálloda 2 ágyas szobáiban, vagy 2x2 ágyas hostel
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY A feladatsor három részbol áll 1. A vizsgáztató társalgást kezdeményez a vizsgázóval. 2. A vizsgázó egy szituációs feladatban vesz részt a
Utolsó frissítés / Last update: február Szerkesztő / Editor: Csatlós Árpádné
Utolsó frissítés / Last update: 2016. február Szerkesztő / Editor: Csatlós Árpádné TARTALOM / Contents BEVEZETŐ / Introduction... 2 FELNŐTT TAGBÉLYEGEK / Adult membership stamps... 3 IFJÚSÁGI TAGBÉLYEGEK
16F628A megszakítás kezelése
16F628A megszakítás kezelése A 'megszakítás' azt jelenti, hogy a program normális, szekvenciális futása valamilyen külső hatás miatt átmenetileg felfüggesztődik, és a vezérlést egy külön rutin, a megszakításkezelő
Rezgésdiagnosztika. Diagnosztika 02 --- 1
Rezgésdiagnosztika Diagnosztika 02 --- 1 Diagnosztika 02 --- 2 A rezgéskép elemzésével kimutatható gépészeti problémák Minden gép, mely tartalmaz forgó részt (pl. motor, generátor, szivattyú, ventilátor,
A vitorlázás versenyszabályai a 2013-2016. évekre angol-magyar nyelvű kiadásának változási és hibajegyzéke
A vitorlázás versenyszabályai a 2013-2016. évekre angol-magyar nyelvű kiadásának változási és hibajegyzéke A dokumentum A vitorlázás versenyszabályai a 2013-2016. évekre angol-magyar nyelvű kiadásában
Statistical Dependence
Statistical Dependence Petra Petrovics Statistical Dependence Deinition: Statistical dependence exists when the value o some variable is dependent upon or aected by the value o some other variable. Independent
Lopocsi Istvánné MINTA DOLGOZATOK FELTÉTELES MONDATOK. (1 st, 2 nd, 3 rd CONDITIONAL) + ANSWER KEY PRESENT PERFECT + ANSWER KEY
Lopocsi Istvánné MINTA DOLGOZATOK FELTÉTELES MONDATOK (1 st, 2 nd, 3 rd CONDITIONAL) + ANSWER KEY PRESENT PERFECT + ANSWER KEY FELTÉTELES MONDATOK 1 st, 2 nd, 3 rd CONDITIONAL I. A) Egészítsd ki a mondatokat!
Ültetési és öntözési javaslatok. Planting and watering instructions
Ültetési és öntözési javaslatok Planting and watering instructions 1 Önöntöző-rendszer Sub-irrigation 2 Kedves növénykedvelő A LECHUZA önöntöző rendszerrel növényeink természetüknél fogva gyönyörű virágokat
Teszt topológia E1/1 E1/0 SW1 E1/0 E1/0 SW3 SW2. Kuris Ferenc - [HUN] Cisco Blog -
VTP Teszt topológia E1/1 E1/0 SW1 E1/0 E1/0 SW2 SW3 2 Alap konfiguráció SW1-2-3 conf t interface e1/0 switchport trunk encapsulation dot1q switchport mode trunk vtp domain CCIE vtp mode transparent vtp
Descriptive Statistics
Descriptive Statistics Petra Petrovics DESCRIPTIVE STATISTICS Definition: Descriptive statistics is concerned only with collecting and describing data Methods: - statistical tables and graphs - descriptive
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2008. május 26. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2008. május 26. 8:00 Az írásbeli vizsga időtartama: 180 perc Pótlapok száma Tisztázati Piszkozati OKTATÁSI
Expansion of Red Deer and afforestation in Hungary
Expansion of Red Deer and afforestation in Hungary László Szemethy, Róbert Lehoczki, Krisztián Katona, Norbert Bleier, Sándor Csányi www.vmi.szie.hu Background and importance large herbivores are overpopulated
GEOGRAPHICAL ECONOMICS B
GEOGRAPHICAL ECONOMICS B ELTE Faculty of Social Sciences, Department of Economics Geographical Economics "B" KRUGMAN (1991) MODEL: EXTENSIONS Authors: Gábor Békés, Sarolta Rózsás Supervised by Gábor
ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP
ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP CHILD S DATA / GYERMEK ADATAI PLEASE FILL IN THIS INFORMATION WITH DATA BASED ON OFFICIAL DOCUMENTS / KÉRJÜK, TÖLTSE KI A HIVATALOS DOKUMENTUMOKBAN SZEREPLŐ ADATOK
Csima Judit április 9.
Osztályozókról még pár dolog Csima Judit BME, VIK, Számítástudományi és Információelméleti Tanszék 2018. április 9. Csima Judit Osztályozókról még pár dolog 1 / 19 SVM (support vector machine) ez is egy
USER MANUAL Guest user
USER MANUAL Guest user 1 Welcome in Kutatótér (Researchroom) Top menu 1. Click on it and the left side menu will pop up 2. With the slider you can make left side menu visible 3. Font side: enlarging font
1. MINTAFELADATSOR KÖZÉPSZINT. Az írásbeli vizsga időtartama: 30 perc. III. Hallott szöveg értése
Oktatáskutató és Fejlesztő Intézet TÁMOP-3.1.1-11/1-2012-0001 XXI. századi közoktatás (fejlesztés, koordináció) II. szakasz ANGOL NYELV 1. MINTAFELADATSOR KÖZÉPSZINT Az írásbeli vizsga időtartama: 30 perc
EN United in diversity EN A8-0206/473. Amendment
21.3.2019 A8-0206/473 473 Recital 12 d (new) (12d) Since there is no sufficient link of a driver with a territory of a Member State of transit, transit operations should not be considered as posting situations.
Az Open Data jogi háttere. Dr. Telek Eszter
Az Open Data jogi háttere Dr. Telek Eszter Egy kis ismétlés Open Data/Open Access/Open Knowledge gyökerei Open Source Software FLOSS (Free Libre Open Source Software) Szoftver esetében egyszerű alapok:
Tudományos Ismeretterjesztő Társulat
Sample letter number 3. Russell Ltd. 57b Great Hawthorne Industrial Estate Hull East Yorkshire HU 19 5BV 14 Bebek u. Budapest H-1105 10 December, 2009 Ref.: complaint Dear Sir/Madam, After seeing your
A BÜKKI KARSZTVÍZSZINT ÉSZLELŐ RENDSZER KERETÉBEN GYŰJTÖTT HIDROMETEOROLÓGIAI ADATOK ELEMZÉSE
KARSZTFEJLŐDÉS XIX. Szombathely, 2014. pp. 137-146. A BÜKKI KARSZTVÍZSZINT ÉSZLELŐ RENDSZER KERETÉBEN GYŰJTÖTT HIDROMETEOROLÓGIAI ADATOK ELEMZÉSE ANALYSIS OF HYDROMETEOROLIGYCAL DATA OF BÜKK WATER LEVEL
Nemzetközi Kenguru Matematikatábor
Nemzetközi Kenguru Matematikatábor 2011. augusztus 19-27., Werbellinsee, Németország BESZÁMOLÓ Bevezető Idén hetedik alkalommal került megrendezére a Nemzetközi Kenguru Matematikatábor (7. Internationale
EBBEN A VIZSGARÉSZBEN A VIZSGAFELADAT ARÁNYA
Az Országos Képzési Jegyzékről és az Országos Képzési Jegyzékbe történő felvétel és törlés eljárási rendjéről szóló 133/2010. (IV. 22.) Korm. rendelet alapján. Szakképesítés, szakképesítés-elágazás, rész-szakképesítés,
INTELLIGENT ENERGY EUROPE PROGRAMME BUILD UP SKILLS TRAINBUD. Quality label system
INTELLIGENT ENERGY EUROPE PROGRAMME BUILD UP SKILLS TRAINBUD WP4: Deliverable 4.5 Development of voluntary qualification system Quality label system 1 INTELLIGENT ENERGY EUROPE PROGRAMME BUILD UP SKILLS
(Asking for permission) (-hatok/-hetek?; Szabad ni? Lehet ni?) Az engedélykérés kifejezésére a következő segédigéket használhatjuk: vagy vagy vagy
(Asking for permission) (-hatok/-hetek?; Szabad ni? Lehet ni?) SEGÉDIGÉKKEL Az engedélykérés kifejezésére a következő segédigéket használhatjuk: vagy vagy vagy A fenti felsorolásban a magabiztosság/félénkség
HAMBURG Használati útmutató Vezérlőmodul UKSM 24VDC Cikkszám: 260.033
HABURG Használati útmutató Vezérlőmodul UKS 24VDC Cikkszám: 260.033 Brandschutz-Technik und Rauchabzug GmbH Schnackenburgallee 41d D-22525 Hamburg Germany +49 40 89 71 20-0 Fax: +49 40 89 71 20-20 Internet:
Minta ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA II. Minta VIZSGÁZTATÓI PÉLDÁNY
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA II. A feladatsor három részből áll VIZSGÁZTATÓI PÉLDÁNY 1. A vizsgáztató társalgást kezdeményez a vizsgázóval. 2. A vizsgázó egy szituációs feladatban vesz részt a
Searching in an Unsorted Database
Searching in an Unsorted Database "Man - a being in search of meaning." Plato History of data base searching v1 2018.04.20. 2 History of data base searching v2 2018.04.20. 3 History of data base searching
ios alkalmazásfejlesztés Koltai Róbert
ios alkalmazásfejlesztés Koltai Róbert robert.koltai@ponte.hu Mi az a block? Utasítások sorozata { }-ek között, amit egy objektumként tuduk kezelni. ios 4.0 és Mac OSX 10.6 óta 2 Egy példa a felépítésére
Üzleti élet Nyitás. Nagyon hivatalos, a címzettnek meghatározott rangja van, aminek szerepelnie kell
- Nyitás angol magyar Dear Mr. President, Tisztelt Elnök Úr! Nagyon hivatalos, a címzettnek meghatározott rangja van, aminek szerepelnie kell Dear Sir, Hivatalos, férfi címzett, ismeretlen név Dear Madam,
István Micsinai Csaba Molnár: Analysing Parliamentary Data in Hungarian
István Micsinai Csaba Molnár: Analysing Parliamentary Data in Hungarian The Hungarian Comparative Agendas Project Participant of international Comparative Agendas Project Datasets on: Laws (1949-2014)
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2012. május 25. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2012. május 25. 8:00 Az írásbeli vizsga időtartama: 180 perc Pótlapok száma Tisztázati Piszkozati NEMZETI
Üzleti élet Nyitás. Nagyon hivatalos, a címzettnek meghatározott rangja van, aminek szerepelnie kell
- Nyitás magyar angol Tisztelt Elnök Úr! Dear Mr. President, Nagyon hivatalos, a címzettnek meghatározott rangja van, aminek szerepelnie kell Tisztelt Uram! Hivatalos, férfi címzett, ismeretlen név Tisztelt
Eladni könnyedén? Oracle Sales Cloud. Horváth Tünde Principal Sales Consultant 2014. március 23.
Eladni könnyedén? Oracle Sales Cloud Horváth Tünde Principal Sales Consultant 2014. március 23. Oracle Confidential Internal/Restricted/Highly Restricted Safe Harbor Statement The following is intended
Bevezetés a kvantum-informatikába és kommunikációba 2016/2017 tavasz
Bevezetés a kvantum-informatikába és kommunikációba 2016/2017 tavasz Kvantumkapuk, áramkörök 2017. február 23. A kvantummechanika Posztulátumai, avagy, ahogy az apró dolgok működnek 1. Posztulátum: kvantum
Utolsó frissítés / Last update: Szeptember / September Szerkesztő / Editor: Csatlós Árpádné
Utolsó frissítés / Last update: 2018. Szeptember / September Szerkesztő / Editor: Csatlós Árpádné TARTALOM / Contents BEVEZETŐ / Introduction... 2 FELNŐTT TAGBÉLYEGEK / Adult membership stamps... 3 IFJÚSÁGI
ANGOL NYELVI SZINTFELMÉRŐ 2013 A CSOPORT. on of for from in by with up to at
ANGOL NYELVI SZINTFELMÉRŐ 2013 A CSOPORT A feladatok megoldására 45 perc áll rendelkezésedre, melyből körülbelül 10-15 percet érdemes a levélírási feladatra szánnod. Sok sikert! 1. Válaszd ki a helyes
MINO V2 ÁLLVÁNY CSERÉJE V4-RE
MINO V2 remote controlled MINO V2 ÁLLVÁNY CSERÉJE V4-RE Mino V3 circuit board replacement Mino V2-V4 csere készlet ezüst Art# 59348S, Mino V2-V4 csere készlet fehér Art# 59348W V4 áramköri lap Art# 75914
Új funkciók az RBP-ben 2015. október 1-től New functions in RBP from 1 October 2015. Tatár Balázs
Új funkciók az RBP-ben 2015. október 1-től New functions in RBP from 1 October 2015 Tatár Balázs Üzletfejlesztés vezető / Business Development Manager Rendszerhasználói Tájékoztató Nap, 2015. szeptember
Választási modellek 3
Választási modellek 3 Prileszky István Doktori Iskola 2018 http://www.sze.hu/~prile Forrás: A Self Instructing Course in Mode Choice Modeling: Multinomial and Nested Logit Models Prepared For U.S. Department
MTAT Cryptology II. Oblivious Transfer. Sven Laur University of Tartu
MTAT.07.003 Cryptology II Oblivious Transfer Sven Laur University of Tartu Ideal implementation b x 0, x 1 b x 0, x 1 x b Ideal ( 2 1) -OT The protocol is always carried out between a client P 1 and a
Decision where Process Based OpRisk Management. made the difference. Norbert Kozma Head of Operational Risk Control. Erste Bank Hungary
Decision where Process Based OpRisk Management made the difference Norbert Kozma Head of Operational Risk Control Erste Bank Hungary About Erste Group 2010. 09. 30. 2 Erste Bank Hungary Erste Group entered
Számítógéppel irányított rendszerek elmélete. Gyakorlat - Mintavételezés, DT-LTI rendszermodellek
Számítógéppel irányított rendszerek elmélete Gyakorlat - Mintavételezés, DT-LTI rendszermodellek Hangos Katalin Villamosmérnöki és Információs Rendszerek Tanszék e-mail: hangos.katalin@virt.uni-pannon.hu
Sebastián Sáez Senior Trade Economist INTERNATIONAL TRADE DEPARTMENT WORLD BANK
Sebastián Sáez Senior Trade Economist INTERNATIONAL TRADE DEPARTMENT WORLD BANK Despite enormous challenges many developing countries are service exporters Besides traditional activities such as tourism;
Pletykaalapú gépi tanulás teljesen elosztott környezetben
Pletykaalapú gépi tanulás teljesen elosztott környezetben Hegedűs István Jelasity Márk témavezető Szegedi Tudományegyetem MTA-SZTE Mesterséges Intelligencia Kutatócsopot Motiváció Az adat adatközpontokban
Tudok köszönni tegezve és önözve, és el tudok búcsúzni. I can greet people in formal and informal ways. I can also say goodbye to them.
Mérleg Your checklist Az alábbiakban a MagyarOK 1. tankönyv témáinak listáját találja. A mondatok mellett a kapcsolódó oldalak és gyakorlatok számát is megadtuk, hogy megkönnyítsük az ismétlést. This document
TestLine - Angol teszt Minta feladatsor
Minta felaatsor venég Téma: Általános szintfelmérő Aláírás:... Dátum: 2016.05.29 08:18:49 Kérések száma: 25 kérés Kitöltési iő: 1:17:27 Nehézség: Összetett Pont egység: +6-2 Értékelés: Alaértelmezett értékelés
Website review acci.hu
Website review acci.hu Generated on September 30 2016 21:54 PM The score is 37/100 SEO Content Title Acci.hu - Ingyenes apróhirdető Length : 30 Perfect, your title contains between 10 and 70 characters.