A Generalization of Cobham s Theorem to Automata over Real Numbers
|
|
- Hanna Fülöp
- 6 évvel ezelőtt
- Látták:
Átírás
1 ÒØÖ Ö Ò Î Ö Ø ÓÒ Ì Ò Ð Ê ÔÓÖØ ÒÙÑ Ö ¾¼¼ º Ò Ö Ð Þ Ø ÓÒ Ó Ó Ñ³ Ì ÓÖ Ñ ØÓ ÙØÓÑ Ø ÓÚ Ö Ê Ð ÆÙÑ Ö ÖÒ Ö Ó ÐÓØ ÂÙÐ Ò ÖÙ Ø Ò Ì ÛÓÖ Û Ô ÖØ ÐÐÝ ÙÔÔÓÖØ Ý Ê Ö ÒØ ¾º ¼º¼¾ ØØÔ»»ÛÛÛºÙÐ º º»»» Ú
2 A Generalization of Cobham s Theorem to Automata over Real Numbers Bernard Boigelot and Julien Brusten Institut Montefiore, B28 Université de Liège B-4000 Liège, Belgium {boigelot,brusten}@montefiore.ulg.ac.be Abstract. This paper studies the expressive power of finite-state automata recognizing sets of real numbers encoded positionally. It is known that the sets that are definable in the first-order additive theory of real and integer variables R, Z, +, < can all be recognized by weak deterministic Büchi automata, regardless of the encoding base r > 1. In this paper, we prove the reciprocal property, i.e., that a subset of R that is recognizable by weak deterministic automata in every base r > 1 is necessarily definable in R, Z, +, <. This result generalizes to real numbers the well-known Cobham s theorem on the finite-state recognizability of sets of integers. Our proof gives interesting insight into the internal structure of automata recognizing sets of real numbers, which may lead to efficient data structures for handling these sets. 1 Introduction The verification of infinite-state systems, in particular the reachability analysis of systems modeled as finite-state machines extended with unbounded variables, has prompted the development of symbolic data structures for representing the sets of values that have to be handled during state-space exploration [Boi98]. A simple representation strategy consists in using finite-state automata: The values in the considered domain are encoded as words over a given finite alphabet; a set of values is thus encoded as a language. If this language is regular, then a finite-state automaton that accepts it forms a representation of the set [WB98]. This approach has many advantages: Regular languages are closed under all usual set-theory operators (intersection, union, complement, Cartesian product, projection,...), and automata are easy to manipulate algorithmically. Deterministic automata can also be reduced to a canonical form, which simplifies comparison operations between sets. The expressive power of automata is also well suited for verification applications. In the case of programs manipulating unbounded integer variables, it is known for a long time that the sets of integers that can be recognized by Research fellow ( aspirant ) of the Belgian Fund for Scientific Research (F.R.S.- FNRS).
3 a finite-state automaton using the positional encoding of numbers in a base r > 1 correspond to those definable in an extension of Presburger arithmetic, i.e., the first-order additive theory of the integers Z, +, < [Büc62]. Furthermore, the well known Cobham s theorem characterizes the sets that are representable by automata in all bases r > 1 as being exactly those that are Presburgerdefinable [Cob69,BHMV94]. In order to analyze systems relying on integer and real variables, such as timed or hybrid automata, automata-based representations of numbers can be generalized to real values [BBR97]. From a theoretical point of view, this amounts to moving from finite-word to infinite-word automata, which is not problematic. It has been shown that the sets of reals that can be recognized by infinite-word automata in a given encoding base are those definable in an extension of the first-order additive theory of real and integers variables R, Z,+,< [BRW98]. In practice though, handling infinite-word automata can be difficult, especially if set complementation needs to be performed. It is however known that, for representing the sets definable in R, Z,+,<, the full expressive power of Büchi automata is not required, and that the much simpler subclass of weak deterministic automata is sufficient [BJW05]. The advantage is that, from an algorithmic perspective, handling weak automata is similar to manipulating finite-word automata. A natural question is then to characterize precisely the expressive power of weak deterministic automata representing sets of real numbers. For a given encoding base r > 1, it is known that the representable sets form a base-dependent extension of R, Z,+,<. This covers, in particular, all the sets definable in R, Z,+,<, P r, where P r is a predicate that checks whether its argument is a power of r [Bru06]. This paper is aimed at characterizing the subsets of R that can be represented as weak deterministic automata in multiple bases. Our central result is to show that, for two relatively prime bases r 1 and r 2, the sets that are simultaneously recognizable in bases r 1 and r 2 can be defined in R, Z,+,<. As a corollary, such sets are then representable in any base r > 1. The intuition behind our proof is the following. First, we reduce the problem to characterizing the representable subsets of [0, 1]. We then introduce the notion of interval boundary points, as points with special topological properties, and establish that a set representable in multiple bases can only contain finitely many such points. Finally, we show that this property implies that S is definable in R, Z,+,<. The argument used for this last step provides a description of the internal structure of automata representing sets definable in R, Z, +, <. This result may help to develop efficient data structures for handling such sets. 2 Representing Sets of Numbers with Automata In this section, we briefly present the automata-based representations of sets of integer and real values. 2
4 2.1 Number Decision Diagrams Let r > 1 be an integer base. A natural number x N can be encoded positionally in base r by finite words b p 1 b p 2...b 1 b 0 over the alphabet Σ r = {0,1,...,r 1}, such that x = p 1 i=0 b ir i. Negative values are encoded by their r s-complement, i.e., the encodings of x Z with x < 0 are formed by the last p digits of the encodings of r p + x. The length p of the encodings of a number x Z is not fixed, but must be non-zero and large enough for r p 1 x < r p 1 to hold. As a consequence, the most significant digit of encodings, called the sign digit, is equal to r 1 for strictly negative numbers, and to 0 for positive numbers. This encoding scheme maps a subset S of Z onto a language over Σ r. If the language containing all the encodings of the elements of S is regular, then a finitestate automaton that accepts it is called a Number Decision Diagram (NDD), and is said to represent, or recognize, the set S. NDDs can be generalized to representing subsets of Z n, i.e., sets of vectors, for any n > 0 [Büc62,WB95,Boi98]. It has been shown [Büc62,Vil92,BHMV94] that the subsets of Z recognizable by NDDs in a base r > 1 are exactly those that can be defined in the first-order theory Z,+,<, V r where V r (x) is the function mapping an integer x > 0 to the greatest power of r dividing it. Moreover, the sets that are recognizable by NDDs in every base r > 1 have been characterized by Cobham [Cob69] as being exactly those that are definable in Z, +, <, i.e., Presburger arithmetic. This result has been extended to subsets of Z n by Semenov [Sem77]. Computing the intersection, union, complementation, difference and Cartesian product of sets represented by NDDs reduces to performing the corresponding operations on the languages accepted by the automata. Projection is more tricky, as the resulting automaton has to be completed in order to accept all the encodings of the vectors it recognizes. Finally, since NDDs are finite-word automata, they can be determinized, as well as minimized into a canonical form. 2.2 Real Number Automata Real numbers can also be encoded positionally. Let r > 1 be a base. An encoding w of a number x R is an infinite word w I w F over Σ r { }, where w I Σ r encodes the integer part x I Z of x, and w F Σ ω r its fractional part x F [0,1], i.e., we have w F = b 1 b 2 b 3... with x F = Σ i>0 b i r i. Note that some numbers have two distinct encodings with the same integer-part length. For example, in base 10, the number 11/2 has the encodings ω and ω. Such encodings are said to be dual. We denote by Λ r the set of valid prefixes of base-r encodings that include a separator, i.e., Λ r = {0,r 1} Σ r Σ r. Similarly to the case of integers, the base-r encoding scheme transforms a set S R into a language L(S) Λ r Σ ω r. A Real Number Automaton (RNA) is defined as a Büchi automaton that accepts the language containing all the base-r encodings of the elements of S. This representation can be generalized into Real Vector Automata (RVA), suited for subsets of R n (n > 0) [BBR97]. The expressiveness of RVA (and RNA) has been studied [BRW98]: The subsets of R n that are representable in a base r > 1 are exactly those that are 3
5 definable in the first-order theory R, Z,+,<, X r, where X r (x,u, k) is a basedependent predicate that is true iff u is an integer power of r, and there exists an encoding of x in which the digit at the position specified by u is equal to k. The predicate X r can alternatively be replaced by a function V r analogous to the one defined in the integer case [Bru06]: We say that x R divides y R iff there exists an integer k such that kx = y. The function V r is then defined such that V r (x) returns the greatest power of r dividing x, if it exists, and 1 otherwise. 2.3 Weak Deterministic RNA As in the case of integers, applying most set-theory operators to RNA (or RVA) reduces to carrying out the same operations on their accepted language. This is somehow problematic, since operations like set complementation are typically costly and tricky to implement on infinite-word automata [KV05]. In order to alleviate this problem, it has been shown that the full expressive power of Büchi automata is not needed for representing the subsets of R n (n 0), that are definable in the first-order additive theory R, Z,+,< of mixed integer and real variables [BJW05]. Such sets can indeed be represented by weak deterministic RVA, i.e., deterministic RVA such that their set of states can be partitioned into disjoint subsets Q 1,...,Q m, where each Q i contains only either accepting or non-accepting states, and there exists a partial order on the sets Q 1,...,Q m such that for every transition (q, a, q ) of the automaton, with q Q i and q Q j, we have Q j Q i. As remarked in [Wil93], weak deterministic automata are infinite-word automata that can be manipulated essentially in the same way as finite-word ones. There exist efficient algorithms for applying to weak deterministic RVA all classical set-theory operators (intersection, union, complement, Cartesian product, projection,...) [BJW05]. Furthermore, such RVA can be minimized into a canonical form. It is worth mentioning that expressiveness of weak deterministic RVA is clearly not limited to the sets that are definable in the first-order additive theory of the integers and reals. For instance, the set of (negative and positive) integer powers of the representation base is clearly recognizable. Let r > 1 be a base, and P r (x) be a predicate that holds iff x is an integer power of r. It has been shown, using a quantifier elimination result for R,1,+,,P r [vdd85,ay07], that all the sets definable in R, Z,+,<, P r can also be represented by weak deterministic RVA in base r [Bru06]. 3 Problem Reduction Let S R be a set recognizable by a weak deterministic RNA A 1, assumed to be in canonical form, in a base r > 1. Each accepting path of A contains exactly one occurrence of the separator symbol. Each transition labeled by thus links two distinct strongly connected components of A. Since there are only finitely 4
6 many such transitions, the language L accepted by A is of the form i LI i LF i, where the union is finite, and for all i, L I i Σ r encodes the integer part, and L F i Σr ω the fractional part, of the encodings of numbers x S. More precisely, for every i, let Si I Z denote the set encoded by LI i and let SF i [0,1] denote the set encoded by 0 + L F i. We have S = i (SI i + SF i ). Note that each LI i is recognizable by a NDD in base r and that, similarly, each language of the form 0 + L F i is recognizable by a RNA (except for the dual encodings of 0 and 1, which can be explicitly added to the language if needed). The decomposition of S into sets Si I and Si F of integer and fractional parts does not depend on the representation base. Therefore, if S is recognizable in two relatively prime bases r 1 and r 2, then so are Si I and Si F for every i. From Cobham s theorem, each Si I must then be definable in Z,+,<. In order to show that S is definable in R, Z,+,<, it is hence sufficient to prove that each Si F is definable in that theory. We have thus reduced the problem of characterizing the subsets of R that are simultaneously recognizable in two relatively prime bases to the same problem over the subsets of [0,1]. 4 Interval Boundary Points We now consider a set S [0,1] represented by a weak deterministic RNA A. We define the interval boundary points of S as points with specific topological properties, and establish a relation between the existence of such points and some structures in the transition graph of A. 4.1 Definitions A neighborhood N ε (x) of a point x R, with ε > 0, is the set N ε (x) = {y x y < ε}. A point x R is a boundary point of S iff all its neighborhoods contain points from S as well as from its complement S, i.e., ε > 0 : N ε (x) S N ε (x) S. A left neighborhood N < ε (x) of a point x R, with ε > 0, is the set N < ε (x) = {y x ε < y < x}. Similarly, a right neighborhood N > ε (x) of x is defined as N > ε (x) = {y x < y < x+ε}. A boundary point x of S is a left interval boundary point of S iff it admits a left neighborhood N < ε (x) that is entirely contained in either S or S, i.e., ε > 0 : N < ε (x) S N < ε (x) S. Right interval boundary points are defined in the same way. A point x S is an interval boundary point of S iff it is a left or a right interval boundary point of S. Each interval boundary point x of S is thus characterized by its direction (left or right), its polarity w.r.t. S (i.e., whether x S or x S), and the polarity of its left or right neighborhoods of sufficiently small size (i.e., whether they are subsets of S or of S). The possible combinations define eight types of interval boundary points, that are illustrated in Figure 1. 5
7 Left interval boundary points S S S = Right interval boundary points S S S = x S x S x S x S S S = S S S S = x S x S x S x S Fig.1. Types of interval boundary points. 4.2 Recognizing Interval Boundary Points Recall that A is a weak deterministic RNA recognizing a set S [0,1]. We assume w.l.o.g. that A is canonical and complete, in the sense that from each state q and alphabet symbol a, there exists an outgoing transition from q labeled by a. Consider a path π of A that reads an encoding w of a left interval boundary point x of S. Since A is weak, π eventually reaches a strongly connected component C that it does not leave. The accepting status of C corresponds to the polarity of x w.r.t. S. Since x is a left interval boundary point, all its sufficiently small left neighborhoods are either subsets of S or subsets of S, depending on the type of x. Hence, from each state s of C visited infinitely many times by π, its outgoing transitions labeled by smaller digits than the one read in π must necessarily lead to either the universal or the empty strongly connected component of A. It follows that, after having reached some state s in C, the path π follows the transitions within C that are labeled by the smallest possible digits, hence it eventually cycles through a loop. A similar result holds for right interval boundary points, which are read by paths that eventually follow the largest possible digits in their terminal strongly connected component. As a consequence, every base-r encoding w of an interval boundary point of S is necessarily ultimately periodic, i.e., such that w = u v ω, with u Λ r and v Σ + r. Besides, each ultimate period v of such encodings can be uniquely determined from a suitable state of A associated with a direction (left or right). We therefore have the following results. Theorem 1. Each interval boundary point of a subset of [0,1] that is recognizable by a weak deterministic RNA is a rational number. Theorem 2. Let S [0,1] be a set recognizable by a weak deterministic RNA in a base r > 1. The set of ultimate periods of the base-r encodings of the interval boundary points of S is finite. 4.3 Recognizing Interval Boundary Points in Multiple Bases Consider now a set S [0, 1] that is simultaneously recognizable by weak deterministic RNA in two relatively prime bases r 1 > 1 and r 2 > 1. Let A 1 and A 2 denote, respectively, such RNA. 6
8 Suppose that S has infinitely many interval boundary points. From Theorem 2, there must exist some ultimate period v Σ + r 1 such that infinitely many interval boundary points of S have base-r 1 encodings of the form u i v ω, with i : u i Λ r1. Moreover, the language L of the words u i for which u i v ω encodes an interval boundary point of S, and such that u i and v do not end with the same digit, is infinite and regular. (The restriction on the last digit of u i and v expresses that u i is the smallest aperiodic prefix of u i v ω.) Indeed, each u i L can be recognized by a path from the initial state of A to a state from which v can be read as the ultimate period of an encoding of an interval boundary point. Hence, there exist w 1 Λ r1 and w 2,w 3 Σ r 1, with w 2 > 0, such that k : w 1 (w 2 ) k w 3 L. Furthermore, we have that w 2 w 3 and v do not end with the same digit. Thus, for each k 0, there exists an interval boundary point of S with a base-r 1 encoding of the form w 1 (w 2 ) k w 3 v ω. Each word in this language is ultimately periodic, thus it encodes in base r 1 a rational number that can also be encoded by an ultimately periodic word in base r 2. We use the following lemma. Lemma 1. Let r 1 > 1 and r 2 > 1 be relatively prime bases, and let w 1 Λ r1,w 2,w 3,w 4 Σ r 1, with w 2 > 0, w 4 > 0, such that the words w 2 w 3 and w 4 do not end with the same digit. The subset of Q encoded in base r 1 by the language w 1 (w 2 ) w 3 (w 4 ) ω cannot be encoded in base r 2 with only a finite number of ultimate periods. Proof. The proof is given in Appendix A. Together with Theorem 2, this lemma contradicts our assumption that S has infinitely many interval boundary points. We thus have the following theorem. Theorem 3. If a set S [0,1] is simultaneously recognizable by weak deterministic RNA in two relatively prime bases, then it has finitely many interval boundary points. We therefore call a set that satisfies the hypotheses of Theorem 3 a finiteboundary set. 5 Finite-Boundary Sets Our goal is now to characterize the structure of the transition graph of RNA that recognize finite-boundary sets. We start by establishing some properties that hold for all weak deterministic RNA, and then focus on the specific case of finite-boundary sets. 5.1 Properties of Weak Deterministic RNA Let A be a weak deterministic RNA, which we assume to be complete and canonical, recognizing a subset of R in a base r > 1. Consider a strongly connected component C of A such that each of its outgoing transitions leads to either the universal or the empty strongly connected component, i.e., those accepting respectively the languages Σ ω r and. 7
9 Lemma 2. Let π be a minimal (resp. maximal) infinite path within C, i.e., a path that follows from each visited state the transition of C labeled by the smallest (resp. largest) possible digit. The destination of all outgoing transitions from states visited by π, and that are labeled by a smaller (resp. larger) digit than the one read in π, is identical. Proof. We first study the case of two transitions t 1 and t 2 originating from the same state s visited by π, that are respectively labeled by digits d 1, d 2 smaller that the digit d read from s in π. Among the digits that satisfy this condition, one can always find consecutive values, hence it is sufficient to consider the case where d 2 = d Let σ be a finite path that reaches s from the initial state of A. By appending to σ suffixes that read d 1 (r 1) ω and d 2 0 ω, one obtains paths that recognize dual encodings of the same number, hence these paths must be either both accepting or both non-accepting. Therefore, t 1 and t 2 share the same destination. Consider now transitions t 1 and t 2 from distinct states s 1 and s 2 visited by π, labeled by smaller digits than those respectively denoted d 1 and d 2 read in π. We can assume w.l.o.g. that s 1 and s 2 are consecutive among the states visited by π that have such outgoing transitions. In other words, the subpath of π that links s 1 to s 2 is labeled by a word of the form d 1 0 k, with d 1 > 0 and k 0. Let σ be a finite path that reaches s 1 from the initial state of A. Appending to σ suffixes that read (d 1 1) (r 1) ω and d 1 0 ω yields paths that read dual encodings of the same number, hence these paths must be either both accepting or both non-accepting. The destinations of the transitions that leave C from s 1 and s 2 must thus be identical. The case of maximal paths is handled in the same way. The following result now expresses a constraint on the trivial (acyclic) strongly connected components of the fractional part of A (i.e., the part of A reached after reading an occurrence of the symbol ). Lemma 3. From any trivial strongly connected component of the fractional part of A, there must exist a reachable strongly connected component that is neither empty, trivial, nor universal. Proof. The proof is by contradiction. Let {s} be a trivial strongly connected component of the fractional part of A. Assume that all paths from s eventually reach the universal or the empty strongly connected component, after passing only through trivial components. As a consequence, the language accepted from s is of the form L Σ ω r, where L Σ r is finite. We can require w.l.o.g. that all words in L share the same length l. Note that L cannot be empty or equal to Σ l r, since s does not belong to the empty or universal components. Each word in Σ l r can be seen as the base-r encoding of an integer in the interval [0,r l 1]. Since L is neither empty nor universal, there exist two words w 1,w 2 Σ l r that do not both belong to L or to Σ l r \ L, and that encode two consecutive integers n and n + 1. Then, u w 2 0 ω and u w 1 (r 1) ω encode the same number in base r, where u is the label of an arbitrary path from the 8
10 initial state of A to s. This contradicts the fact that A accepts all the encodings of the numbers it recognizes. 5.2 Properties of RNA Recognizing Finite-Boundary Sets Theorem 4. Let A be a weak deterministic RNA, supposed to be in complete and canonical form, recognizing a finite-boundary set S [0, 1]. Each non-trivial, non-empty and non-universal strongly connected component of the fractional part of A takes the form of a single cycle. Moreover, from each such component, the only reachable strongly connected components besides itself are the empty or the universal ones. Proof. Let C be a non-trivial, non-empty and non-universal strongly connected component of the fractional part of A, and let s be an arbitrary state of C. The path π from s that stays within C and follows the transitions with the smallest possible digits is cyclic, and determines the ultimate period of encodings of some interval boundary points of S. If C contains other cycles, or if C is reachable from other non-trivial strongly connected components in the fractional part, then π can be prefixed by infinitely many reachable paths from an entry state of the fractional part of A to s. This contradicts the fact that S has only finitely many interval boundary points. That no trivial strongly connected component can be reachable from C then follows from Lemma 3. This result characterizes quite precisely the shape of the fractional part of a weak deterministic RNA recognizing a finite-boundary set: Its transition graph is first composed of a bottom layer of strongly connected components containing only the universal and the empty one, and then a (possibly empty) layer of single-cycle components leading to the bottom layer. Thanks to Lemma 2, the transitions that leave a single-cycle component with a smaller (or larger) digit all lead to the same empty or universal component (which may differ for the smaller and larger cases). Thus, each single-cycle component can simply be characterized by its label and the polarity of its smaller and greater alternatives. Finally, the two layers of non-trivial strongly connected components can be reached through an acyclic structure of trivial components, such that from each of them, there is at least one outgoing path leading to a single-cycle component. As a consequence, we are now able to describe the language accepted by such a RNA. Theorem 5. Let A be a weak deterministic RNA recognizing a finite-boundary set S [0,1] encoded in a base r > 1. The language L accepted by A can be expressed as L = i L w i Σ ω r i L w i (v i ) ω i L w i (Σ ω r \ (v i) ω ) L 0 L 1, where each union is finite, i : w i,w i,w i,v i,v i Σ r with v i > 0, v i > 0, L = 0 +, L 0 is either empty or equal to (r 1) + (r 1) ω, and L 1 is either empty or equal to ω. 9
11 (The terms L 0 and L 1 are introduced in order to deal with the dual encodings of 0 and 1.) In the expression given by Theorem 5, each term of the union encodes a subset of [0,1] that is definable in R, Z,+,< : L w i Σr ω defines an interval [a,b], with a,b Q, the terms L w i (v i) ω, L 0 and L 1 correspond to single rational numbers c Q, and L w i (Σω r \ (v i )ω ) recognizes a set [a,b] \ {c} with a, b, c Q. This shows that the set S [0, 1] recognized by A is definable in R, Z,+,<. Combining this result with Theorem 3, as well as the reduction discussed in Section 3, we get our main result: Theorem 6. If a set S R is simultaneously recognizable by weak deterministic RNA in two relatively prime bases, then it is definable in R, Z,+,<. Corollary 1. A set S R is recognizable by weak deterministic RNA in every base r > 1 iff it is definable in R, Z,+,<. 6 Conclusions and Future Work The main contribution of this work is to show that the subsets of R that can be recognized by weak deterministic RNA in all integer bases r > 1 are exactly those that are definable in the first-order additive theory of the real and integer numbers R, Z, +, <. Our central result is actually stronger, stating that recognizability in two relatively prime bases r 1 and r 2 is sufficient for forcing definability in R, Z,+,<. Using the same argument as in the proof of Lemma 1, this result can directly be extended to bases r 1 and r 2 that do not share the same set of prime factors. This differs slightly from the statement of Cobham s original theorem, which considers instead bases that are multiplicatively independent, i.e., that cannot be expressed as integer powers of the same integer [Cob69,BHMV94]. Unfortunately, our approach does not easily generalize to multiplicatively independent bases, since Theorem 3 then becomes invalid. Addressing this issue is an interesting open problem. Another contribution is a detailed characterization of the transition graph of weak deterministic RNA that represent subsets of R defined in first-order additive arithmetic. This characterization could be turned into efficient data structures for handling such RNA. In particular, since their fractional parts recognize a finite union of interval and individual rational values, an efficient representation might be based on symbolic data structures such as BDDs for handling large but finite enumerations. Another possible application is the extraction of formulas from automata-based representations of sets [Lat05,Ler05]. Finally, another goal will be to extend our results to sets in higher dimensions, i.e., to generalize Semenov s theorem [Sem77] to automata over real vectors. 10
12 References [AY07] J. Avigad and Y. Yin. Quantifier elimination for the reals with a predicate for the powers of two. Theoretical Computer Science, 370:48 59, [BBR97] B. Boigelot, L. Bronne, and S. Rassart. An improved reachability analysis method for strongly linear hybrid systems. In Proc. 9th CAV, volume 1254 of Lecture Notes in Computer Science, pages , Haifa, June Springer. [BHMV94] V. Bruyère, G. Hansel, C. Michaux, and R. Villemaire. Logic and p- recognizable sets of integers. Bulletin of the Belgian Mathematical Society, 1(2): , March [BJW05] B. Boigelot, S. Jodogne, and P. Wolper. An effective decision procedure for linear arithmetic over the integers and reals. ACM Transactions on Computational Logic, 6(3): , [Boi98] B. Boigelot. Symbolic methods for exploring infinite state spaces. PhD thesis, Université de Liège, [Bru06] J. Brusten. Etude des propriétés des RVA. Graduate thesis, Université de Liège, May [BRW98] B. Boigelot, S. Rassart, and P. Wolper. On the expressiveness of real and integer arithmetic automata. In Proc. 25th ICALP, volume 1443 of Lecture Notes in Computer Science, pages , Aalborg, July Springer. [Büc62] J. R. Büchi. On a decision method in restricted second order arithmetic. In Proc. International Congress on Logic, Methodoloy and Philosophy of Science, pages 1 12, Stanford, Stanford University Press. [Cob69] A. Cobham. On the base-dependence of sets of numbers recognizable by finite automata. Mathematical Systems Theory, 3: , [KV05] O. Kupferman and M.Y. Vardi. Complementation constructions for nondeterministic automata on infinite words. In Proc. 11th TACAS, volume 3440 of Lecture Notes in Computer Science, pages , Edinburgh, April Springer. [Lat05] L. Latour. Presburger arithmetic: from automata to formulas. PhD thesis, Université de Liège, [Ler05] J. Leroux. A polynomial time Presburger criterion and synthesis for number decision diagrams. In Proc. 20th LICS, pages , Chicago, June IEEE Computer Society. [Sem77] A.L. Semenov. Presburgerness of predicates regular in two number systems. Siberian Mathematical Journal, 18: , [vdd85] L. van den Dries. The field of reals with a predicate for the powers of two. Manuscripta Mathematica, 54: , [Vil92] R. Villemaire. The theory of N, +, V k, V l is undecidable. Theoretical Computer Science, 106(2): , [WB95] P. Wolper and B. Boigelot. An automata-theoretic approach to Presburger arithmetic constraints. In Proc. 2nd SAS, volume 983 of Lecture Notes in Computer Science, Glasgow, September Springer. [WB98] P. Wolper and B. Boigelot. Verifying systems with infinite but regular state spaces. In Proc. 10th CAV, volume 1427 of Lecture Notes in Computer Science, pages 88 97, Vancouver, June Springer. [Wil93] T. Wilke. Locally threshold testable languages of infinite words. In Proc. 10th STACS, volume 665 of Lecture Notes in Computer Science, pages , Würzburg, Springer. 11
13 A Proof of Lemma 1 For a base r > 1 and a word w Λ r Σr ω, let [w] r denote the real number encoded by w in that base. Similarly, for w {0,r 1} Σr, let [w] r denote the integer number encoded by w, i.e., [w] r = [w 0 ω ] r. For every k 0, we define x k = [w 1 (w 2 ) k w 3 (w 4 ) ω ] r1. The prefix w 1 can be decomposed into w 1 = w 1 w 1, with w 1 {0,r 1 1} Σr 1 and w 1 Σr 1. We then have for every k > 0, x k = y k r w 1 +k w2 + w3 1 (r w4 1 1), (1) with y k = (r w4 1 1)[w 1 w 1 w2 k w 3 ] r1 +[0 w 4 ] r1. Remark that y k is an integer, but cannot be a multiple of r 1. Indeed, we have y k modr 1 = ([0 w 4 ] r1 [w 1 w 1 w2 k w 3 ] r1 ) modr 1, which is non-zero thanks to the hypothesis on the last digits of w 2 w 3 and w 4. For every k > 0, we have y k = z k r w2 1 1, with z k = ar k w2 1 + b, a = r w3 1 (r w4 1 1)((r w2 1 1)[w 1 w 1] r1 + [0 w 2 ] r1 ), and b = r w3 1 (r w4 1 1)[0 w 2 ] r1 +(r w2 1 1)(r w4 1 1)[0 w 3 ] r1 +(r w2 1 1)[0 w 4 ] r1. Substituting in (1), we get x k = z k r w 1 +k w2 + w3 1 (r w2 1 1)(r w4 1 1). (2) Since z k = (r w2 1 1)y k and y k modr 1 0, we have z k modr 1 0, hence b 0. Consider a prime factor f of r 1, and define l as the greatest integer such that f l divides b. For every k > l, we have z k modf l = 0 and z k modf l+1 = b modf l+1 0. It follows that the reduced rational expression of x k, i.e., x k = n k /d k with n k,d k Z, d k > 0 and gcd(n k,d k ) = 1, is such that f k l divides d k for every k > l. Indeed, the numerator of (2) is not divisible by f l+1 whereas its denominator is divisible by f k+1. Assume now, by contradiction, that the set {x k k 0} can be represented in base r 2 using only a finite number of ultimate periods. Then, there exists an ultimate period v Σ r + 2 such that for infinitely many values of k, we have x k = [u k u k vω ] r2, with u k {0,r 2 1} Σr 2 and u k Σ r 2. We then have, for these values of k, x k = [u k u k v] r 2 [u k u r u k 2 (r v 2 1) Since (r v 2 1) is bounded, and r 2 is relatively prime with r 1 by hypothesis, the denominator of this expression can only be divisible by a bounded number of powers of f, which contradicts our previous result. k ] r 2. 12
On The Number Of Slim Semimodular Lattices
On The Number Of Slim Semimodular Lattices Gábor Czédli, Tamás Dékány, László Ozsvárt, Nóra Szakács, Balázs Udvari Bolyai Institute, University of Szeged Conference on Universal Algebra and Lattice Theory
Centre Fédéré en Vérication
Centre Fédéré en Vérication Technical Report number 2009.118 Partial Projection of Sets Represented by Finite Automata, with Application to State-Space Visualization Bernard Boigelot, Jean-Franßois Degbomont
Construction of a cube given with its centre and a sideline
Transformation of a plane of projection Construction of a cube given with its centre and a sideline Exercise. Given the center O and a sideline e of a cube, where e is a vertical line. Construct the projections
Centre Fédéré en Vérication
Centre Fédéré en Vérication Technical Report number 2008.120 Computing Convex Hulls by Automata Iteration François Cantin, Axel Legay, Pierre Wolper This work was partially supported by a FRFC grant: 2.4530.02
Performance Modeling of Intelligent Car Parking Systems
Performance Modeling of Intelligent Car Parking Systems Károly Farkas Gábor Horváth András Mészáros Miklós Telek Technical University of Budapest, Hungary EPEW 2014, Florence, Italy Outline Intelligent
Correlation & Linear Regression in SPSS
Petra Petrovics Correlation & Linear Regression in SPSS 4 th seminar Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Correlation
Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz
Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz Kvantumkapuk, áramkörök 2016. március 3. A kvantummechanika posztulátumai (1-2) 1. Állapotleírás Zárt fizikai rendszer aktuális állapota
Dependency preservation
Adatbázis-kezelés. (4 előadás: Relácó felbontásai (dekomponálás)) 1 Getting lossless decomposition is necessary. But of course, we also want to keep dependencies, since losing a dependency means, that
Cluster Analysis. Potyó László
Cluster Analysis Potyó László What is Cluster Analysis? Cluster: a collection of data objects Similar to one another within the same cluster Dissimilar to the objects in other clusters Cluster analysis
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Hypothesis Testing. Petra Petrovics.
Hypothesis Testing Petra Petrovics PhD Student Inference from the Sample to the Population Estimation Hypothesis Testing Estimation: how can we determine the value of an unknown parameter of a population
Characterizations and Properties of Graphs of Baire Functions
Characterizations and Properties of Graphs of Baire Functions BSc Szakdolgozat Szerz : Témavezet : Maga Balázs Buczolich Zoltán Matematika BSc Matematikus Egyetemi tanár Analízis Tanszék Eötvös Loránd
Véges szavak általánosított részszó-bonyolultsága
Véges szavak általánosított részszó-bonyolultsága KÁSA Zoltán Sapientia Erdélyi Magyar Tudományegyetem Kolozsvár Marosvásárhely Csíkszereda Matematika-Informatika Tanszék, Marosvásárhely Budapest, 2010.
SQL/PSM kurzorok rész
SQL/PSM kurzorok --- 2.rész Tankönyv: Ullman-Widom: Adatbázisrendszerek Alapvetés Második, átdolgozott kiadás, Panem, 2009 9.3. Az SQL és a befogadó nyelv közötti felület (sormutatók) 9.4. SQL/PSM Sémában
Genome 373: Hidden Markov Models I. Doug Fowler
Genome 373: Hidden Markov Models I Doug Fowler Review From Gene Prediction I transcriptional start site G open reading frame transcriptional termination site promoter 5 untranslated region 3 untranslated
On the ω-language Expressive Power of Extended Petri Nets
ÒØÖ Ö Ò Î Ö Ø ÓÒ Ì Ò Ð Ê ÔÓÖØ ÒÙÑ Ö ¾¼¼ º ¾ ÇÒ Ø ÓÑ ¹Ð Ò Ù ÜÔÖ Ú ÔÓÛ Ö Ó ÜØ Ò È ØÖ Ò Ø Ð Ò Ò Ð ÆË Òµ ÐÐ Ö ÖØ ÍÄ µ  ҹ Ö ÒÓ Ê Ò ÍÄ µ Ä ÙÖ ÒØ Î Ò Ò ÍÄ µ Ì ÛÓÖ Û Ô ÖØ ÐÐÝ ÙÔÔÓÖØ Ý Ê Ö ÒØ ¾º ¼º¼¾ ØØÔ»»ÛÛÛºÙÐ
Correlation & Linear Regression in SPSS
Correlation & Linear Regression in SPSS Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise 1 - Correlation File / Open
FAMILY STRUCTURES THROUGH THE LIFE CYCLE
FAMILY STRUCTURES THROUGH THE LIFE CYCLE István Harcsa Judit Monostori A magyar társadalom 2012-ben: trendek és perspektívák EU összehasonlításban Budapest, 2012 november 22-23 Introduction Factors which
Nemzetközi Kenguru Matematikatábor
Nemzetközi Kenguru Matematikatábor 2011. augusztus 19-27., Werbellinsee, Németország BESZÁMOLÓ Bevezető Idén hetedik alkalommal került megrendezére a Nemzetközi Kenguru Matematikatábor (7. Internationale
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Factor Analysis
Factor Analysis Factor analysis is a multiple statistical method, which analyzes the correlation relation between data, and it is for data reduction, dimension reduction and to explore the structure. Aim
Cashback 2015 Deposit Promotion teljes szabályzat
Cashback 2015 Deposit Promotion teljes szabályzat 1. Definitions 1. Definíciók: a) Account Client s trading account or any other accounts and/or registers maintained for Számla Az ügyfél kereskedési számlája
A logaritmikus legkisebb négyzetek módszerének karakterizációi
A logaritmikus legkisebb négyzetek módszerének karakterizációi Csató László laszlo.csato@uni-corvinus.hu MTA Számítástechnikai és Automatizálási Kutatóintézet (MTA SZTAKI) Operációkutatás és Döntési Rendszerek
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Correlation & Linear. Petra Petrovics.
Correlation & Linear Regression in SPSS Petra Petrovics PhD Student Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise
Local fluctuations of critical Mandelbrot cascades. Konrad Kolesko
Local fluctuations of critical Mandelbrot cascades Konrad Kolesko joint with D. Buraczewski and P. Dyszewski Warwick, 18-22 May, 2015 Random measures µ µ 1 µ 2 For given random variables X 1, X 2 s.t.
Word and Polygon List for Obtuse Triangular Billiards II
Word and Polygon List for Obtuse Triangular Billiards II Richard Evan Schwartz August 19, 2008 Abstract This is the list of words and polygons we use for our paper. 1 Notation To compress our notation
Schwarz lemma, the Carath eodory and Kobayashi metrics and applications in complex analysis
Schwarz lemma, the Carath eodory and Kobayashi metrics and applications in complex analysis Workshop: The perturbation of the generalized inverses, geometric structures, xed point theory and applications
Kvantum-informatika és kommunikáció 2015/2016 ősz. A kvantuminformatika jelölésrendszere szeptember 11.
Kvantum-informatika és kommunikáció 2015/2016 ősz A kvantuminformatika jelölésrendszere 2015. szeptember 11. Mi lehet kvantumbit? Kvantum eszközök (1) 15=5 3 Bacsárdi Képek forrása: IBM's László, Almaden
STUDENT LOGBOOK. 1 week general practice course for the 6 th year medical students SEMMELWEIS EGYETEM. Name of the student:
STUDENT LOGBOOK 1 week general practice course for the 6 th year medical students Name of the student: Dates of the practice course: Name of the tutor: Address of the family practice: Tel: Please read
Statistical Inference
Petra Petrovics Statistical Inference 1 st lecture Descriptive Statistics Inferential - it is concerned only with collecting and describing data Population - it is used when tentative conclusions about
MATEMATIKA ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2014. május 6. MATEMATIKA ANGOL NYELVEN EMELT SZINTŰ ÍRÁSBELI VIZSGA 2014. május 6. 8:00 Az írásbeli vizsga időtartama: 240 perc Pótlapok száma Tisztázati Piszkozati EMBERI ERŐFORRÁSOK
Descriptive Statistics
Descriptive Statistics Petra Petrovics DESCRIPTIVE STATISTICS Definition: Descriptive statistics is concerned only with collecting and describing data Methods: - statistical tables and graphs - descriptive
Mapping Sequencing Reads to a Reference Genome
Mapping Sequencing Reads to a Reference Genome High Throughput Sequencing RN Example applications: Sequencing a genome (DN) Sequencing a transcriptome and gene expression studies (RN) ChIP (chromatin immunoprecipitation)
(c) 2004 F. Estrada & A. Jepson & D. Fleet Canny Edges Tutorial: Oct. 4, '03 Canny Edges Tutorial References: ffl imagetutorial.m ffl cannytutorial.m
Canny Edges Tutorial: Oct. 4, '03 Canny Edges Tutorial References: ffl imagetutorial.m ffl cannytutorial.m ffl ~jepson/pub/matlab/isetoolbox/tutorials ffl ~jepson/pub/matlab/utvistoolbox/tutorials ffl
Erdős-Ko-Rado theorems on the weak Bruhat lattice
Erdős-Ko-Rado theorems on the weak Bruhat lattice arxiv:1904.01436v1 [math.co] 2 Apr 2019 Susanna Fishel, Glenn Hurlbert, Vikram Kamat, Karen Meagher April 3, 2019 Abstract Let L = (X, ) be a lattice.
EN United in diversity EN A8-0206/473. Amendment
21.3.2019 A8-0206/473 473 Recital 12 d (new) (12d) Since there is no sufficient link of a driver with a territory of a Member State of transit, transit operations should not be considered as posting situations.
Ensemble Kalman Filters Part 1: The basics
Ensemble Kalman Filters Part 1: The basics Peter Jan van Leeuwen Data Assimilation Research Centre DARC University of Reading p.j.vanleeuwen@reading.ac.uk Model: 10 9 unknowns P[u(x1),u(x2),T(x3),.. Observations:
EN United in diversity EN A8-0206/419. Amendment
22.3.2019 A8-0206/419 419 Article 2 paragraph 4 point a point i (i) the identity of the road transport operator; (i) the identity of the road transport operator by means of its intra-community tax identification
Statistical Dependence
Statistical Dependence Petra Petrovics Statistical Dependence Deinition: Statistical dependence exists when the value o some variable is dependent upon or aected by the value o some other variable. Independent
Phenotype. Genotype. It is like any other experiment! What is a bioinformatics experiment? Remember the Goal. Infectious Disease Paradigm
It is like any other experiment! What is a bioinformatics experiment? You need to know your data/input sources You need to understand your methods and their assumptions You need a plan to get from point
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Nonparametric Tests
Nonparametric Tests Petra Petrovics Hypothesis Testing Parametric Tests Mean of a population Population proportion Population Standard Deviation Nonparametric Tests Test for Independence Analysis of Variance
Széchenyi István Egyetem www.sze.hu/~herno
Oldal: 1/6 A feladat során megismerkedünk a C# és a LabVIEW összekapcsolásának egy lehetőségével, pontosabban nagyon egyszerű C#- ban írt kódból fordítunk DLL-t, amit meghívunk LabVIEW-ból. Az eljárás
A rosszindulatú daganatos halálozás változása 1975 és 2001 között Magyarországon
A rosszindulatú daganatos halálozás változása és között Eredeti közlemény Gaudi István 1,2, Kásler Miklós 2 1 MTA Számítástechnikai és Automatizálási Kutató Intézete, Budapest 2 Országos Onkológiai Intézet,
Using the CW-Net in a user defined IP network
Using the CW-Net in a user defined IP network Data transmission and device control through IP platform CW-Net Basically, CableWorld's CW-Net operates in the 10.123.13.xxx IP address range. User Defined
Computer Architecture
Computer Architecture Locality-aware programming 2016. április 27. Budapest Gábor Horváth associate professor BUTE Department of Telecommunications ghorvath@hit.bme.hu Számítógép Architektúrák Horváth
MATEMATIKA ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2018. május 8. MATEMATIKA ANGOL NYELVEN EMELT SZINTŰ ÍRÁSBELI VIZSGA 2018. május 8. 8:00 Időtartam: 300 perc Pótlapok száma Tisztázati Piszkozati EMBERI ERŐFORRÁSOK MINISZTÉRIUMA Matematika
Supporting Information
Supporting Information Cell-free GFP simulations Cell-free simulations of degfp production were consistent with experimental measurements (Fig. S1). Dual emmission GFP was produced under a P70a promoter
Alternating Permutations
Alternating Permutations Richard P. Stanley M.I.T. Definitions A sequence a 1, a 2,..., a k of distinct integers is alternating if a 1 > a 2 < a 3 > a 4 a 3
PIACI HIRDETMÉNY / MARKET NOTICE
PIACI HIRDETMÉNY / MARKET NOTICE HUPX DAM Másnapi Aukció / HUPX DAM Day-Ahead Auction Iktatási szám / Notice #: Dátum / Of: 18/11/2014 HUPX-MN-DAM-2014-0023 Tárgy / Subject: Változások a HUPX másnapi piac
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel Timea Farkas Click here if your download doesn"t start
ó Ú ő ó ó ó ö ó ó ő ö ó ö ö ő ö ó ö ö ö ö ó ó ó ó ó ö ó ó ó ó Ú ö ö ó ó Ú ú ó ó ö ó Ű ő ó ó ó ő ó ó ó ó ö ó ó ó ö ő ö ó ó ó Ú ó ó ö ó ö ó ö ő ó ó ó ó Ú ö ö ő ő ó ó ö ö ó ö ó ó ó ö ö ő ö Ú ó ó ó ü ú ú ű
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2008. május 26. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2008. május 26. 8:00 Az írásbeli vizsga időtartama: 180 perc Pótlapok száma Tisztázati Piszkozati OKTATÁSI
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 200. május 4. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 200. május 4. 8:00 Az írásbeli vizsga időtartama: 80 perc Pótlapok száma Tisztázati Piszkozati OKTATÁSI
Contact us Toll free (800) fax (800)
Table of Contents Thank you for purchasing our product, your business is greatly appreciated. If you have any questions, comments, or concerns with the product you received please contact the factory.
Néhány folyóiratkereső rendszer felsorolása és példa segítségével vázlatos bemutatása Sasvári Péter
Néhány folyóiratkereső rendszer felsorolása és példa segítségével vázlatos bemutatása Sasvári Péter DOI: http://doi.org/10.13140/rg.2.2.28994.22721 A tudományos közlemények írása minden szakma művelésének
GEOGRAPHICAL ECONOMICS B
GEOGRAPHICAL ECONOMICS B ELTE Faculty of Social Sciences, Department of Economics Geographical Economics "B" KRUGMAN (1991) MODEL: EXTENSIONS Authors: Gábor Békés, Sarolta Rózsás Supervised by Gábor
Dr. Sasvári Péter Egyetemi docens
A KKV-k Informatikai Infrastruktúrájának vizsgálata a Visegrádi országokban The Analysis Of The IT Infrastructure Among SMEs In The Visegrád Group Of Countries Dr. Sasvári Péter Egyetemi docens MultiScience
Telefonszám(ok) +36-93-502-916 Mobil +36-30-396-8675 Fax(ok) +36-93-502-900. Egyetem u. 10., 8200 Veszprém. Tehetséggondozás (matematika)
Europass Önéletrajz Személyi adatok Vezetéknév(ek) / Utónév(ek) Bujtás Csilla Telefonszám(ok) +36-93-502-916 Mobil +36-30-396-8675 Fax(ok) +36-93-502-900 E-mail(ek) Szakmai tapasztalat bujtas@dcs.vein.hu
16F628A megszakítás kezelése
16F628A megszakítás kezelése A 'megszakítás' azt jelenti, hogy a program normális, szekvenciális futása valamilyen külső hatás miatt átmenetileg felfüggesztődik, és a vezérlést egy külön rutin, a megszakításkezelő
Efficient symmetric key private authentication
Efficient symmetric key private authentication Cryptographic Protocols (EIT ICT MSc) Dr. Levente Buttyán Associate Professor BME Hálózati Rendszerek és Szolgáltatások Tanszék Lab of Cryptography and System
Verification of Timed Automata
Budapest University of Technology and Economics Faculty of Electrical Engineering and Informatics Department of Measurement and Information Systems Verification of Timed Automata by CEGAR-Based Algorithms
ACTA ACADEMIAE PAEDAGOGICAE AGRIENSIS
Separatum ACTA ACADEMIAE PAEDAGOGICAE AGRIESIS OVA SERIES TOM. XXII. SECTIO MATEMATICAE TÓMÁCS TIBOR Egy rekurzív sorozat tagjainak átlagáról EGER, 994 Egy rekurzív sorozat tagjainak átlagáról TÓMÁCS TIBOR
Választási modellek 3
Választási modellek 3 Prileszky István Doktori Iskola 2018 http://www.sze.hu/~prile Forrás: A Self Instructing Course in Mode Choice Modeling: Multinomial and Nested Logit Models Prepared For U.S. Department
MATEMATIKA ANGOL NYELVEN
ÉRETTSÉGI VIZSGA MATEMATIKA ANGOL NYELVEN EMELT SZINTŰ ÍRÁSBELI VIZSGA 8:00 Az írásbeli vizsga időtartama: 240 perc Pótlapok száma Tisztázati Piszkozati OKTATÁSI ÉS KULTURÁLIS MINISZTÉRIUM Matematika angol
MATEMATIKA ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2012. május 8. MATEMATIKA ANGOL NYELVEN EMELT SZINTŰ ÍRÁSBELI VIZSGA 2012. május 8. 8:00 Az írásbeli vizsga időtartama: 240 perc Pótlapok száma Tisztázati Piszkozati NEMZETI ERŐFORRÁS
Small Dynamical Heights for Quadratic Polynomials and Rational Functions
Experimental Mathematics, 23:433 447, 2014 Copyright C Taylor & Francis Group, LLC ISSN: 1058-6458 print / 1944-950X online DOI: 10.1080/10586458.2014.938203 Small Dynamical Heights for Quadratic Polynomials
First experiences with Gd fuel assemblies in. Tamás Parkó, Botond Beliczai AER Symposium 2009.09.21 25.
First experiences with Gd fuel assemblies in the Paks NPP Tams Parkó, Botond Beliczai AER Symposium 2009.09.21 25. Introduction From 2006 we increased the heat power of our units by 8% For reaching this
MATEMATIKA ANGOL NYELVEN MATHEMATICS
ÉRETTSÉGI VIZSGA 2005. május 10. MATEMATIKA ANGOL NYELVEN MATHEMATICS EMELT SZINTŰ ÍRÁSBELI VIZSGA HIGHER LEVEL WRITTEN EXAMINATION Az írásbeli vizsga időtartama: 240 perc Time allowed for the examination:
AZ ACM NEMZETKÖZI PROGRAMOZÓI VERSENYE
AZ ACM NEMZETKÖZI PROGRAMOZÓI VERSENYE Kuki Attila, kuki@math.klte.hu Kossuth Lajos Tudományegyetem, Információ Technológia Tanszék Abstract This paper is dedicated to the Scholastic Programming Contest
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2013. május 23. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2013. május 23. 8:00 Az írásbeli vizsga időtartama: 180 perc Pótlapok száma Tisztázati Piszkozati EMBERI
Pletykaalapú gépi tanulás teljesen elosztott környezetben
Pletykaalapú gépi tanulás teljesen elosztott környezetben Hegedűs István Jelasity Márk témavezető Szegedi Tudományegyetem MTA-SZTE Mesterséges Intelligencia Kutatócsopot Motiváció Az adat adatközpontokban
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében. Dicse Jenő üzletfejlesztési igazgató
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében Dicse Jenő üzletfejlesztési igazgató How to apply modern e-learning to improve the training of firefighters Jenő Dicse Director of
MATEMATIKA ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2014. október 14. MATEMATIKA ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2014. október 14. 8:00 I. Időtartam: 45 perc Pótlapok száma Tisztázati Piszkozati EMBERI ERŐFORRÁSOK MINISZTÉRIUMA
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Nonparametric Tests. Petra Petrovics.
Nonparametric Tests Petra Petrovics PhD Student Hypothesis Testing Parametric Tests Mean o a population Population proportion Population Standard Deviation Nonparametric Tests Test or Independence Analysis
Proxer 7 Manager szoftver felhasználói leírás
Proxer 7 Manager szoftver felhasználói leírás A program az induláskor elkezdi keresni az eszközöket. Ha van olyan eszköz, amely virtuális billentyűzetként van beállítva, akkor azokat is kijelzi. Azokkal
7 th Iron Smelting Symposium 2010, Holland
7 th Iron Smelting Symposium 2010, Holland Október 13-17 között került megrendezésre a Hollandiai Alphen aan den Rijn városában található Archeon Skanzenben a 7. Vasolvasztó Szimpózium. Az öt napos rendezvényen
Centre Fédéré en Vérication
Centre Fédéré en Vérication Technical Report number 2009.110 An Antichain Algorithm for LTL Realizability Emmanuel Filiot, Naiyong Jin, Jean-François Raskin This work was partially supported by a FRFC
Unit 10: In Context 55. In Context. What's the Exam Task? Mediation Task B 2: Translation of an informal letter from Hungarian to English.
Unit 10: In Context 55 UNIT 10 Mediation Task B 2 Hungarian into English In Context OVERVIEW 1. Hungarian and English in Context 2. Step By Step Exam Techniques Real World Link Students who have studied
Adatbázisok 1. Rekurzió a Datalogban és SQL-99
Adatbázisok 1 Rekurzió a Datalogban és SQL-99 Expressive Power of Datalog Without recursion, Datalog can express all and only the queries of core relational algebra. The same as SQL select-from-where,
Utolsó frissítés / Last update: február Szerkesztő / Editor: Csatlós Árpádné
Utolsó frissítés / Last update: 2016. február Szerkesztő / Editor: Csatlós Árpádné TARTALOM / Contents BEVEZETŐ / Introduction... 2 FELNŐTT TAGBÉLYEGEK / Adult membership stamps... 3 IFJÚSÁGI TAGBÉLYEGEK
már mindenben úgy kell eljárnunk, mint bármilyen viaszveszejtéses öntés esetén. A kapott öntvény kidolgozásánál még mindig van lehetőségünk
Budapest Régiségei XLII-XLIII. 2009-2010. Vecsey Ádám Fémeszterga versus viaszesztergálás Bev e z e t é s A méhviaszt, mint alapanyagot nehéz besorolni a műtárgyalkotó anyagok különböző csoportjaiba, mert
Cloud computing. Cloud computing. Dr. Bakonyi Péter.
Cloud computing Cloud computing Dr. Bakonyi Péter. 1/24/2011 1/24/2011 Cloud computing 2 Cloud definició A cloud vagy felhő egy platform vagy infrastruktúra Az alkalmazások és szolgáltatások végrehajtására
Could René Descartes Have Known This?
Experimental Mathematics, 00:1 11, 2015 Copyright C Taylor & Francis Group, LLC ISSN: 1058-6458 print / 1944-950X online DOI: 10.1080/10586458.2015.1030051 Could René Descartes Have Known This? Jens Forsgård
MATEMATIKA ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2009. május 5. MATEMATIKA ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2009. május 5. 8:00 I. Időtartam: 45 perc Pótlapok száma Tisztázati Piszkozati OKTATÁSI ÉS KULTURÁLIS MINISZTÉRIUM Matematika
discosnp demo - Peterlongo Pierre 1 DISCOSNP++: Live demo
discosnp demo - Peterlongo Pierre 1 DISCOSNP++: Live demo Download and install discosnp demo - Peterlongo Pierre 3 Download web page: github.com/gatb/discosnp Chose latest release (2.2.10 today) discosnp
KELET-ÁZSIAI DUPLANÁDAS HANGSZEREK ÉS A HICHIRIKI HASZNÁLATA A 20. SZÁZADI ÉS A KORTÁRS ZENÉBEN
Liszt Ferenc Zeneművészeti Egyetem 28. számú művészet- és művelődéstörténeti tudományok besorolású doktori iskola KELET-ÁZSIAI DUPLANÁDAS HANGSZEREK ÉS A HICHIRIKI HASZNÁLATA A 20. SZÁZADI ÉS A KORTÁRS
Dynamic freefly DIVE POOL LINES
Dynamic freefly 3.rész Part 3 DIVE POOL LINES A dynamic repülés három fajta mozgásból áll: Dynamic freeflying is composed of three types of movements: -Lines (vízszintes "szlalom") (horizontal "slalom")
Hierarchical Abstraction for the Verification of State-based Systems
Budapest University of Technology and Economics Faculty of Electrical Engineering and Informatics Department of Measurement and Information Systems Hierarchical Abstraction for the Verification of State-based
Tudományos Ismeretterjesztő Társulat
Sample letter number 5. International Culture Festival PO Box 34467 Harrogate HG 45 67F Sonnenbergstraße 11a CH-6005 Luzern Re: Festival May 19, 2009 Dear Ms Atkinson, We are two students from Switzerland
Utolsó frissítés / Last update: Szeptember / September Szerkesztő / Editor: Csatlós Árpádné
Utolsó frissítés / Last update: 2018. Szeptember / September Szerkesztő / Editor: Csatlós Árpádné TARTALOM / Contents BEVEZETŐ / Introduction... 2 FELNŐTT TAGBÉLYEGEK / Adult membership stamps... 3 IFJÚSÁGI
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY A feladatsor három részbol áll 1. A vizsgáztató társalgást kezdeményez a vizsgázóval. 2. A vizsgázó egy szituációs feladatban vesz részt a
EN United in diversity EN A8-0206/482. Amendment
21.3.2019 A8-0206/482 482 Recital 13 g (new) (13g) In recognition of the need for specific treatment for the transport sector, in which movement is the very essence of the work undertaken by drivers, the
Megbízási szerződés (KP) Agency Agreement (TP) mely létrejött egyrészről a. concluded by and between
Megbízási szerződés (KP) Agency Agreement (TP) mely létrejött egyrészről a Cégnév: Székhely: Cégjegyzékszám:. Adószám: mint megbízó (továbbiakban: Megbízó) másrészről pedig a concluded by and between Company
MATEMATIKA ANGOL NYELVEN
Név:... osztály:... ÉRETTSÉGI VIZSGA 2007. október 25. MATEMATIKA ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2007. október 25. 8:00 I. Időtartam: 45 perc Pótlapok száma Tisztázati Piszkozati OKTATÁSI ÉS
Modeling the ecological collapse of Easter Island
szakdolgozat Modeling the ecological collapse of Easter Island Takács Bálint Máté Alkalmazott Matematikus MSc hallgató Témavezet k: Faragó István egyetemi tanár ELTE Alkalmazott Analízis és Számításmatematikai
Create & validate a signature
IOTA TUTORIAL 7 Create & validate a signature v.0.0 KNBJDBIRYCUGVWMSKPVA9KOOGKKIRCBYHLMUTLGGAV9LIIPZSBGIENVBQ9NBQWXOXQSJRIRBHYJ9LCTJLISGGBRFRTTWD ABBYUVKPYFDJWTFLICYQQWQVDPCAKNVMSQERSYDPSSXPCZLVKWYKYZMREAEYZOSPWEJLHHFPYGSNSUYRZXANDNQTTLLZA
MATEMATIKA ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2016. május 3. MATEMATIKA ANGOL NYELVEN EMELT SZINTŰ ÍRÁSBELI VIZSGA 2016. május 3. 8:00 Az írásbeli vizsga időtartama: 240 perc Pótlapok száma Tisztázati Piszkozati EMBERI ERŐFORRÁSOK
MATEMATIKA ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2011. május 3. MATEMATIKA ANGOL NYELVEN EMELT SZINTŰ ÍRÁSBELI VIZSGA 2011. május 3. 8:00 Az írásbeli vizsga időtartama: 240 perc Pótlapok száma Tisztázati Piszkozati NEMZETI ERŐFORRÁS
István Micsinai Csaba Molnár: Analysing Parliamentary Data in Hungarian
István Micsinai Csaba Molnár: Analysing Parliamentary Data in Hungarian The Hungarian Comparative Agendas Project Participant of international Comparative Agendas Project Datasets on: Laws (1949-2014)
Lecture 11: Genetic Algorithms
Lecture 11 1 Linear and Combinatorial Optimization Lecture 11: Genetic Algorithms Genetic Algorithms - idea Genetic Algorithms - implementation and examples Lecture 11 2 Genetic algorithms Algorithm is
Cloud computing Dr. Bakonyi Péter.
Cloud computing Dr. Bakonyi Péter. 1/24/2011 Cloud computing 1/24/2011 Cloud computing 2 Cloud definició A cloud vagy felhő egy platform vagy infrastruktúra Az alkalmazások és szolgáltatások végrehajtására
USER MANUAL Guest user
USER MANUAL Guest user 1 Welcome in Kutatótér (Researchroom) Top menu 1. Click on it and the left side menu will pop up 2. With the slider you can make left side menu visible 3. Font side: enlarging font