PENILE FRACTURE WITH URETHRAL INJURY. B. Ç etin el, M.D.** / E. A k k u ş M.D.** / O. A ra r M.D.*** / V. S o lo k M.D.*
|
|
- Ágoston Juhász
- 6 évvel ezelőtt
- Látták:
Átírás
1 Marmara Medical Journal Volume 7 No:4 October 1994 PENILE FRACTURE WITH URETHRAL INJURY (Received 21 December, 1993) B. Ç etin el, M.D.** / E. A k k u ş M.D.** / O. A ra r M.D.*** / V. S o lo k M.D.* P rofessor. D e p a rtm e n t o f U rology, C errahpaşa F a cu lty o f M edicine. Is ta n b u l U niversity, Is ta n b u l. Turkey. ' * In s tru c to r. D e p a rtm e n t o f Urology, C errahpaşa F a cu lty o f M edicine. Is ta n b u l U niversity, Is ta n b u l. Turkey. * ' Research A ssistant. D e p a rtm e n t o f U rology. C errahpaşa F a c u lty o f M edicine, Is ta n b u l U niversity, Is ta n b u l, Turkey. S U M M A R Y An unusual case of penile fracture (rupture of corpus cavernosum) that accidentally occurred during sexual intercourse is presented. The injury also involved the rupture of the urethra. The need for immediate surgery is emphasized when compared to the complications of conservative treatment. K e y W ord s: Penile fracture, Urethra, Trauma INTRODUCTION Associated rupture of both corpora cavernosa and urethra during coitus is a urologic emergency. When recognized early and surgically repaired, a good functional result regarding micturition and erection can be expected. CASE REPORT A 37-year-old man presented with penile swelling, hematoma, pain and deformity 4 hours after sexual intercourse. He also complained of urethral bleeding. 14F Foley catheter was tried to be inserted, but the procedure was unsuccessful with the feeling of "false route". The patient underwent immediate exploration with circumcision incision, and it was recognized that both right corpus cavernosum and urethra (3 cm and 1,5 cm respectively) were injured (Figure). Evacuation of hematoma, antibiotic irrigation of corpus cavernosum, and repair of corpus cavernosum and the urethra were performed during this emergency operation. The follow-up controls revealed excellent functional results including normal erection and micturition. DISCUSSION Penile fracture with urethral injury, is one of the rare urological experiences. It is usually the result of blunt trauma during intercourse or masturbation. Either conservative treatment or immediate surgical exploration are the therapeutic options.(2) Conservative treatment usually results with penile plaque, fibrosis or curvature and perhaps impotence (2,3). Urethral injury accompanying penile fracture cases were treated successfully if immediate surgery was performed.(1,3,4) In our case with immediate surgical exploration and repair of the injuries, excellent functional results including erection and micturition were achieved. We therefore recommend immediate surgical treatment with circumcision incision which provides excellent exposure in cases of penile fracture with or without urethral injury. Fig 1. Associated rupture of both corpora cavernosa and urethra were exposed via circumcised approach. 196
2 Marmara Medical Journal Volume 7 No:4 October 1994 REFERENCES 1. B itk e r MO. B e rlin J, J a rd in A, C h a te la in C. "Faux p a s d u c o it " w ith a s s o c ia te d r u p tu re o f b o th c o r p o r a c a v e rn o s a a n d u re th r a. U ro lo g y ;3 2 : Tan LB. C h ia n g CP. H u a n g CH. T ra u m a tic ru p tu re o f th e c o rp u s c a ve m o su m. B r J U rol :6 8 : A n s e lm o G, P a n d e ila A, P aggiano L. F ra ctu re s o i th e p e n is : T h e ra p e u tic a p p ro a c h a n d lo n g te rm results. B r J U rol ;6 7 : Tsang T. D e m b y AM. P e n ile fra c tu re w ith u re th ra l in ju ry. J U rol :1 4 7 :
3 C ria Bilgisi: Bileşiaü: Trental" 400: Her drajede yavaş salınımlı 400 mg Pcntoksifılin Trcntal* ampul: Her ampulde 15 ml 100 mg Pentoksifılin. Eadlkasyoalan: Periferik. serebral. göz ve iç kulağın dolaşım bozukluktan. Koatreadikasyoalan: Pcntoksifılinc aşırı duyarlılık, masif kanamalar, akut miyokard enfarktüsü, gebelik. Yaa etkileri: Gastrointcstinal yakınmalar bulantı. kusma vb. başağrısı. duyarlılık reaksiyonları kusma. ürtiker vb. ender hipotansiyon. İlaç etkileşiari: Hipotansiflcr. insülin ve glibenklamid ile birlikte kullanımında doz ayarlaması gerekebilir. Pozoto^i: Trental" 400. Günde üç kez birer dr^je. Trental ampul: bkz prospektüs. Ticari şekilleri ve fiyatı: 20 drajelik kutu: TL.. 5 ampullük kutu: TL. Mart I994 Reçete ile satılır Ayrıntılı bilgi için firmamıza başvurunuz. Türk Hocchst San. ve Tic. A.Ş. Davutpaşa Cad. No Topkapı - İstanbul. H oechst B
4
5 Acknowledgement to the Reviewers We wish to express our deep appreciation to the following reviewers for the time they have spend reviewing manuscripts of Volume VII. Editorlal Board Akdaş, F. (Ph.D.) Durmuşoğlu, F. (M.D.) Sivas, A. (M.D.) Akoğlu, E. (M.D.) Esemenli, T. (M.D.) Söyletir, G. (M.D.) Akoğlu, T. (M. D.) Erer, M. (M.D.) Şehitoğlu, M.A. (M.D.) Aktan, S. (M.D.) Erez, S. (M.D.) Şenvar, A. (M. D.) Aktan, Ö. (M.D.) Gökyiğit, A. (M.D.) Şimşek, F. (M.D.) Ander, H. (M.D.) Gürmen, N. (M.D.) Taga, Y. (M.D.) Asana, U. (M.D.) Aytekin, Y. (Ph.D.) Babacan, F. (M.D.) Barış, İ. (M.D.) Başaran, M. (M.D.) Cengiz, C. (M.D.) Ceryan, K. (M.D.) Ceyhan, N. (M.D.) Çamlıbel, T. (M.D.) Çavdar, S. (Ph.D.) Çavdar, T. (M.D.) Hatemi, H. (M.D.) İlker, Y. (M.D.) ince, U. (M.D.) Johansson, C. (Ph.D.) Kırkalı, 2. (M.D.) Küllü, S. (M.D.) Numanoğlu, A. (M.D.) Okar, i. (M.D.) Oktay, Ş. (M.D., Ph.D.) Özer, F. (M.D.) Taşyürekli, M. (M.D.) Taner, D. (M.D.) Tekelioğlu, M. (M.D.) Tözün, N. (M.D.) Turgan, Ç. (M.D.) Turoğlu, T. (M.D.) Ulusoy, NB. (M.D.) Uysal, M. (M.D.) Üneri, C. (M.D.) Vural. F. (M.D.) Çelebiler, Ö. (M.D.) Pekin, S. (M.D.) Yalaz, K. (M.D.) Çırakoğlu, B. (M.D.) Renda, Y. (M.D.) Yalçın, S. (Ph.D.) Çolgar, U. (M. D.) Siva, A. (M.D.) Yurtkuran, M. (M.D.)
6 Author Index for Volume VII Issue, Page Issue, Page Açan, NL 3:115 Karaca,C 1:40 Adalet. 1 4:160 Karakoç, F 3:111 Afşar, N 1:22 Kars, A 1:14 Akan, H 4: 192 Kayhan, B 1:14 Akkuş, E 4: 196 Kılıç, T 3:111 Akman, MA 1:33 Kır, M 1:10; 2: 86 Akoğlu, E 2: 54; 3: 126 Kışlaoğlu, E 4: 155 Aktan, S 1:22 Korkmaz, H 1:18 Alican, İ 4: 178 Kutlay, LC 1: 10; 2:59 Alpdoğan, Û 3: 126 Lawrence, RA 2:54 Arar, O 4: 196 Leylek, O 1:33; 2:86 Arbak, S 4: 166, 171, 178 Macoska, JA 4: 187 Arda. S 3: 102 Mamıkoğlu, B 1: 18; 2:74 Arsan, B 4: 150 Menteş, BB 2:81 Artvinli, M 1:6 Micale, MA 4: 187 Aslan, N 4: 178 Mülazimoğlu, L 2: 78 Atabey, A 1:40 Nurlu, H 2:81 Avkan,V 2:78 Oktay, Ş 4: 178 Aykut, C 1:22 Ozan, H 2:88 Battalı, E 1: 14 Öbek, C 3: 130 Barutçu, A 1: 40 Özdemir, A 4: 155 Başaran, M 3: 111 Özdemir, TK 1:6 Batman, AÇ 1: 18; 2:74 Özek, E 3: 111 Belgin, E 3: 106 Özener, Ç 2:54; 3:126 Berkman, K 4: 178 Özgün, Ş 3: 126 Bilgehan, A 2: 81 Ûzylikan, E 1: 14 Bilgen, H Özyılkan, Ö 1: 14 Bilgin, T 2:88 Pamir, N 3: 111 Bilsel, S 1:36 Peker, F 4: 155 Canatay, H 1:33 Pekin, S 1:10; 2:59,86. Canbulat, EC 2:69 Pekin, T 2:86 Cantez, S 4: 160 Pontes, JE 4: 187 Cantürk, N2 3: 102 Powell, IJ 4: 187 Cengiz, C 2:88 Rakunt, C 4: 192 Ceyhan, B 3: 126 Sakr, W 4: 187 Ceyhan, N 2: 59,86 Sarıoğlu, T 3: 106 Çavdar, S 4: 171 Sav, A 2:74 Çaycı, B 2:81 Sıralı, M 4: 160 Çelikel, T 3: 126 Solak, N 2:64; 4: 150 Çetine!, B 3: 130; 4: 196 Solok, V 3: 130; 4: 196 Dizdar, H 2:74 Söyletir, G 1:27 Durak, N 4: 155 Şehitoğlu, MA 2:74 Dülger, M 3: 102 Şen, F 4: 178 Eker, S Şenel, A 4: 192 Emerk, K 1:36 Tanık, A 4: 192 Ener, B 3: 133 Taşer, B 2: 78 Erbengi, T 4: 166 Telatar, H 1: 14 Ercan, F 4: 178 Tellaloğlu, S 3: 122 Erdiş, E 2: 64; 4:150 Tekuzman, G 1:14 Erdoğru, T 3: 122 Tezcan, EF 3: 115 Erenus, M 1: 10,33; 2:59,90 Tolunay, Ş 2:88 Erkılınç, Ş 2: 64; 4:150 Topeli, A 1: 14 Ersoy, A 4: 160 Tutkun, A 1:18; 2: 74 Ersöz, Ö 2:54 Türkalp, I 2: 69; 4: 146 Erşahln, Ç 1:36 Türkeri, LN 4: 187 Ertem, D 3: 111 Türközkan, N 2:81 Eskitürk, A 1:27 UtkaTı, NZ 3: 102 Ferahköşe, 2 2:81 Üneri, C 1:18; 2:74 Fırat, D 1: 14 Üstün, M 2:64; 4: 150 Gençoğlu, A 1:6 Vahaboğlu, MH 2:78 Göğüş, Y 1:33 Yalçın, O 4: 160 Gözükara, i 3: 119 Yalçıner, A 1: 36 Grignon, DJ 4: 187 Yalın, A 4: 171 Gülkılık, A 2:64; 4: 150 Yeğen, BC 4: 178 Gürsel, B 3: 106 Yenilmez, E 4: 166 Hergenç, G 3: 119 Yıldırım, I 2:78 Kadıoğlu, A 3: 122 Yüksel, F 4:155 Kaptanağası, A 4: 146 Wolman, SR 4: 187
7 Contents of Volume VII Is Hypocapnia an Important Factor in Exercise - Induced Asthma? T.K. Özdemir / M. Artvinli / A. ûençoğlu 6 Comparison of the Efficacy of Lisuride Versus Bromocriptine in the Treatment of Hyperprolactinemia M. Erenus / M. Kır / L.C. Kutlay / S. Pekin 10 Prevalence of Hepatitis C Virus Antibody in Cancer Patients from Turkey A. Topeli / Ö. Özyılkan / E. Özyılkan / A. Kars / Q. Tekuzman E. Baltalı / B. Kayhan / H. Telatar / D. Fırat 14 The Effect of Antibiotic Therapy after Tonsillectomy A.Ç. Batman / A. Tutkun / B. Mamıkogiu / H. Korkmaz / C. Clneri 18 Risk Factors and Specific Stroke Types of Cerebrovascular Accident Cases at Marmara Medical School neurology Department H. Afşar / S. Aktan / C. Aykut 22 Isolation Rate of Unusual Bacterial Pathogens from Stool Cultures A.Eskitürk / Q. Söyletir 27 Single Dose Intravenous Ondansetron in the Prophylaxis of Postoperative nausea and Vomiting M. Erenus / Ö. Leylek / H. Canatay / M.A. Akman / Y. Qöğüş 33 Effect of Defibrotide on Cultured Endothelial Cell Cycle Progression Analysed by Flow Cytometry Ç. Erşahin / S. Bilsel / A. Yalçmer / K. Emerk 36 Facial Cleft and Maxillary Duplication A. Barutçu / C. Karaca / A. Atabey 40 Erythropoietin in the treatm ent of anaem ia of chronic renal failure İ.Ç. Özener / R.A. Lawrence / Ö. Ersöz / E. Akoğlu 54 The value of nonstress test in the assessm ent of fetal well being before 34 weeks of gestation - A pros pie ctive analysis M. Erenus / L. Kutlay / n. Ceyhan / S. Pekin 59 Color Doppler sonography in the differential diagnosis of ovarian m asses M. Üstün / Ş. Erkılınç / A. Oülkılık / M. Solak / E. Erdiş 64 Acute myocardial infarction risk predicted by serum levels of lipoprotein (a) in Turkish population E.C. Canbulat / I. Türkalp 69 The distribution of the nucleolar organiser regions in the dysplastic epithelial lesions and in the epidermoid carcinomas of the vocal cords Ç. Batman / A. Tutkun / A. Sav / B. Mamikogiu / H. Dizdar C. Üneri / M.A. Şehitoğlu 74 Nasopharyngeal carriage rate and antimicrobial resistance of Haemophilus influenzae in İstanbul - Türkiye M.H. Vahaboğlu / L. Mülazimoğlu / I. Yıldınm / V. Avkan / B. Taşer 78 Protective effects of verapiamil on experimental ischem ia - repierfusion - induced liver injury in cirrhotic rats Z. Ferahköşe / H. Hurlu / B.B. Menteş / H. Türközkan / A. Bilgehan / B. Çaycı 81 An intraabdominal troublemaker: Endometrioma Ö. Leylek / H. Ceyhan / T. Pekin / M. Kır / S. Pekin 86 Mature cystic teratom a with malignant degeneration T. Bilgin / C. Cengiz / Ş. Tolunay / H. Ozan ' 88 Ovarian cancer and reproduction M. Erenus 90
8 Alteration of com plem ent levels following thermal injury and surgery S. Arda / N.Z. Cantürk / N.Z. Utkan / M. Dülger 102 The effect of glycerol on static acoustic im pedance in Meniere's disease T. Sanoglu / B. Gürsel / E. Belgin 106 Transcranial Doppler sonography: Physiological influences on cerebral he modyn am ics E. Özek / D. Ertem / P. Karakoç / T. Kılıç / H. Bilgen N. Pamir /JM. Başaran 111 Inhibition of brain glutathione reductase by sodium arsenite N.L. Açan / E.F. Tezcan 115 Osteocalcin levels in Graves' disease and euthyroid controls Q. Hergenç / t. Gözükara 119 Intrapenile arterial anatomic details examined by color Doppler ultrasonography A. Kadıoglu / T. Erdoğru / S. Tellaloglu 122 Goodpasture's syndrome mimicking idiopathic pulmonary hem osiderosis B. Ceyhan / T. Çelikel / E. Akoğlu / Ç. Özener /Ö. Alpdoğan / Ş. Özgün 126 Bulbous urethral cyst in a man B. Çetinel / C. Öbek / V. Solok 130 Candida infections in ENT B. Ener 133 Plasma lipid peroxide levels in type II diabetics : Relationship with long term diabetic complications I. Türkalp / A. Kaptanağası 146 Color Doppler sonography in the differential diagnosis of uterine m asses M. Üstün / Ş. Erkılınç / A. Gülkılık / N. Solak / E. Erdiş / B. Arsan 150 Gunshot wounds to the face N. Durak / E. Kışlaoğlu / F. Yüksel / P. Peker / A. Özdemir 155 Radionuclide hysterosalpingography : Does it have a role in the m anagem ent of female infertility? I. Adalet / O. Yalçın / A. Ersoy / S. Eker / M. Sıralı / S. Cantez 160 Effects of nickel sulphate on rat testes sem iniferous tubules : An ultrastructural investigation E. Yenilmez / S. Arbak / T. Erbengi 166 Vincula tendineum and vascularisation of the flexor pollicis longus tendon A. Yalın / S. Çavdar / S. Arbak 171 Stress ulcer : A morphological approach S. Arbak / F. Şen / F. Ercan / İ. Alican / N. Aslan B. Ç. Yeğen / S. Oktay / K. Berkman 178 Combined polymerase chain reaction (PCR) and fluorescence in situ hybridization (FISH) analysis of Y chrom osom e loss related to age and disease status in prostate cancer L.N. Türkeri / W. Sakr / S.R. Wolman / M.A. Micale / D.J. Grignon I.J. Powell / J.E. Pontes / J.A. Macoska 187 Pycnodysostosis : Report of two cases A. Şenel / C. Rakunt / H. Akan / A. Tanık 192 Penile fracture with urethral injury B. Çetinel / E. Akkuş / O. Arar / V. Solok 196 Acknowledgement to the Reviewers Author index to Volume VII Contents of Volume VII
9 MARMARA MEDICAL JOURNAL INSTRUCTIONS TO AUTHORS 1. Manuscripts, letters and editorial correspondence should be sent to 'Editor. Marmara Medical Journal. Marmara University. Faculty of Medicine. Istanbul Turkey' by first class mail (airmail for overseas). 2. Submissions considered for publication are received with the understanding that no part of the submission has previously appeared elsewhere in any but abstract form. 3. Manuscripts should be typed double-spaced on standard site typewriter paper with margins of at least 2 5 cm This includes references, tables and figure legends The original typescript and two high quality copies of the manuscripts should be submitted 4. Number pages consecutively in order and place author (s) name, highest degree, institutional affiliations and address below the title 5. Marmara Medical Journal invites papers on original research, case reports, reviews, short communications for practical applications, let ters. editorials, book reviews and announcements The number of typewritten pages should not exceed 10 for original articles. 12 for reviews. 4 for case reports and I for letters 6 Original articles and research papers should normally be divided Into following sections.- A. ( I ) An informative summary for not more than 200 words must be included and should appear at the beginning of the paper. (2) Key words. (3) Introduction. (4) Materials and Methods. (5) Results. (6) Discussion.and (7) References B References must be typed in double spacing and numbered consecutively as they are cited The style of references is that of the Index Medicus List all authors when there are six or fewer, when there are seven or more, list the first three, then 'et a l\ Sample references follow: 1 Steward JH. Castaldi PA. Uremic bleeding: a reversible platelet defect corrected by dialysis. OJ Med. 1967: 36 : Bearn AG Wilson s Disease In: Stanbury JB. Wyngaarden JB. Fredrickson 05. id s The metabolic basic of inherited disease New York : McGraw Hill. 1972: Tables should be as few as possib.e and should include only essential data Tables should be typed in double spacing on separate sheets and have a legend for each Diagrams or illu s trations should be drawn w ith black Indian ink on w hite paper and should be given Roman numerals. Each illustration should be accompanied by a legend clearly describing it all legends should be grouped and typew ritten (double spaced) on a separate sheet of paper Photographs and photom icrographs should be unmounted high contrast glossy black on white prints and -should not be retouched Each photograph or illustration should be marked on the back w ith the name (s) of the author (s). should bear on indication of sequence number and the top should be marked w ith an arrow. All measurements should be given in metric units 8 Manuscripts are examined by the editorial board usually sent to out side referees The editor reserves the right to reject or to return the m anuscript to the author(s) for additional changes if all the guidelines and requirements are not uniform ly completed Only two copies o f the rejected papers are returned to the author (s) 9. Proofs will be subm itted to the author responsible for proof correction and shduld be re turned to the editor w ithin 5 days Major a lte r ations from the text cannot be accented 10. Correspondence and comm unications regarding manuscripts and ed.torial m aterial subscriptions and payments should be sent to The Editor Marmara Medical Journal Marmara University. Faculty of Medicine Haydarpaşa Istanbul.
STUDENT LOGBOOK. 1 week general practice course for the 6 th year medical students SEMMELWEIS EGYETEM. Name of the student:
STUDENT LOGBOOK 1 week general practice course for the 6 th year medical students Name of the student: Dates of the practice course: Name of the tutor: Address of the family practice: Tel: Please read
Mark Auspitz, Fayez Quereshy, Allan Okrainec, Alvina Tse, Sanjeev Sockalingam, Michelle Cleghorn, Timothy Jackson
Mark Auspitz, Fayez Quereshy, Allan Okrainec, Alvina Tse, Sanjeev Sockalingam, Michelle Cleghorn, Timothy Jackson Division of General Surgery, University Health Network, University of Toronto, Toronto,
3. MINTAFELADATSOR KÖZÉPSZINT. Az írásbeli vizsga időtartama: 30 perc. III. Hallott szöveg értése
Oktatáskutató és Fejlesztő Intézet TÁMOP-3.1.1-11/1-2012-0001 XXI. századi közoktatás (fejlesztés, koordináció) II. szakasz ANGOL NYELV 3. MINTAFELADATSOR KÖZÉPSZINT Az írásbeli vizsga időtartama: 30 perc
EN United in diversity EN A8-0206/419. Amendment
22.3.2019 A8-0206/419 419 Article 2 paragraph 4 point a point i (i) the identity of the road transport operator; (i) the identity of the road transport operator by means of its intra-community tax identification
Lexington Public Schools 146 Maple Street Lexington, Massachusetts 02420
146 Maple Street Lexington, Massachusetts 02420 Surplus Printing Equipment For Sale Key Dates/Times: Item Date Time Location Release of Bid 10/23/2014 11:00 a.m. http://lps.lexingtonma.org (under Quick
Supporting Information
Supporting Information Cell-free GFP simulations Cell-free simulations of degfp production were consistent with experimental measurements (Fig. S1). Dual emmission GFP was produced under a P70a promoter
Supplementary Table 1. Cystometric parameters in sham-operated wild type and Trpv4 -/- rats during saline infusion and
WT sham Trpv4 -/- sham Saline 10µM GSK1016709A P value Saline 10µM GSK1016709A P value Number 10 10 8 8 Intercontractile interval (sec) 143 (102 155) 98.4 (71.4 148) 0.01 96 (92 121) 109 (95 123) 0.3 Voided
Correlation & Linear Regression in SPSS
Petra Petrovics Correlation & Linear Regression in SPSS 4 th seminar Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Correlation
Mapping Sequencing Reads to a Reference Genome
Mapping Sequencing Reads to a Reference Genome High Throughput Sequencing RN Example applications: Sequencing a genome (DN) Sequencing a transcriptome and gene expression studies (RN) ChIP (chromatin immunoprecipitation)
PROSPECTIVE ASSESSMENT OF THE RISK OF BACTEREMIA IN CIRRHOTIC PATIENTS AFTER EUS WITH AND WITHOUT FNA
PROSPECTIVE ASSESSMENT OF THE RISK OF BACTEREMIA IN CIRRHOTIC PATIENTS AFTER EUS WITH AND WITHOUT FNA Fernández ndez-esparrach G, Gimeno-Garc García a AZ, Pellisé M, Almela M*, Sendino O, Zabalza M, Llach
Using the CW-Net in a user defined IP network
Using the CW-Net in a user defined IP network Data transmission and device control through IP platform CW-Net Basically, CableWorld's CW-Net operates in the 10.123.13.xxx IP address range. User Defined
Supplementary materials to: Whole-mount single molecule FISH method for zebrafish embryo
Supplementary materials to: Whole-mount single molecule FISH method for zebrafish embryo Yuma Oka and Thomas N. Sato Supplementary Figure S1. Whole-mount smfish with and without the methanol pretreatment.
ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP
ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP CHILD S DATA / GYERMEK ADATAI PLEASE FILL IN THIS INFORMATION WITH DATA BASED ON OFFICIAL DOCUMENTS / KÉRJÜK, TÖLTSE KI A HIVATALOS DOKUMENTUMOKBAN SZEREPLŐ ADATOK
Ultrasound biomicroscopy as a diagnostic method of corneal degeneration and inflammation
Ultrasound biomicroscopy as a diagnostic method of corneal degeneration and inflammation Ph.D. Thesis Ákos Skribek M.D. Department of Ophthalmology Faculty of Medicine University of Szeged Szeged, Hungary
USER MANUAL Guest user
USER MANUAL Guest user 1 Welcome in Kutatótér (Researchroom) Top menu 1. Click on it and the left side menu will pop up 2. With the slider you can make left side menu visible 3. Font side: enlarging font
A rosszindulatú daganatos halálozás változása 1975 és 2001 között Magyarországon
A rosszindulatú daganatos halálozás változása és között Eredeti közlemény Gaudi István 1,2, Kásler Miklós 2 1 MTA Számítástechnikai és Automatizálási Kutató Intézete, Budapest 2 Országos Onkológiai Intézet,
Correlation & Linear Regression in SPSS
Correlation & Linear Regression in SPSS Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise 1 - Correlation File / Open
ACTA AGRARIA DEBRECENIENSIS A kézirat elkészítésére vonatkozó elıírások
ACTA AGRARIA DEBRECENIENSIS A kézirat elkészítésére vonatkozó elıírások ACTA AGRARIA DEBRECENIENSIS Manuscript Editing Instructions (short version, see also the examples given in the full Hungarian version)
Cashback 2015 Deposit Promotion teljes szabályzat
Cashback 2015 Deposit Promotion teljes szabályzat 1. Definitions 1. Definíciók: a) Account Client s trading account or any other accounts and/or registers maintained for Számla Az ügyfél kereskedési számlája
First experiences with Gd fuel assemblies in. Tamás Parkó, Botond Beliczai AER Symposium 2009.09.21 25.
First experiences with Gd fuel assemblies in the Paks NPP Tams Parkó, Botond Beliczai AER Symposium 2009.09.21 25. Introduction From 2006 we increased the heat power of our units by 8% For reaching this
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel Timea Farkas Click here if your download doesn"t start
Construction of a cube given with its centre and a sideline
Transformation of a plane of projection Construction of a cube given with its centre and a sideline Exercise. Given the center O and a sideline e of a cube, where e is a vertical line. Construct the projections
Széchenyi István Egyetem www.sze.hu/~herno
Oldal: 1/6 A feladat során megismerkedünk a C# és a LabVIEW összekapcsolásának egy lehetőségével, pontosabban nagyon egyszerű C#- ban írt kódból fordítunk DLL-t, amit meghívunk LabVIEW-ból. Az eljárás
MELLÉKLET / ANNEX. EU MEGFELELŐSÉGI NYILATKOZAT-hoz for EU DECLARATION OF CONFORMITY
TRACON BUDAPEST KFT. TRACON BUDAPEST LTD. 2120 DUNAKESZI, PALLAG U. 23. TEL.: (27) 540-000, FAX: (27) 540-005 WWW.TRACON.HU EU MEGFELELŐSÉGI NYILATKOZAT, a 79/1997. (XII. 31.) IKIM számú és a 374/2012.
Néhány folyóiratkereső rendszer felsorolása és példa segítségével vázlatos bemutatása Sasvári Péter
Néhány folyóiratkereső rendszer felsorolása és példa segítségével vázlatos bemutatása Sasvári Péter DOI: http://doi.org/10.13140/rg.2.2.28994.22721 A tudományos közlemények írása minden szakma művelésének
Phenotype. Genotype. It is like any other experiment! What is a bioinformatics experiment? Remember the Goal. Infectious Disease Paradigm
It is like any other experiment! What is a bioinformatics experiment? You need to know your data/input sources You need to understand your methods and their assumptions You need a plan to get from point
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Correlation & Linear. Petra Petrovics.
Correlation & Linear Regression in SPSS Petra Petrovics PhD Student Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise
EXKLUZÍV AJÁNDÉKANYAGOD A Phrasal Verb hadsereg! 2. rész
A Phrasal Verb hadsereg! 2. rész FONTOS! Ha ennek az ajándékanyag sorozatnak nem láttad az 1. részét, akkor mindenképpen azzal kezdd! Fekete Gábor www.goangol.hu A sorozat 1. részét itt éred el: www.goangol.hu/ajandekok/phrasalverbs
Statistical Dependence
Statistical Dependence Petra Petrovics Statistical Dependence Deinition: Statistical dependence exists when the value o some variable is dependent upon or aected by the value o some other variable. Independent
Tudományos Ismeretterjesztő Társulat
Sample letter number 3. Russell Ltd. 57b Great Hawthorne Industrial Estate Hull East Yorkshire HU 19 5BV 14 Bebek u. Budapest H-1105 10 December, 2009 Ref.: complaint Dear Sir/Madam, After seeing your
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Nonparametric Tests
Nonparametric Tests Petra Petrovics Hypothesis Testing Parametric Tests Mean of a population Population proportion Population Standard Deviation Nonparametric Tests Test for Independence Analysis of Variance
Gottsegen National Institute of Cardiology. Prof. A. JÁNOSI
Myocardial Infarction Registry Pilot Study Hungarian Myocardial Infarction Register Gottsegen National Institute of Cardiology Prof. A. JÁNOSI A https://ir.kardio.hu A Web based study with quality assurance
On The Number Of Slim Semimodular Lattices
On The Number Of Slim Semimodular Lattices Gábor Czédli, Tamás Dékány, László Ozsvárt, Nóra Szakács, Balázs Udvari Bolyai Institute, University of Szeged Conference on Universal Algebra and Lattice Theory
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Hypothesis Testing. Petra Petrovics.
Hypothesis Testing Petra Petrovics PhD Student Inference from the Sample to the Population Estimation Hypothesis Testing Estimation: how can we determine the value of an unknown parameter of a population
CONCERTO COMMUNITIES IN EU DEALING WITH OPTIMAL THERMAL AND ELECTRICAL EFFICIENCY OF BUILDINGS AND DISTRICTS, BASED ON MICROGRIDS. WP 5 Del 5.
CONCERTO COMMUNITIES IN EU DEALING WITH OPTIMAL THERMAL AND ELECTRICAL EFFICIENCY OF BUILDINGS AND DISTRICTS, BASED ON MICROGRIDS WP 5 Del 5.14 1 st period Szentendre Papers and articles in specialist
Budapest By Vince Kiado, Klösz György
Budapest 1900 2000 By Vince Kiado, Klösz György Download Ebook : budapest 1900 2000 in PDF Format. also available for mobile reader If you are looking for a book Budapest 1900-2000 by Vince Kiado;Klosz
2. Local communities involved in landscape architecture in Óbuda
Év Tájépítésze pályázat - Wallner Krisztina 2. Közösségi tervezés Óbudán Óbuda jelmondata: Közösséget építünk, ennek megfelelően a formálódó helyi közösségeket bevonva fejlesztik a közterületeket. Békásmegyer-Ófaluban
(NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV
Kommunikációs rendszerek programozása (NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV (5. mérés) SIP telefonközpont készítése Trixbox-szal 1 Mérés helye: Széchenyi István Egyetem, L-1/7 laboratórium, 9026 Győr, Egyetem
Conference Proceeding
Conference Proceeding Publication in the conference book of IDK2016 is only available for applicants meeting the following criteria: The author or a co-author gave the presentation/poster-presentation
Word and Polygon List for Obtuse Triangular Billiards II
Word and Polygon List for Obtuse Triangular Billiards II Richard Evan Schwartz August 19, 2008 Abstract This is the list of words and polygons we use for our paper. 1 Notation To compress our notation
FAMILY STRUCTURES THROUGH THE LIFE CYCLE
FAMILY STRUCTURES THROUGH THE LIFE CYCLE István Harcsa Judit Monostori A magyar társadalom 2012-ben: trendek és perspektívák EU összehasonlításban Budapest, 2012 november 22-23 Introduction Factors which
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében. Dicse Jenő üzletfejlesztési igazgató
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében Dicse Jenő üzletfejlesztési igazgató How to apply modern e-learning to improve the training of firefighters Jenő Dicse Director of
EGÉSZSÉGTUDOMÁNY, LVII. ÉVFOLYAM, 2013. 4. SZÁM 2013/4
Part II: Seasonal variations in human infections with Puumula hantavirus in Styria II. rész: Évszakos változások a Puumula hantavirus okozta humán fertőzésekben Stájerországban PROF. SIXL WOLF DIETER,
Welcome to The survey visit and common nonconformities
QPA, e г l. We GPs. We д w d to be a GP. O νт n be a ch d þ a þ at, p or s, ŋ a ch d þ в be l x s. O νт n be a нt þ k, siŋ y X y or not, ŋ a нt þ x ch c e. GPs, д þat г l n t st t r нt s t storеs, рe w
FORGÁCS ANNA 1 LISÁNYI ENDRÉNÉ BEKE JUDIT 2
FORGÁCS ANNA 1 LISÁNYI ENDRÉNÉ BEKE JUDIT 2 Hátrányos-e az új tagállamok számára a KAP támogatások disztribúciója? Can the CAP fund distribution system be considered unfair to the new Member States? A
INTELLIGENT ENERGY EUROPE PROGRAMME BUILD UP SKILLS TRAINBUD. Quality label system
INTELLIGENT ENERGY EUROPE PROGRAMME BUILD UP SKILLS TRAINBUD WP4: Deliverable 4.5 Development of voluntary qualification system Quality label system 1 INTELLIGENT ENERGY EUROPE PROGRAMME BUILD UP SKILLS
Trinucleotide Repeat Diseases: CRISPR Cas9 PacBio no PCR Sequencing MFMER slide-1
Trinucleotide Repeat Diseases: CRISPR Cas9 PacBio no PCR Sequencing 2015 MFMER slide-1 Fuch s Eye Disease TCF 4 gene Fuchs occurs in about 4% of the US population. Leads to deteriorating vision without
Proxer 7 Manager szoftver felhasználói leírás
Proxer 7 Manager szoftver felhasználói leírás A program az induláskor elkezdi keresni az eszközöket. Ha van olyan eszköz, amely virtuális billentyűzetként van beállítva, akkor azokat is kijelzi. Azokkal
2. Tavasz Kupa. Uszonyos és Búvárúszó Verseny Kiírása
2. Tavasz Kupa Uszonyos és Búvárúszó Verseny Kiírása 1,/ A verseny célja: Az uszonyos-, és búvárúszás népszerűsítése, versenyzők részére versenyzési lehetőség biztosítása. 2,/ A verseny rendezője: HÓD
BKI13ATEX0030/1 EK-Típus Vizsgálati Tanúsítvány/ EC-Type Examination Certificate 1. kiegészítés / Amendment 1 MSZ EN 60079-31:2014
(1) EK-TípusVizsgálati Tanúsítvány (2) A potenciálisan robbanásveszélyes környezetben történő alkalmazásra szánt berendezések, védelmi rendszerek 94/9/EK Direktíva / Equipment or Protective Systems Intended
Intézményi IKI Gazdasági Nyelvi Vizsga
Intézményi IKI Gazdasági Nyelvi Vizsga Név:... Születési hely:... Születési dátum (év/hó/nap):... Nyelv: Angol Fok: Alapfok 1. Feladat: Olvasáskészséget mérő feladat 20 pont Olvassa el a szöveget és válaszoljon
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Factor Analysis
Factor Analysis Factor analysis is a multiple statistical method, which analyzes the correlation relation between data, and it is for data reduction, dimension reduction and to explore the structure. Aim
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY A feladatsor három részbol áll 1. A vizsgáztató társalgást kezdeményez a vizsgázóval. 2. A vizsgázó egy szituációs feladatban vesz részt a
INVITATION. The cost of adherence: quality of life and health economic impacts. Corvinus Health Policy and Health Economics Conference Series 2014/3
Corvinus Health Policy and Health Economics Conference Series 2014/3 Health Economics Study Circle, Health and Health Care Economics Section of the Hungarian Economic Association in cooperation with: Semmelweis
Statistical Inference
Petra Petrovics Statistical Inference 1 st lecture Descriptive Statistics Inferential - it is concerned only with collecting and describing data Population - it is used when tentative conclusions about
MINO V2 ÁLLVÁNY CSERÉJE V4-RE
MINO V2 remote controlled MINO V2 ÁLLVÁNY CSERÉJE V4-RE Mino V3 circuit board replacement Mino V2-V4 csere készlet ezüst Art# 59348S, Mino V2-V4 csere készlet fehér Art# 59348W V4 áramköri lap Art# 75914
TELJESÍTMÉNYNYILATKOZAT. sz HU
TELJESÍTMÉNYNYILATKOZAT sz. 0069 HU 1. A terméktípus egyedi azonosító kódja: fis her EA II feszítődü el 2. Felhasználás célja(i): Termék Fé dü elek eto a törté ő felhasználásra (nagy terhelhetőség Re deltetésszerű
Decision where Process Based OpRisk Management. made the difference. Norbert Kozma Head of Operational Risk Control. Erste Bank Hungary
Decision where Process Based OpRisk Management made the difference Norbert Kozma Head of Operational Risk Control Erste Bank Hungary About Erste Group 2010. 09. 30. 2 Erste Bank Hungary Erste Group entered
T Á J É K O Z T A T Ó. A 1108INT számú nyomtatvány a http://www.nav.gov.hu webcímen a Letöltések Nyomtatványkitöltő programok fülön érhető el.
T Á J É K O Z T A T Ó A 1108INT számú nyomtatvány a http://www.nav.gov.hu webcímen a Letöltések Nyomtatványkitöltő programok fülön érhető el. A Nyomtatványkitöltő programok fület választva a megjelenő
Tavaszi Sporttábor / Spring Sports Camp. 2016. május 27 29. (péntek vasárnap) 27 29 May 2016 (Friday Sunday)
Tavaszi Sporttábor / Spring Sports Camp 2016. május 27 29. (péntek vasárnap) 27 29 May 2016 (Friday Sunday) SZÁLLÁS / ACCOMODDATION on a Hotel Gellért*** szálloda 2 ágyas szobáiban, vagy 2x2 ágyas hostel
Kezelési útmutató. Vezetékes távirányító
Kezelési útmutató Vezetékes távirányító MODELL Ez az útmutató részletesen leírja, hogy az üzemeltetés 1 Bizt i el í ok1 2 3 Üzemmódok ismertetése 2 3 5 Telepítés4 6 11 Hibajelzések11 Függelék13 The following
KN-CP50. MANUAL (p. 2) Digital compass. ANLEITUNG (s. 4) Digitaler Kompass. GEBRUIKSAANWIJZING (p. 10) Digitaal kompas
KN-CP50 MANUAL (p. ) Digital compass ANLEITUNG (s. 4) Digitaler Kompass MODE D EMPLOI (p. 7) Boussole numérique GEBRUIKSAANWIJZING (p. 0) Digitaal kompas MANUALE (p. ) Bussola digitale MANUAL DE USO (p.
Lopocsi Istvánné MINTA DOLGOZATOK FELTÉTELES MONDATOK. (1 st, 2 nd, 3 rd CONDITIONAL) + ANSWER KEY PRESENT PERFECT + ANSWER KEY
Lopocsi Istvánné MINTA DOLGOZATOK FELTÉTELES MONDATOK (1 st, 2 nd, 3 rd CONDITIONAL) + ANSWER KEY PRESENT PERFECT + ANSWER KEY FELTÉTELES MONDATOK 1 st, 2 nd, 3 rd CONDITIONAL I. A) Egészítsd ki a mondatokat!
vancomycin CFSL cefepime CFPM cefozopran CZOP 4 cephem cefpirome CPR cefoselis Inhibitory Concentration FIC index
vancomycin cephem 1a 2 1 1 2 a : 15 4 15 15 9 5 1999 2 methicillin MRSA12 vancomycinvcm 4 cephem cefpiromecprcefoseliscfslcefepimecfpmcefozopranczop VCM CPR 12 77 75.5CFSL 82.4CFPM 81 79.4 CZOP 76 74.5
Computer Architecture
Computer Architecture Locality-aware programming 2016. április 27. Budapest Gábor Horváth associate professor BUTE Department of Telecommunications ghorvath@hit.bme.hu Számítógép Architektúrák Horváth
7 th Iron Smelting Symposium 2010, Holland
7 th Iron Smelting Symposium 2010, Holland Október 13-17 között került megrendezésre a Hollandiai Alphen aan den Rijn városában található Archeon Skanzenben a 7. Vasolvasztó Szimpózium. Az öt napos rendezvényen
SZÉKEK & FOTELEK CHAIRS & ARMCHAIRS
SZÉKEK & FOTELEK CHAIRS & ARMCHAIRS 1 Art&Deco Contemporary is a retail and interior design enterprise in one. As for our interior design department, we are focused on furniture design, and Art&Deco s
FIATAL MŰSZAKIAK TUDOMÁNYOS ÜLÉSSZAKA
FIATAL ŰSZAKIAK TUDOÁNYOS ÜLÉSSZAKA Kolozsvár, 1999. március 19-20. Zsákolt áruk palettázását végző rendszer szimulációs kapacitásvizsgálata Kádár Tamás Abstract This essay is based on a research work
Excel vagy Given-When-Then? Vagy mindkettő?
TESZT & TEA BUDAPEST AGILE MEETUP Pénzügyi számítások automatizált agilis tesztelése: Excel vagy Given-When-Then? Vagy mindkettő? NAGY GÁSPÁR TechTalk developer coach Budapest, 2014 február 6. SpecFlow
TELJESÍTMÉNYNYILATKOZAT. sz HU. Re deltetésszerű hasz álat. függelék, mellékletek B 1 - B 4
TELJESÍTMÉNYNYILATKOZAT sz. 0081 HU 1. A terméktípus egyedi azonosító kódja: fischer FAZ II horgonycsap 2. Felhasználás célja(i): Termék Nyo atéksza ályozott feszítődü el Re deltetésszerű hasz álat Repedezett
Art&Deco Contemporary is a retail and interior design enterprise in one. As for our interior design department,
OTTOMÁNOK OTTOMANS Art&Deco Contemporary is a retail and interior design enterprise in one. As for our interior design department, we are focused on furniture design, and Art&Deco s own collection has
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Nonparametric Tests. Petra Petrovics.
Nonparametric Tests Petra Petrovics PhD Student Hypothesis Testing Parametric Tests Mean o a population Population proportion Population Standard Deviation Nonparametric Tests Test or Independence Analysis
TestLine - Angol teszt Minta feladatsor
Minta felaatsor venég Téma: Általános szintfelmérő Aláírás:... Dátum: 2016.05.29 08:18:49 Kérések száma: 25 kérés Kitöltési iő: 1:17:27 Nehézség: Összetett Pont egység: +6-2 Értékelés: Alaértelmezett értékelés
FODOR MÓNIKA 1, RUDOLFNÉ KATONA MÁRIA 2, KARAKASNÉ MORVAY KLÁRA 3
FODOR MÓNIKA 1, RUDOLFNÉ KATONA MÁRIA 2, KARAKASNÉ MORVAY KLÁRA 3 Kihívások, fejlesztési lehetôségek a munkahelyi étkeztetésben a gazdasági válság hatására bekövetkezett változások tükrében Challenges
Szívkatéterek hajlékonysága, meghajlítása
Szívkatéterek hajlékonysága, meghajlítása Összefoglalás A szívkatéter egy olyan intravaszkuláris katéter, amelyet a szívbe vezetnek, ültetnek be diagnosztikus vagy terápiás célból. A katéterek felvezetés/eltávolítás
TELJESÍTMÉNYNYILATKOZAT. sz HU
TELJESÍTMÉNYNYILATKOZAT sz. 0036 HU 1. A terméktípus egyedi azonosító kódja: fis her FZEA II Zyko eütődü el 2. Felhasználás célja(i): Termék Fé dü elek eto a törté ő felhasz álásra agy terhelhetőség Re
Vállalati kockázatkezelés jelentősége
www.pwc.com/hu Vállalati kockázatkezelés jelentősége Fedor Péter 2013. szeptember 19. Miről lesz szó 1. Mi is az az ERM? 2. Miért fontos? 3. Gyakorlati sajátosságok PwC Magyarország Mi is az az ERM? PwC
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY A feladatsor három részből áll 1. A vizsgáztató társalgást kezdeményez a vizsgázóval. 2. A vizsgázó egy szituációs feladatban vesz részt a
A jövedelem alakulásának vizsgálata az észak-alföldi régióban az 1997-99. évi adatok alapján
A jövedelem alakulásának vizsgálata az észak-alföldi régióban az 1997-99. évi adatok alapján Rózsa Attila Debreceni Egyetem Agrártudományi Centrum, Agrárgazdasági és Vidékfejlesztési Intézet, Számviteli
Melyik stentgraftothasználjuk? Új, regiszter alapú prospektív tanulmány
Melyik stentgraftothasználjuk? Új, regiszter alapú prospektív tanulmány Menyhei Gábor PTE KK Érsebészeti Klinika Az ICVR (International Consortium of Vascular Registries) nevében StentgraftokAAA ellátására
Where are the parrots? (Hol vannak a papagájok?)
Where are the parrots? (Hol vannak a papagájok?) Hi Agents! This is your final test so get ready. Work your way through the exercises and when you have finished, the letters will spell out the name of
KELER KSZF Zrt. bankgarancia-befogadási kondíciói. Hatályos: 2014. július 8.
KELER KSZF Zrt. bankgarancia-befogadási kondíciói Hatályos: 2014. július 8. A KELER KSZF a nem-pénzügyi klíringtagjaitól, és az energiapiaci alklíringtagjaitól a KELER KSZF Általános Üzletszabályzata szerinti
4 vana, vanb, vanc1, vanc2
77 1) 2) 2) 3) 4) 5) 1) 2) 3) 4) 5) 16 12 7 17 4 8 2003 1 2004 7 3 Enterococcus 5 Enterococcus faecalis 1 Enterococcus avium 1 Enterococcus faecium 2 5 PCR E. faecium 1 E-test MIC 256 mg/ml vana MRSA MRSA
ATLS Student Course Schedule
American College of Surgeons & Magyar ATLS Munkacsoport & Szegedi Tudományegyetem Traumatológiai Klinika ATLS Student Course Schedule 25-27, November 2010 Szegedi Tudományegyetem Traumatológiai Klinika
A magyar racka juh tejének beltartalmi változása a laktáció alatt
A magyar racka juh tejének beltartalmi változása a laktáció alatt Nagy László Komlósi István Debreceni Egyetem Agrártudományi Centrum, Mezőgazdaságtudományi Kar, Állattenyésztés- és Takarmányozástani Tanszék,
Összefoglalás. Summary
Parlagoltatásos, zöld- és istállótrágyázásos vetésforgók összehasonlítása a talajtömörödöttség tükrében Szőllősi István Antal Tamás Nyíregyházi Főiskola, Műszaki és Mezőgazdasági Főiskolai Kar Jármű és
Utasítások. Üzembe helyezés
HASZNÁLATI ÚTMUTATÓ Üzembe helyezés Utasítások Windows XP / Vista / Windows 7 / Windows 8 rendszerben történő telepítéshez 1 Töltse le az AORUS makróalkalmazás telepítőjét az AORUS hivatalos webhelyéről.
1. MINTAFELADATSOR KÖZÉPSZINT. Az írásbeli vizsga időtartama: 30 perc. III. Hallott szöveg értése
Oktatáskutató és Fejlesztő Intézet TÁMOP-3.1.1-11/1-2012-0001 XXI. századi közoktatás (fejlesztés, koordináció) II. szakasz ANGOL NYELV 1. MINTAFELADATSOR KÖZÉPSZINT Az írásbeli vizsga időtartama: 30 perc
Szeretettel hívjuk, várjuk sporttársainkat az Eger Ünnepe és az Egri Senior Úszó-Klub fennállásának 25-ikévében rendezett versenyünkre
XIII. BITSKEY ALADÁR NEMZETKÖZI SENIOR ÚSZÓ EMLÉKVERSENY az Egri Csillag jegyében 25-ik éves az Egri Szenior Úszó Klub EGER, 2016. szeptember 18-19. Szeretettel hívjuk, várjuk sporttársainkat az Eger Ünnepe
KORRÓZIÓS FIGYELÕ korrózióvédelmi mûszaki tudományos folyóirat. Szerkeszti: a szerkesztõbizottság. A szerkesztõbizottság elnöke: Zanathy Valéria
LIII. évfolyam 3. szám 2013 KORRÓZIÓS FIGYELÕ korrózióvédelmi mûszaki tudományos folyóirat Szerkeszti: a szerkesztõbizottság A szerkesztõbizottság elnöke: Zanathy Valéria Dalmay Gábor Dr. Haskó Ferenc
Csípôízületi totál endoprotézis-beültetés lehetôségei csípôkörüli osteotomiát követôen
A Pécsi Orvostudományi Egyetem Ortopédiai Klinika közleménye Csípôízületi totál endoprotézis-beültetés lehetôségei csípôkörüli osteotomiát követôen DR. BELLYEI ÁRPÁD, DR. THAN PÉTER. DR. VERMES CSABA Érkezett:
NEVEZÉSI LAP I ENTRY FORM MARATON - váltó MARATHON - relay
NEVEZÉSI LAP I ENTRY FORM MARATON - váltó MARATHON - relay RAJTSZÁM / START NUMBER: (A rajtszámot a rendezőség tölti ki. / To be entered by the organisers:) Kérjük a nevezési lapot NYOMTATOTT BETŰVEL,
ANGOL NYELVI SZINTFELMÉRŐ 2013 A CSOPORT. on of for from in by with up to at
ANGOL NYELVI SZINTFELMÉRŐ 2013 A CSOPORT A feladatok megoldására 45 perc áll rendelkezésedre, melyből körülbelül 10-15 percet érdemes a levélírási feladatra szánnod. Sok sikert! 1. Válaszd ki a helyes
FÖLDRAJZ ANGOL NYELVEN
Földrajz angol nyelven középszint 1112 ÉRETTSÉGI VIZSGA 2014. május 15. FÖLDRAJZ ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI ÉRETTSÉGI VIZSGA JAVÍTÁSI-ÉRTÉKELÉSI ÚTMUTATÓ EMBERI ERŐFORRÁSOK MINISZTÉRIUMA Paper
Abigail Norfleet James, Ph.D.
Abigail Norfleet James, Ph.D. Left side of brain develops first in girls, right in boys o Probably source of girls verbal skills o And source of boys spatial skills Pre-frontal lobes Control impulses and
Szakmai továbbképzési nap akadémiai oktatóknak. 2012. december 14. HISZK, Hódmezővásárhely / Webex
Szakmai továbbképzési nap akadémiai oktatóknak 2012. december 14. HISZK, Hódmezővásárhely / Webex 14.00-15.00 15.00-15.30 15.30-15.40 Mai program 1. Amit feltétlenül ismernünk kell: az irányítótábla közelebbről.
Dr. Sasvári Péter Egyetemi docens
A KKV-k Informatikai Infrastruktúrájának vizsgálata a Visegrádi országokban The Analysis Of The IT Infrastructure Among SMEs In The Visegrád Group Of Countries Dr. Sasvári Péter Egyetemi docens MultiScience
Védősisak viselés és a kerékpáros fejsérülések összefüggése gyermekkorban
A Pécsi Tudományegyetem Gyermekklinika, Sebészeti Osztály, Pécs 1 és az LKH Gyermekklinika, Sebészeti Osztály, Graz 2 közleménye Védősisak viselés és a kerékpáros fejsérülések összefüggése gyermekkorban
Create & validate a signature
IOTA TUTORIAL 7 Create & validate a signature v.0.0 KNBJDBIRYCUGVWMSKPVA9KOOGKKIRCBYHLMUTLGGAV9LIIPZSBGIENVBQ9NBQWXOXQSJRIRBHYJ9LCTJLISGGBRFRTTWD ABBYUVKPYFDJWTFLICYQQWQVDPCAKNVMSQERSYDPSSXPCZLVKWYKYZMREAEYZOSPWEJLHHFPYGSNSUYRZXANDNQTTLLZA
Személyes adatváltoztatási formanyomtatvány- Magyarország / Personal Data Change Form - Hungary
Személyes adatváltoztatási formanyomtatvány- Magyarország / Personal Data Change Form - Hungary KITÖLTÉSI ÚTMUTATÓ: A formanyomtatványon a munkavállaló a személyes adatainak módosítását kezdeményezheti.