Basic Arrays. Contents. Chris Wild & Steven Zeil. May 28, Description 3
|
|
- Elemér Vass
- 6 évvel ezelőtt
- Látták:
Átírás
1 Chris Wild & Steven Zeil May 28, 2013 Contents 1 Description 3 1
2 2 Example 4 3 Tips 6 4 String Literals Description Example Tips Common Errors Using Arrays 13 CS333 2
3 1 Description Arrays are convenient for naming and using a collection of objects of the same type. For example, if you wanted to find the biggest of three integers you could name each integer individually, but if you wanted to store and find the biggest of a thousand integers, naming each integer is inconvenient to say the least. All the objects in an array must be of the same type (e.g. integers, floats, user defined objects, or even arrays themselves) An array has a fixed size which must be known at the time the array is defined. Each array has a unique name and each element in the array has a unique position. CS333 3
4 The position is designated by an integer expression called the array index. The positions in an array start at the integer 0 (the first element is at position 0) and goes to the size of the array 1. Thus an array with 3 elements has positions 0,1 and 2 To name an element in an array, use the array name followed by the position enclosed in square brackets ( [ and ] ) 2 Example int somearray [ 3 ] ; / / t h i s i s an array of three integers. somearray [ 0 ] = 567; / / s e t the f i r s t element in the array / / to the integer constant "567"; CS333 4
5 int someinteger = 4 ; / / t h i s i s NOT an array j u s t a plain / / integer with i n i t i a l value "4" somearray [ 1 ] = someinteger ; / / s e t s the second element in the / / array to the value " 4" / / At t h i s point the value of the third element of the / / array ( somearray [ 2 ] ) i s undefined float avector [ ] ; / / a vector of 100 floating point / / numbers, indexed from 0 to 99 avector [ 9 9 ] = 3. 4 ; / / s e t s the value of the l a s t element to 3.4 char astring [ 2 0 ] ; / / an array of characters i s also known as a string astring [ 9 ] = z ; / / s e t s the 10th character to z CS333 5
6 3 Tips Counting from 0 instead of 1 is strange at first and is the cause of errors. Why count from 0? think about this - how many single digits numbers are there in the decimal system? Answer: 10, the digits 0 through 9. If you start counting at 1 the last number would be "10" which requires two digits (thus more memory) then if you started counting at 0 and went to 9 for the 10th digit 0 is the first digit, 9 is the 10th digit The size of an array must be a constant (so that the compiler can known how much memory to allocate), however it can be any (practical) value. It is recommended CS333 6
7 that you define an integer constant and use that to define your arrays. - This allows the size of the array to change easily by changing the value of the constant. You will see more examples of this later on which better motivate the recommendation. const int SIZE_OF_SOME_ARRAY = 3 ; int somearray [SIZE_OF_SOME_ARRAY ] ; / / d e f i n e s an array of three elements Arrays are prone to several limitations and can be the source of errors in logic if misused. For more details check here 4 String Literals 4.1 Description When we write a "string" inside quotes, it is called a string literal, e.g., CS333 7
8 " This i s a string l i t e r a l " Oddly enough, this is not a std::string. String literals are actually done as nullterminated character arrays. "character arrays", because they are simply arrays of char "null-terminated", meaning that the final character in the string is an ASCII NUL character (the char of value zero). This character is "invisible" when printed, so it does not affect the visible appearance of the string. But when our code finds that zero value in the array, it knows that it has reached the end of the string. Strings that have been stored into a null-terminated aray are variously referred to as char arrays and C-strings. (The latter refers to the fact that this style of storage for strings is inherited from C++ s "parent" language, C.) CS333 8
9 Sadly, lots of people (including programmers and textbook authors who should know better) get pretty lax on this point, and frequently use the term "string" ambiguously to refer to both std::string and C-strings. A string literal is of type "const char *". (We have not yet introduced the * types in C++. For now it s enough to know that char* is pretty much the same as char[] and the "const" means that you can look at the individual characters inside a string literal, but you aren t allowed to change them.) You can input and output C-strings using the standard insertion «and extraction» operators on cin and cout. When outputting a C-string, the insertion operator stops at the null termination character CS333 9
10 When inputting a C-string, the extraction operator stops at the first whitespace character (e.g. blank, tab, new line) To include a double quote in a string literal put a backslash character \ before the double quote. This is called escaping the character. Other escape sequences include: character desired escape sequence description " \" double quote \ \\ backslash null character \0 Used as null termination character tab \t tab character new line \n new line character CS333 10
11 4.2 Example char name[ 4 ] = "Pam" ; / / need 4 characters don t f o r g e t the / / null termination character implicit at / / the end of a s t r i n g l i t e r a l name[ 0 ] = S ; / / changes name to "Sam" cout << name; / / prints out the s t r i n g "Sam" char anothername [ 6 ] ; / / unused array anothername [ 0 ] = name[ 0 ] ; / / copies the character S to anothername anothername [ 1 ] = name[ 1 ] ; / / copies the character a to anothername anothername [ 2 ] = name[ 2 ] ; / / copies the character m to anothername anothername [ 3 ] = name[ 3 ] ; / / copies the character \ 0 ( the null / / termination character ) to anothername CS333 11
12 cout << anothername ; / / prints out the s t r i n g "Sam" cin >> name; / / reads character up to the f i r s t / / white space, puts in name and adds null termination characte / / / / NOTE: assumes user types l e s s than 4 characters otherwise / / will overflow the array and lead to possible programming errors. / / / / This i s one of the reasons to avoid character arrays and to use / / the " s t r i n g " c l a s s. 4.3 Tips As a general rule, use C-strings/character arrays when you want to type a specific string within your code and to use it without modification. When you want to change strings, modify them, or pull pieces out of them, use a std::string. Remember to allocate an extra space for the null character when defining char arrays that hold null terminated strings CS333 12
13 There is an older C string library ( <cstring> ) for operating on character arrays to perform common string manipulation operations Input of C-strings is tricky because the compiler and run time system does not check to see if there is enough room for the input. 5 Common Errors Using Arrays There are several cases where array variables behave differently than regular C++ variables. For instance: You cannot use an array in an assignment statement (you can use an array element though) CS333 13
14 You cannot return an array as the return value of a function (you can return a pointer to an array) The size of an array is not an inherent property of it. When you pass an array to a function, the function in general has no idea how long it is. This is why C-strings (which are char arrays) are typically null terminated. The null termination character is one way to know where the string ends. Null termination does not work for other kinds of arrays. "0" is a "real" value typically used for purposes other than signaling the end of the array. Because the compiler and C++ run-time system do not know the size of an array, it is possible to attempt to access an element which is not in the array (by using an incorrect index value.). CS333 14
15 Accessing elements outside the array can lead to unpredictable results and is a serious error in logic. When reading in an array, it is possible to overwrite memory that does not belong to the array. CS333 15
16 Example: Common Errors / / the following statements are not allowed and w i l l cause compiler e r r o r s int a [ 1 0 ], b [ 1 0 ] ; a = b ; / / cannot assign an entire array visual c++ gives l e f t operand not a a [ 3 ] = b [ 3 ] ; / / t h i s i s OK int [ ] myfunction ( ) ; / / cannot return an entire array int * myfunction ( ) ; / / t h i s i s OK CS333 16
17 Example: Errors in Reading Arrays / / Examples in reading input char somestring [ 1 1 ] ; / / holds up to 10 characters plus the null character cin >> somestring ; / / reads next bunch of non whitespace characters into so / / i n s e r t s null character are end / / assumes that t h i s will be 10 or l e s s characters cin. g e t l i n e ( somestring, 1 1 ) ; / / reads at most 10 characters or until / / end of line / / i n s e r t s null character at end / / i f the line contains 9 or l e s s characters, the new line / / character i s removed / / i f the l i n e contains more than 9 characters, the extra / / characters ( i f any ) and the newline are kept. CS333 cin. get ( somestring, 1 1 ) ; / / reads17at most 10 characters or until end of lin / / i n s e r t s null character at end
Mapping Sequencing Reads to a Reference Genome
Mapping Sequencing Reads to a Reference Genome High Throughput Sequencing RN Example applications: Sequencing a genome (DN) Sequencing a transcriptome and gene expression studies (RN) ChIP (chromatin immunoprecipitation)
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel Timea Farkas Click here if your download doesn"t start
Széchenyi István Egyetem www.sze.hu/~herno
Oldal: 1/6 A feladat során megismerkedünk a C# és a LabVIEW összekapcsolásának egy lehetőségével, pontosabban nagyon egyszerű C#- ban írt kódból fordítunk DLL-t, amit meghívunk LabVIEW-ból. Az eljárás
Construction of a cube given with its centre and a sideline
Transformation of a plane of projection Construction of a cube given with its centre and a sideline Exercise. Given the center O and a sideline e of a cube, where e is a vertical line. Construct the projections
On The Number Of Slim Semimodular Lattices
On The Number Of Slim Semimodular Lattices Gábor Czédli, Tamás Dékány, László Ozsvárt, Nóra Szakács, Balázs Udvari Bolyai Institute, University of Szeged Conference on Universal Algebra and Lattice Theory
Tudományos Ismeretterjesztő Társulat
Sample letter number 5. International Culture Festival PO Box 34467 Harrogate HG 45 67F Sonnenbergstraße 11a CH-6005 Luzern Re: Festival May 19, 2009 Dear Ms Atkinson, We are two students from Switzerland
Using the CW-Net in a user defined IP network
Using the CW-Net in a user defined IP network Data transmission and device control through IP platform CW-Net Basically, CableWorld's CW-Net operates in the 10.123.13.xxx IP address range. User Defined
SQL/PSM kurzorok rész
SQL/PSM kurzorok --- 2.rész Tankönyv: Ullman-Widom: Adatbázisrendszerek Alapvetés Második, átdolgozott kiadás, Panem, 2009 9.3. Az SQL és a befogadó nyelv közötti felület (sormutatók) 9.4. SQL/PSM Sémában
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY A feladatsor három részbol áll 1. A vizsgáztató társalgást kezdeményez a vizsgázóval. 2. A vizsgázó egy szituációs feladatban vesz részt a
Computer Architecture
Computer Architecture Locality-aware programming 2016. április 27. Budapest Gábor Horváth associate professor BUTE Department of Telecommunications ghorvath@hit.bme.hu Számítógép Architektúrák Horváth
ANGOL NYELVI SZINTFELMÉRŐ 2013 A CSOPORT. on of for from in by with up to at
ANGOL NYELVI SZINTFELMÉRŐ 2013 A CSOPORT A feladatok megoldására 45 perc áll rendelkezésedre, melyből körülbelül 10-15 percet érdemes a levélírási feladatra szánnod. Sok sikert! 1. Válaszd ki a helyes
USER MANUAL Guest user
USER MANUAL Guest user 1 Welcome in Kutatótér (Researchroom) Top menu 1. Click on it and the left side menu will pop up 2. With the slider you can make left side menu visible 3. Font side: enlarging font
EN United in diversity EN A8-0206/419. Amendment
22.3.2019 A8-0206/419 419 Article 2 paragraph 4 point a point i (i) the identity of the road transport operator; (i) the identity of the road transport operator by means of its intra-community tax identification
Proxer 7 Manager szoftver felhasználói leírás
Proxer 7 Manager szoftver felhasználói leírás A program az induláskor elkezdi keresni az eszközöket. Ha van olyan eszköz, amely virtuális billentyűzetként van beállítva, akkor azokat is kijelzi. Azokkal
Lopocsi Istvánné MINTA DOLGOZATOK FELTÉTELES MONDATOK. (1 st, 2 nd, 3 rd CONDITIONAL) + ANSWER KEY PRESENT PERFECT + ANSWER KEY
Lopocsi Istvánné MINTA DOLGOZATOK FELTÉTELES MONDATOK (1 st, 2 nd, 3 rd CONDITIONAL) + ANSWER KEY PRESENT PERFECT + ANSWER KEY FELTÉTELES MONDATOK 1 st, 2 nd, 3 rd CONDITIONAL I. A) Egészítsd ki a mondatokat!
Minta ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA II. Minta VIZSGÁZTATÓI PÉLDÁNY
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA II. A feladatsor három részből áll VIZSGÁZTATÓI PÉLDÁNY 1. A vizsgáztató társalgást kezdeményez a vizsgázóval. 2. A vizsgázó egy szituációs feladatban vesz részt a
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY A feladatsor három részből áll 1. A vizsgáztató társalgást kezdeményez a vizsgázóval. 2. A vizsgázó egy szituációs feladatban vesz részt a
Relative Clauses Alárendelő mellékmondat
Relative Clauses Alárendelő mellékmondat We use relative clauses to give additional information about something without starting another sentence. By combining sentences with a relative clause, your text
(Asking for permission) (-hatok/-hetek?; Szabad ni? Lehet ni?) Az engedélykérés kifejezésére a következő segédigéket használhatjuk: vagy vagy vagy
(Asking for permission) (-hatok/-hetek?; Szabad ni? Lehet ni?) SEGÉDIGÉKKEL Az engedélykérés kifejezésére a következő segédigéket használhatjuk: vagy vagy vagy A fenti felsorolásban a magabiztosság/félénkség
Adatbázisok 1. Rekurzió a Datalogban és SQL-99
Adatbázisok 1 Rekurzió a Datalogban és SQL-99 Expressive Power of Datalog Without recursion, Datalog can express all and only the queries of core relational algebra. The same as SQL select-from-where,
There is/are/were/was/will be
There is/are/were/was/will be Forms - Képzése: [There + to be] [There + létige ragozott alakja] USE - HASZNÁLAT If you simply want to say that something exists or somebody is doing something then you start
ANGOL NYELVI SZINTFELMÉRŐ 2012 A CSOPORT. to into after of about on for in at from
ANGOL NYELVI SZINTFELMÉRŐ 2012 A CSOPORT A feladatok megoldására 45 perc áll rendelkezésedre, melyből körülbelül 10-15 percet érdemes a levélírási feladatra szánnod. Sok sikert! 1. Válaszd ki a helyes
Pénzügyi algoritmusok
Pénzügyi algoritmusok A C++ programozás alapjai Az Integrált Fejlesztői Környezet C++ alapok Az Integrált Fejlesztői Környezet Visual Studio 2013 Community Edition Kitekintés: fordítás Preprocesszor Fordító
Phenotype. Genotype. It is like any other experiment! What is a bioinformatics experiment? Remember the Goal. Infectious Disease Paradigm
It is like any other experiment! What is a bioinformatics experiment? You need to know your data/input sources You need to understand your methods and their assumptions You need a plan to get from point
ANGOL NYELVI SZINTFELMÉRŐ 2011 B CSOPORT. for on off by to at from
ANGOL NYELVI SZINTFELMÉRŐ 2011 B CSOPORT A feladatok megoldására 45 perc áll rendelkezésedre, melyből körülbelül 10-15 percet érdemes a levélírási feladatra szánnod. Megoldásaid a válaszlapra írd! Sok
Can/be able to. Using Can in Present, Past, and Future. A Can jelen, múlt és jövő idejű használata
Can/ Can is one of the most commonly used modal verbs in English. It be used to express ability or opportunity, to request or offer permission, and to show possibility or impossibility. A az egyik leggyakrabban
Genome 373: Hidden Markov Models I. Doug Fowler
Genome 373: Hidden Markov Models I Doug Fowler Review From Gene Prediction I transcriptional start site G open reading frame transcriptional termination site promoter 5 untranslated region 3 untranslated
Please stay here. Peter asked me to stay there. He asked me if I could do it then. Can you do it now?
Eredeti mondat Please stay here. Kérlek, maradj itt. Can you do it now? Meg tudod csinálni most? Will you help me tomorrow? Segítesz nekem holnap? I ll stay at home today. Ma itthon maradok. I woke up
Travel Getting Around
- Location I am lost. Not knowing where you are Can you show me where it is on the map? Asking for a specific location on a map Where can I find? Asking for a specific Eltévedtem. Meg tudná nekem mutatni
MATEMATIKA ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2016. október 18. MATEMATIKA ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2016. október 18. 8:00 I. Időtartam: 45 perc Pótlapok száma Tisztázati Piszkozati EMBERI ERŐFORRÁSOK MINISZTÉRIUMA
3. MINTAFELADATSOR KÖZÉPSZINT. Az írásbeli vizsga időtartama: 30 perc. III. Hallott szöveg értése
Oktatáskutató és Fejlesztő Intézet TÁMOP-3.1.1-11/1-2012-0001 XXI. századi közoktatás (fejlesztés, koordináció) II. szakasz ANGOL NYELV 3. MINTAFELADATSOR KÖZÉPSZINT Az írásbeli vizsga időtartama: 30 perc
Word and Polygon List for Obtuse Triangular Billiards II
Word and Polygon List for Obtuse Triangular Billiards II Richard Evan Schwartz August 19, 2008 Abstract This is the list of words and polygons we use for our paper. 1 Notation To compress our notation
Correlation & Linear Regression in SPSS
Petra Petrovics Correlation & Linear Regression in SPSS 4 th seminar Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Correlation
Create & validate a signature
IOTA TUTORIAL 7 Create & validate a signature v.0.0 KNBJDBIRYCUGVWMSKPVA9KOOGKKIRCBYHLMUTLGGAV9LIIPZSBGIENVBQ9NBQWXOXQSJRIRBHYJ9LCTJLISGGBRFRTTWD ABBYUVKPYFDJWTFLICYQQWQVDPCAKNVMSQERSYDPSSXPCZLVKWYKYZMREAEYZOSPWEJLHHFPYGSNSUYRZXANDNQTTLLZA
Website review acci.hu
Website review acci.hu Generated on September 30 2016 21:54 PM The score is 37/100 SEO Content Title Acci.hu - Ingyenes apróhirdető Length : 30 Perfect, your title contains between 10 and 70 characters.
TestLine - Angol teszt Minta feladatsor
Minta felaatsor venég Téma: Általános szintfelmérő Aláírás:... Dátum: 2016.05.29 08:18:49 Kérések száma: 25 kérés Kitöltési iő: 1:17:27 Nehézség: Összetett Pont egység: +6-2 Értékelés: Alaértelmezett értékelés
Utazás Szállás. Szállás - Keresés. Szállás - Foglalás. Útbaigazítás kérése. ... kiadó szoba?... a room to rent? szállásfajta.
- Keresés Hol találom a? Útbaigazítás kérése Where can I find?... kiadó szoba?... a room to rent?...hostel?... a hostel?... egy hotel?... a hotel?...bed and breakfast?...kemping? Milyenek az árak itt?
Előszó.2. Starter exercises. 3. Exercises for kids.. 9. Our comic...17
2011. december Tartalom Előszó.2 Starter exercises. 3 Exercises for kids.. 9 Our comic....17 1 Előszó Kedves angolul tanulók! A 2010/2011- es tanévben elkezdett újságunkat szeretnénk továbbra is szerkeszteni
KN-CP50. MANUAL (p. 2) Digital compass. ANLEITUNG (s. 4) Digitaler Kompass. GEBRUIKSAANWIJZING (p. 10) Digitaal kompas
KN-CP50 MANUAL (p. ) Digital compass ANLEITUNG (s. 4) Digitaler Kompass MODE D EMPLOI (p. 7) Boussole numérique GEBRUIKSAANWIJZING (p. 0) Digitaal kompas MANUALE (p. ) Bussola digitale MANUAL DE USO (p.
Tudományos Ismeretterjesztő Társulat
Sample letter number 1. Vancouver English Centre 47. Zoltán u. 840 Have St, Suite 200 Budapest Vancouver BC V6Z 212 H-1114 Canada Ref.: application 15 Januar, 2010 Dear Sir/Madam, I have just read your
Intézményi IKI Gazdasági Nyelvi Vizsga
Intézményi IKI Gazdasági Nyelvi Vizsga Név:... Születési hely:... Születési dátum (év/hó/nap):... Nyelv: Angol Fok: Alapfok 1. Feladat: Olvasáskészséget mérő feladat 20 pont Olvassa el a szöveget és válaszoljon
A vitorlázás versenyszabályai a 2013-2016. évekre angol-magyar nyelvű kiadásának változási és hibajegyzéke
A vitorlázás versenyszabályai a 2013-2016. évekre angol-magyar nyelvű kiadásának változási és hibajegyzéke A dokumentum A vitorlázás versenyszabályai a 2013-2016. évekre angol-magyar nyelvű kiadásában
Statistical Inference
Petra Petrovics Statistical Inference 1 st lecture Descriptive Statistics Inferential - it is concerned only with collecting and describing data Population - it is used when tentative conclusions about
ios alkalmazásfejlesztés Koltai Róbert
ios alkalmazásfejlesztés Koltai Róbert robert.koltai@ponte.hu Mi az a block? Utasítások sorozata { }-ek között, amit egy objektumként tuduk kezelni. ios 4.0 és Mac OSX 10.6 óta 2 Egy példa a felépítésére
EXKLUZÍV AJÁNDÉKANYAGOD A Phrasal Verb hadsereg! 2. rész
A Phrasal Verb hadsereg! 2. rész FONTOS! Ha ennek az ajándékanyag sorozatnak nem láttad az 1. részét, akkor mindenképpen azzal kezdd! Fekete Gábor www.goangol.hu A sorozat 1. részét itt éred el: www.goangol.hu/ajandekok/phrasalverbs
Angol érettségi témakörök 12.KL, 13.KM, 12.F
Angol érettségi témakörök 12.KL, 13.KM, 12.F TÉMÁK VIZSGASZINTEK Középszint 1. Személyes vonatkozások, család - A vizsgázó személye, életrajza, életének fontos állomásai (fordulópontjai) - Családi élet,
Lexington Public Schools 146 Maple Street Lexington, Massachusetts 02420
146 Maple Street Lexington, Massachusetts 02420 Surplus Printing Equipment For Sale Key Dates/Times: Item Date Time Location Release of Bid 10/23/2014 11:00 a.m. http://lps.lexingtonma.org (under Quick
T Á J É K O Z T A T Ó. A 1108INT számú nyomtatvány a http://www.nav.gov.hu webcímen a Letöltések Nyomtatványkitöltő programok fülön érhető el.
T Á J É K O Z T A T Ó A 1108INT számú nyomtatvány a http://www.nav.gov.hu webcímen a Letöltések Nyomtatványkitöltő programok fülön érhető el. A Nyomtatványkitöltő programok fület választva a megjelenő
AZ ACM NEMZETKÖZI PROGRAMOZÓI VERSENYE
AZ ACM NEMZETKÖZI PROGRAMOZÓI VERSENYE Kuki Attila, kuki@math.klte.hu Kossuth Lajos Tudományegyetem, Információ Technológia Tanszék Abstract This paper is dedicated to the Scholastic Programming Contest
INDEXSTRUKTÚRÁK III.
2MU05_Bitmap.pdf camü_ea INDEXSTRUKTÚRÁK III. Molina-Ullman-Widom: Adatbázisrendszerek megvalósítása Panem, 2001könyv 5.4. Bittérkép indexek fejezete alapján Oracle: Indexek a gyakorlatban Oracle Database
STUDENT LOGBOOK. 1 week general practice course for the 6 th year medical students SEMMELWEIS EGYETEM. Name of the student:
STUDENT LOGBOOK 1 week general practice course for the 6 th year medical students Name of the student: Dates of the practice course: Name of the tutor: Address of the family practice: Tel: Please read
16F628A megszakítás kezelése
16F628A megszakítás kezelése A 'megszakítás' azt jelenti, hogy a program normális, szekvenciális futása valamilyen külső hatás miatt átmenetileg felfüggesztődik, és a vezérlést egy külön rutin, a megszakításkezelő
1. Gyakorlat: Telepítés: Windows Server 2008 R2 Enterprise, Core, Windows 7
1. Gyakorlat: Telepítés: Windows Server 2008 R2 Enterprise, Core, Windows 7 1.1. Új virtuális gép és Windows Server 2008 R2 Enterprise alap lemez létrehozása 1.2. A differenciális lemezek és a két új virtuális
MATEMATIKA ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2016. május 3. MATEMATIKA ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2016. május 3. 8:00 I. Időtartam: 45 perc Pótlapok száma Tisztázati Piszkozati EMBERI ERŐFORRÁSOK MINISZTÉRIUMA Matematika
mondat ami nélkül ne indulj el külföldre
51 mondat ami nélkül ne indulj el külföldre 51 mondat ami nélkül ne indulj el külföldre 1. Good morning / afternoon / evening. Jó reggelt / napot / estét. 2. How are you? / How is it going? Hogy van? /
Contact us Toll free (800) fax (800)
Table of Contents Thank you for purchasing our product, your business is greatly appreciated. If you have any questions, comments, or concerns with the product you received please contact the factory.
PIACI HIRDETMÉNY / MARKET NOTICE
PIACI HIRDETMÉNY / MARKET NOTICE HUPX DAM Másnapi Aukció / HUPX DAM Day-Ahead Auction Iktatási szám / Notice #: Dátum / Of: 18/11/2014 HUPX-MN-DAM-2014-0023 Tárgy / Subject: Változások a HUPX másnapi piac
Tudok köszönni tegezve és önözve, és el tudok búcsúzni. I can greet people in formal and informal ways. I can also say goodbye to them.
Mérleg Your checklist Az alábbiakban a MagyarOK 1. tankönyv témáinak listáját találja. A mondatok mellett a kapcsolódó oldalak és gyakorlatok számát is megadtuk, hogy megkönnyítsük az ismétlést. This document
Cluster Analysis. Potyó László
Cluster Analysis Potyó László What is Cluster Analysis? Cluster: a collection of data objects Similar to one another within the same cluster Dissimilar to the objects in other clusters Cluster analysis
Eladni könnyedén? Oracle Sales Cloud. Horváth Tünde Principal Sales Consultant 2014. március 23.
Eladni könnyedén? Oracle Sales Cloud Horváth Tünde Principal Sales Consultant 2014. március 23. Oracle Confidential Internal/Restricted/Highly Restricted Safe Harbor Statement The following is intended
Az Open Data jogi háttere. Dr. Telek Eszter
Az Open Data jogi háttere Dr. Telek Eszter Egy kis ismétlés Open Data/Open Access/Open Knowledge gyökerei Open Source Software FLOSS (Free Libre Open Source Software) Szoftver esetében egyszerű alapok:
Ültetési és öntözési javaslatok. Planting and watering instructions
Ültetési és öntözési javaslatok Planting and watering instructions 1 Önöntöző-rendszer Sub-irrigation 2 Kedves növénykedvelő A LECHUZA önöntöző rendszerrel növényeink természetüknél fogva gyönyörű virágokat
bab.la Cümle Kalıpları: İş Sipariş İngilizce-Macarca
bab.la Cümle Kalıpları: İş Sipariş İngilizce-Macarca Sipariş : Verme We are considering the purchase of Gondolkozunk a... vásárlásán. Resmi, çekingen We are pleased to place an order with your company
bab.la Cümle Kalıpları: İş Sipariş Macarca-İngilizce
bab.la Cümle Kalıpları: İş Sipariş Macarca-İngilizce Sipariş : Verme Gondolkozunk a... vásárlásán. We are considering the purchase of Resmi, çekingen Örömmel tudatjuk, hogy szeretnénk Önöktől rendelni...
MATEMATIKA ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2017. október 17. MATEMATIKA ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2017. október 17. 8:00 I. Időtartam: 57 perc Pótlapok száma Tisztázati Piszkozati EMBERI ERŐFORRÁSOK MINISZTÉRIUMA
Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz
Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz Kvantumkapuk, áramkörök 2016. március 3. A kvantummechanika posztulátumai (1-2) 1. Állapotleírás Zárt fizikai rendszer aktuális állapota
Léptetőmotorok. Előnyök: Hátrányok:
Léptetőmotorok A léptetőmotorok lényeges tulajdonsága, hogy egy körülforduláshoz hány lépés szükséges. Ezt megadhatják fokban, ekkor az egy lépésre eső szögelfordulást adják meg. Illetve megadhatják az
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Factor Analysis
Factor Analysis Factor analysis is a multiple statistical method, which analyzes the correlation relation between data, and it is for data reduction, dimension reduction and to explore the structure. Aim
Performance Modeling of Intelligent Car Parking Systems
Performance Modeling of Intelligent Car Parking Systems Károly Farkas Gábor Horváth András Mészáros Miklós Telek Technical University of Budapest, Hungary EPEW 2014, Florence, Italy Outline Intelligent
Utasítások. Üzembe helyezés
HASZNÁLATI ÚTMUTATÓ Üzembe helyezés Utasítások Windows XP / Vista / Windows 7 / Windows 8 rendszerben történő telepítéshez 1 Töltse le az AORUS makróalkalmazás telepítőjét az AORUS hivatalos webhelyéről.
1. MINTAFELADATSOR KÖZÉPSZINT. Az írásbeli vizsga időtartama: 30 perc. III. Hallott szöveg értése
Oktatáskutató és Fejlesztő Intézet TÁMOP-3.1.1-11/1-2012-0001 XXI. századi közoktatás (fejlesztés, koordináció) II. szakasz ANGOL NYELV 1. MINTAFELADATSOR KÖZÉPSZINT Az írásbeli vizsga időtartama: 30 perc
KELET-ÁZSIAI DUPLANÁDAS HANGSZEREK ÉS A HICHIRIKI HASZNÁLATA A 20. SZÁZADI ÉS A KORTÁRS ZENÉBEN
Liszt Ferenc Zeneművészeti Egyetem 28. számú művészet- és művelődéstörténeti tudományok besorolású doktori iskola KELET-ÁZSIAI DUPLANÁDAS HANGSZEREK ÉS A HICHIRIKI HASZNÁLATA A 20. SZÁZADI ÉS A KORTÁRS
Budapest By Vince Kiado, Klösz György
Budapest 1900 2000 By Vince Kiado, Klösz György Download Ebook : budapest 1900 2000 in PDF Format. also available for mobile reader If you are looking for a book Budapest 1900-2000 by Vince Kiado;Klosz
Longman Exams Dictionary egynyelvű angol szótár nyelvvizsgára készülőknek
Longman Exams Dictionary egynyelvű angol szótár nyelvvizsgára készülőknek Egynyelvű angol nagyszótár haladó nyelvtanulóknak és nyelvvizsgázóknak 212,000 szócikkel A szótárban minden definíció egyszerű
Tavaszi Sporttábor / Spring Sports Camp. 2016. május 27 29. (péntek vasárnap) 27 29 May 2016 (Friday Sunday)
Tavaszi Sporttábor / Spring Sports Camp 2016. május 27 29. (péntek vasárnap) 27 29 May 2016 (Friday Sunday) SZÁLLÁS / ACCOMODDATION on a Hotel Gellért*** szálloda 2 ágyas szobáiban, vagy 2x2 ágyas hostel
ANGOL NYELVI SZINTFELMÉRŐ 2014 A CSOPORT
ANGOL NYELVI SZINTFELMÉRŐ 2014 A CSOPORT A feladatok megoldására 45 perc áll rendelkezésedre, melyből körülbelül 10-15 percet érdemes a fogalmazási feladatra szánnod. Megoldásaid a válaszlapra írd! 1.
RPC Remote Procedure Call Távoli eljárás hívás
RPC Remote Procedure Call Távoli eljárás hívás Hagyományos eljáráshívás: Count = read (fd, buf, nbytes) Paraméterek átadásának a típusai: - Érték szerinti átadás - Referencia szerinti átadás - Másoló/visszatöltő
Adatbázis-kezelés ODBC driverrel
ADATBÁZIS-KEZELÉS ODBC DRIVERREL... 1 ODBC: OPEN DATABASE CONNECTIVITY (NYÍLT ADATBÁZIS KAPCSOLÁS)... 1 AZ ODBC FELÉPÍTÉSE... 2 ADATBÁZIS REGISZTRÁCIÓ... 2 PROJEKT LÉTREHOZÁSA... 3 A GENERÁLT PROJEKT FELÉPÍTÉSE...
(NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV
Kommunikációs rendszerek programozása (NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV (5. mérés) SIP telefonközpont készítése Trixbox-szal 1 Mérés helye: Széchenyi István Egyetem, L-1/7 laboratórium, 9026 Győr, Egyetem
C# nyelv alapjai. Krizsán Zoltán 1. Objektumorientált programozás C# alapokon tananyag. Általános Informatikai Tanszék Miskolci Egyetem
C# nyelv alapjai Krizsán Zoltán 1 Általános Informatikai Tanszék Miskolci Egyetem Objektumorientált programozás C# alapokon tananyag Tartalom Bevezetés Lokális változó Utasítások Szójáték Why do all real
Véges szavak általánosított részszó-bonyolultsága
Véges szavak általánosított részszó-bonyolultsága KÁSA Zoltán Sapientia Erdélyi Magyar Tudományegyetem Kolozsvár Marosvásárhely Csíkszereda Matematika-Informatika Tanszék, Marosvásárhely Budapest, 2010.
3. MINTAFELADATSOR EMELT SZINT. Az írásbeli vizsga időtartama: 30 perc. III. Hallott szöveg értése
Oktatáskutató és Fejlesztő Intézet TÁMOP-3.1.1-11/1-2012-0001 XXI. századi közoktatás (fejlesztés, koordináció) II. szakasz ANGOL NYELV 3. MINTAFELADATSOR EMELT SZINT Az írásbeli vizsga időtartama: 30
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében. Dicse Jenő üzletfejlesztési igazgató
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében Dicse Jenő üzletfejlesztési igazgató How to apply modern e-learning to improve the training of firefighters Jenő Dicse Director of
MATEMATIKA ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2015. május 5. MATEMATIKA ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2015. május 5. 8:00 I. Időtartam: 45 perc Pótlapok száma Tisztázati Piszkozati EMBERI ERŐFORRÁSOK MINISZTÉRIUMA Matematika
KIEGÉSZÍTŽ FELADATOK. Készlet Bud. Kap. Pápa Sopr. Veszp. Kecsk. 310 4 6 8 10 5 Pécs 260 6 4 5 6 3 Szomb. 280 9 5 4 3 5 Igény 220 200 80 180 160
KIEGÉSZÍTŽ FELADATOK (Szállítási probléma) Árut kell elszállítani három telephelyr l (Kecskemét, Pécs, Szombathely) öt területi raktárba, melyek Budapesten, Kaposváron, Pápán, Sopronban és Veszprémben
Lesson 1 On the train
Let's Learn Hungarian! Lesson notes Lesson 1 On the train Dialogue for Lesson 1 (formal speech): Guard: Jó napot kívánok. Jó napot. Guard: Az útlevelét, kérem. Tessék. Guard: Köszönöm. Hmmmm, amerikai?
A teszt a következő diával indul! The test begins with the next slide!
A teszt a következő diával indul! The test begins with the next slide! A KÖVETKEZŐKBEN SZÁMOZOTT KÉRDÉSEKET VAGY KÉPEKET LÁT SZÁMOZOTT KÉPLETEKKEL. ÍRJA A SZÁMOZOTT KÉRDÉSRE ADOTT VÁLASZT, VAGY A SZÁMOZOTT
It Could be Worse. tried megpróbált while miközben. terrifying. curtain függöny
7. It Could be Worse Duncan tried not to look at his wife while he read his newspaper, but he knew that she was looking directly at him, and he knew that she was not happy. It could be worse, he said quietly,
Tudományos Ismeretterjesztő Társulat
Sample letter number 3. Russell Ltd. 57b Great Hawthorne Industrial Estate Hull East Yorkshire HU 19 5BV 14 Bebek u. Budapest H-1105 10 December, 2009 Ref.: complaint Dear Sir/Madam, After seeing your
Emelt szint SZÓBELI VIZSGA VIZSGÁZTATÓI PÉLDÁNY VIZSGÁZTATÓI. (A részfeladat tanulmányozására a vizsgázónak fél perc áll a rendelkezésére.
Emelt szint SZÓBELI VIZSGA VIZSGÁZTATÓI PÉLDÁNY VIZSGÁZTATÓI PÉLDÁNY A feladatsor három részből áll 1. A vizsgáztató társalgást kezdeményez a vizsgázóval. 2. A vizsgázó egy vita feladatban vesz részt a
discosnp demo - Peterlongo Pierre 1 DISCOSNP++: Live demo
discosnp demo - Peterlongo Pierre 1 DISCOSNP++: Live demo Download and install discosnp demo - Peterlongo Pierre 3 Download web page: github.com/gatb/discosnp Chose latest release (2.2.10 today) discosnp
Minden amerikanisztika szakos vegye fel az az alábbi elıadásokat (a
Frissítve: aug 29. Tanszéki honlap: http://elteal.ieas-szeged.hu/ Tájékoztató elsıéves BA angol/amerikanisztika és angol/amerikanisztika minor szakos diákoknak az ıszi félévrıl Elıadások: Minden angol
ENGLISH 24 English is fun Letter #1 Letters In the age of e-mails and cell phones writing a letter might seem out of fashion. However, learners of a foreign language should know how to do it. Here you
Abigail Norfleet James, Ph.D.
Abigail Norfleet James, Ph.D. Left side of brain develops first in girls, right in boys o Probably source of girls verbal skills o And source of boys spatial skills Pre-frontal lobes Control impulses and
JEROMOS A BARATOM PDF
JEROMOS A BARATOM PDF ==> Download: JEROMOS A BARATOM PDF JEROMOS A BARATOM PDF - Are you searching for Jeromos A Baratom Books? Now, you will be happy that at this time Jeromos A Baratom PDF is available
boolean motoros_szelep_vegallas_el = true; boolean serial_adatok_kikuldese = true; // ************ Hőmérséklet érzékelők Dallasos!!!!
#include #include #include #include #include #include #include boolean motoros_szelep_vegallas_el = true;
A évi fizikai Nobel-díj
A 2012. évi fizikai Nobel-díj "for ground-breaking experimental methods that enable measuring and manipulation of individual quantum systems" Serge Haroche David Wineland Ecole Normale Superieure, Párizs
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Hypothesis Testing. Petra Petrovics.
Hypothesis Testing Petra Petrovics PhD Student Inference from the Sample to the Population Estimation Hypothesis Testing Estimation: how can we determine the value of an unknown parameter of a population
MOZGÓKÉPKULTÚRA ÉS MÉDIAISMERET ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2010. május 20. MOZGÓKÉPKULTÚRA ÉS MÉDIAISMERET ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2010. május 20. 14:00 Az írásbeli vizsga időtartama: 180 perc Pótlapok száma Tisztázati Piszkozati
7. Bemutatom a barátomat, Pétert. 8. Hogy hívják Önt? 9. Nagyon örülök, hogy találkoztunk. 10. Nem értem Önt. 11. Kérem, beszéljen lassabban.
1. Magyar vagyok. 7. Bemutatom a barátomat, Pétert. 13. Ért Ön engem? 2. Ön honnan jött? Te honnan jöttél? 8. Hogy hívják Önt? 14. Kérem, betűzze a nevét! 3 Beszél Ön angolul? 9. Nagyon örülök, hogy találkoztunk.