Zeeman Eect. University of Basel Department of Physics. Fortgeschrittenenpraktikum I/II. October 5, Abstract
|
|
- Ede Horváth
- 5 évvel ezelőtt
- Látták:
Átírás
1 University of Basel Department of Physics Zeeman Eect Fortgeschrittenenpraktikum I/II October 5, 2018 Abstract The goal of this experiment is to observe and understand the transverse and longitudinal Zeeman eect. Therefore, the splitting of the two σ-lines in the transverse Zeeman eect will be measured. Further, Bohr's magneton is determined and the light emitted along the direction of the magnetic eld, the longitudinal Zeeman eect, will be qualitatively analyzed. 1
2 Contents 1 Theory 3 2 Setup 8 3 Measurements and Analysis 10 2
3 Introduction The Zeeman eect describes the splitting up of the central spectral lines of atoms when a magnetic eld is applied. The normal Zeeman eect is the simplest, it describes the splitting up of one spectral line into three components. A cadmium spectral lamp is used. The splitting up of the red cadmium line (643.8nm) is investigated with a Fabry-Perot interferometer by applying dierent magnetic ux densities. The Bohr's magneton can be yielded from the evaluation of the results. 1 Theory In 1862 Michael Faraday unsuccessfully investigated if a magnetic eld changes the spectrum of colored ames. Only in 1885 Belgian Fievez was able to show this eect. This was forgotten until it was rediscovered by Pieter Zeeman in He worked together with Hendrik Lorentz. The measurements of this experiment were important for the development of atomic shell theory. The splitting of the Cd-spectral line λ=643.8nm into three lines is called Lorentz triplets. This occurs due to the fact that the Cd-atom represents a singlet system with spin S=0. In absence of a magnetic eld there exists only one transition between D and P (see Figure 1), the 643.8nm transition. 3
4 Figure 1: Splitting up of the central spectral lines into the components due to magnetic eld. Figure 2: Longitudinal and transverse Zeeman eect. The magnetic eld causes the energy level to split up into 2L+1 components. Radiation transitions between the components are possible if the selection rules M L = +1 M L = 0 M L = 1 are fullled. There are nine permitted transitions in total which can be assigned to three dierent energies, three transitions for each energy. Thus, only three lines will be visible. The rst three transitions with M L = 1 give a σ-line whose light is vertically polarized to the magnetic eld (see Figure 2). The light of the second group with M L = 0 is parallel and the light of the M L = +1 is again vertically polarized to the magnetic eld. Each ring which could be observed without a magnetic eld splits up into three rings when a magnetic eld is applied perpendicular to the light. Due to the dierent polarization of the rings an analyzer can be used to lter out the π-lines or the σ-lines depending on the analyzer's polarization. If the analyzer is in vertical position only the σ-lines are visible and if it is horizontal orientated the π-lines can be 4
5 observed exclusively. This is the transverse Zeeman eect. The polarization of the light propagating parallel to the magnetic eld is circular. This means independent of the position of the analyzer two rings appear. In the case of the transverse Zeeman eect the splitting of the two σ-lines increases with the magnetic eld strength. The splitting can be analyzed by an Fabry-Perot interferometer. It is characterized in terms of numbers of wavelengths with a precision of 0.002nm. The Fabry-Perot ètalon consists of two parallel at glass plates separated by a distance t (see Figure 3). The surfaces pointing inside are coated with a partially transmitting metallic layer. Figure 3: Transmitted and reected rays at the étalon's parallel surfaces (1) and (2). Figure 4: Focusing of the light coming from the Fabry-Pérot étalon. The light is focused onto a ring with the radius r = fθ, with Θ being the incident angle of the light into the étalon and f the focal length of the lens. An incident ray under the angle Θ with respect to the normal to the glass plates is split into the paths AB, CD, EF, etc. The path dierence between for example AB and CD is where BK is normal to CD. δ = BC + CK This leads to CK = BC cos 2Θ and BC cos Θ = t δ = BCK = BC(1 + cos 2Θ) = 2BC cos 2 Θ = 2t cos Θ and for constructive interference 5
6 nλ = 2t cos Θ must be fullled with n an integer. If the refractive index of the medium between the glass plates is µ 1 the formula needs to be modied: nλ = 2µt cos Θ. (1) Equation 1 is called the basic interferometer equation. To focus the parallel rays B,D,F, etc. they are focused with the help of a lens with the focal length f (see Figure 4). If Θ obeys Equation 1 the radius of the rings appearing in the focal plane are given by r n = f tan Θ n fθ n. (2) Equation 2 is only valid for small angle, that means for rays nearly parallel to the optical axis. Since with n = 2µt ( λ cos Θ n = n 0 cos Θ 0 = n sin 2 Θ ) n 2 the nal formula is ( ) n = n 0 1 Θ2 n 2 n 0 = 2µt λ or Θ n = 2(n 0 n) n 0 (3) The center interference n 0 is in general not an integer. n 1 describes the interference of the rst ring, with n 1 < n 0 due to n 1 = n 0 cos Θ 1. n 0 can be expressed through the nearest integer n 1 n = n 0 ɛ 0 < ɛ < 1. Therefore, the p-th ring of the interference pattern has n p = (n 0 ɛ) (p 1). (4) 6
7 Using Equation 2, 3 and 4 one gets the radii of the rings r p = 2f 2 n 0 (p 1) + ɛ. (5) The dierence between the squares of the radii of two adjacent rings is constant: r 2 p+1 r 2 p = 2f 2 n 0 (6) ɛ can be determined by plotting r 2 p versus p and extrapolating to r 2 p = 0. In the case where the spectral line is split into two components with wavelength λ a and λ b, the components will have fractional orders at the center ɛ a and ɛ b : ɛ a = 2µt λ a n 1,a = 2µtv a n 1,a ɛ b = 2µt λ b n 1,b = 2µtv b n 1,b n 1,a and n 1,b are the interference orders of the rst ring. If the rings do not completely overlap n 1,a = n 1,b. Thus, the dierence between the wave numbers of two components is v = v a v b = ɛ a ɛ b 2µt (7) From Equation 5 and 6 one gets r 2 p+1,a r 2 p+1 r 2 p p = ɛ (8) For the components a and b this yields r 2 p+1,a r 2 p+1,a r 2 p,a p = ɛ a r 2 p+1,b r 2 p+1,b r2 p,b p = ɛ b By substituting the last result into Equation 7 one gets the dierence of the wave numbers: ( v = 1 r 2 p+1,a 2µt rp+1,a 2 rp,a 2 r 2 p+1,b r 2 p+1,b r2 p,b ) (9) From Equation 6 one knows that the dierence of the radii component a squared is equal to one of component b. 7
8 p+1,p a = r 2 p+1,a r 2 p,a = 2f 2 n 0,a p+1,p b = r 2 p+1,b r 2 p,b = 2f 2 n 0,b Thus, whatever the value of p is, p+1,p a = p+1,p b and similar all values δ p+1,p a,b = r 2 p+1,a r 2 p+1,b must be equal. δ and denote the average dierences of the waver numbers of the components a and b, setting µ = 1. This leads to the evidence that v is neither depending on the dimension of the radii not the amplication of the interference pattern. v = 1 δ 2t (10) 2 Setup Figure 5: Experimental setup. 8
9 The electromagnet is placed on a rotating table what enables to switch between transverse and longitudinal Zeeman measurements (see Figure 5). The two poleshoes with holes in it are mounted in way that a gap of 9mm remains for the Cd-lamp (see Figure 6). The pole-shoes must be tightened such that they do not move during the experiments where a magnetic eld is applied. The Cd-lamp is connected to the power supply and put into the the gap without touching the pole-shoes. The coils of the electromagnet are connected in parallel and with an ammeter in between to the variable power supply (up to 20VDC, 12A). To smooth the DC-voltage a 22'000µF capacitor is installed in parallel to the power output. For the investigation of the line splitting several optical components are necessary (see Figure 6). The diaphragm is only used for the transverse Zeeman eect where it acts as light source. The lens L 1 together with an internal lens (f=100mm) of the ètalon create a nearly parallel light beam which is needed for proper interference pattern. An interchangeable color lter of the ètalon lters the 643.8nm cadmium line out. Lens L 2 focuses the interference pattern of rings on the screen. The ring pattern is observed through lens L 3 and the ring diameters can be measured with the scale. The scale can be moved with a precision of 1/100 of an millimeter. Figure 6: Scheme of the optical components The rotating table together with the electromagnet, the pole-shoes and the Cd-lamp are installed at a height of 16cm. With the help of the spirit level the electromagnet is brought into a perfectly horizontal position. The optical bench with all elements as in Figure 6 except for the iris diaphragm is placed closer to the electromagnet, such that one of the outlet holes of the pole-shoes is placed where the diaphragm usually is. L 1 is adjusted in a way that the outlet is in its focus. After, all other optical components are readjusted too. The current through the coils is set to 8A for some time and the interference pattern in axial direction is observed through L 3. With a last adjustment of the ètalon (slightly left/right) and displacement of L 2 a sharp and centered pattern is generated. The slash of the scale representing "0" should be in the center of the most inner ring. 9
10 Now, the electromagnet is rotated by 90, the diaphragm is inserted and the analyzer is turned until the π-line disappears and the two σ-lines appear. 3 Measurements and Analysis First the calibration of the magnetic ux needs to be done. A teslameter is used to determine the magnetic ux at the gap where usually the Cd-lamp is. The measured values for the magnetic ux are plotted against the applied electric current to the coils (see Figure 7). Figure 7: Magnetic ux B in between the two Helmholtz coils, where for the measurements a Cd-lamp is installed, depending on the coil current. 1. When a proper ring pattern is achieved the diameter of a ring can be measured. To do so the scale is shifted horizontally until the "0" slash of the scale for example crosses the fourth ring to the left. A magnetic eld corresponding to a 4A coil current is applied and the splitting of the rings observed. The analyzer is orientated vertically what causes only the σ-lines to appear. The "0" slash is brought to the middle of the outer ring. Next, the inner σ-line is measured and so forth until the "0" slash is placed at the outer σ-line of the fourth ring to the right. The last reading minus the rst reading divided by two provides the radius r 4,b. With the same method the radii of the other rings r 4,a, r 3,b, r 3,a, r 2,b, r 2,a, r 1,b and r 1,a should be evaluated. Further measurements should be done with the same method but with dierent coil currents, for instance 5A, 6A, 8A and 10A. 10
11 2. The wave number dierence of a σ-line with respect to the central line is v/2. The energy of the radiation electrons changes by E = E L,ML E L 1,ML 1 = hc v 2. (11) The change in energy E is proportional to the magnetic ux density B with the Bohr's magneton µ B as proportionality: E = µ B B (12) Extract the Bohr's magneton from the measured data. The literature value for the Bohr's magneton is µ B,Lit. = (9.273)10 24 J T. 3. For the observation of the longitudinal Zeeman eect the electromagnet is turned by 90. When a magnetic eld is applied (8A coil current) each ring splits up into two, no matter at which position the analyzer is. To show that the light of longitudinal Zeeman eect is circular polarized a λ/4 plate is used to transfer into circular polarized light. When the optical axis of the λ/4 plate is vertically orientated and the analyzer is placed at an angle of +45 with respect to the vertical axis, one ring disappears. If the analyzer is installed with an angle of -45 the other ring disappears. Explain the eect. Note: All gures are taken from PHYWE LEP
Construction of a cube given with its centre and a sideline
Transformation of a plane of projection Construction of a cube given with its centre and a sideline Exercise. Given the center O and a sideline e of a cube, where e is a vertical line. Construct the projections
Correlation & Linear Regression in SPSS
Petra Petrovics Correlation & Linear Regression in SPSS 4 th seminar Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Correlation
On The Number Of Slim Semimodular Lattices
On The Number Of Slim Semimodular Lattices Gábor Czédli, Tamás Dékány, László Ozsvárt, Nóra Szakács, Balázs Udvari Bolyai Institute, University of Szeged Conference on Universal Algebra and Lattice Theory
Statistical Dependence
Statistical Dependence Petra Petrovics Statistical Dependence Deinition: Statistical dependence exists when the value o some variable is dependent upon or aected by the value o some other variable. Independent
Statistical Inference
Petra Petrovics Statistical Inference 1 st lecture Descriptive Statistics Inferential - it is concerned only with collecting and describing data Population - it is used when tentative conclusions about
Using the CW-Net in a user defined IP network
Using the CW-Net in a user defined IP network Data transmission and device control through IP platform CW-Net Basically, CableWorld's CW-Net operates in the 10.123.13.xxx IP address range. User Defined
Create & validate a signature
IOTA TUTORIAL 7 Create & validate a signature v.0.0 KNBJDBIRYCUGVWMSKPVA9KOOGKKIRCBYHLMUTLGGAV9LIIPZSBGIENVBQ9NBQWXOXQSJRIRBHYJ9LCTJLISGGBRFRTTWD ABBYUVKPYFDJWTFLICYQQWQVDPCAKNVMSQERSYDPSSXPCZLVKWYKYZMREAEYZOSPWEJLHHFPYGSNSUYRZXANDNQTTLLZA
Supporting Information
Supporting Information Cell-free GFP simulations Cell-free simulations of degfp production were consistent with experimental measurements (Fig. S1). Dual emmission GFP was produced under a P70a promoter
Correlation & Linear Regression in SPSS
Correlation & Linear Regression in SPSS Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise 1 - Correlation File / Open
Cluster Analysis. Potyó László
Cluster Analysis Potyó László What is Cluster Analysis? Cluster: a collection of data objects Similar to one another within the same cluster Dissimilar to the objects in other clusters Cluster analysis
FÖLDRAJZ ANGOL NYELVEN
Földrajz angol nyelven középszint 0821 ÉRETTSÉGI VIZSGA 2009. május 14. FÖLDRAJZ ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI ÉRETTSÉGI VIZSGA JAVÍTÁSI-ÉRTÉKELÉSI ÚTMUTATÓ OKTATÁSI ÉS KULTURÁLIS MINISZTÉRIUM Paper
A golyók felállítása a Pool-biliárd 8-as játékának felel meg. A golyók átmérıje 57.2 mm. 15 számozott és egy fehér golyó. Az elsı 7 egyszínő, 9-15-ig
A golyók elhelyezkedése a Snooker alaphelyzetet mutatja. A golyók átmérıje 52 mm, egyszínőek. 15 db piros, és 1-1 db fehér, fekete, rózsa, kék, barna, zöld, sárga. A garázsban állítjuk fel, ilyenkor az
PIACI HIRDETMÉNY / MARKET NOTICE
PIACI HIRDETMÉNY / MARKET NOTICE HUPX DAM Másnapi Aukció / HUPX DAM Day-Ahead Auction Iktatási szám / Notice #: Dátum / Of: 18/11/2014 HUPX-MN-DAM-2014-0023 Tárgy / Subject: Változások a HUPX másnapi piac
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Correlation & Linear. Petra Petrovics.
Correlation & Linear Regression in SPSS Petra Petrovics PhD Student Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise
KN-CP50. MANUAL (p. 2) Digital compass. ANLEITUNG (s. 4) Digitaler Kompass. GEBRUIKSAANWIJZING (p. 10) Digitaal kompas
KN-CP50 MANUAL (p. ) Digital compass ANLEITUNG (s. 4) Digitaler Kompass MODE D EMPLOI (p. 7) Boussole numérique GEBRUIKSAANWIJZING (p. 0) Digitaal kompas MANUALE (p. ) Bussola digitale MANUAL DE USO (p.
Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz
Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz Kvantumkapuk, áramkörök 2016. március 3. A kvantummechanika posztulátumai (1-2) 1. Állapotleírás Zárt fizikai rendszer aktuális állapota
Performance Modeling of Intelligent Car Parking Systems
Performance Modeling of Intelligent Car Parking Systems Károly Farkas Gábor Horváth András Mészáros Miklós Telek Technical University of Budapest, Hungary EPEW 2014, Florence, Italy Outline Intelligent
16F628A megszakítás kezelése
16F628A megszakítás kezelése A 'megszakítás' azt jelenti, hogy a program normális, szekvenciális futása valamilyen külső hatás miatt átmenetileg felfüggesztődik, és a vezérlést egy külön rutin, a megszakításkezelő
Széchenyi István Egyetem www.sze.hu/~herno
Oldal: 1/6 A feladat során megismerkedünk a C# és a LabVIEW összekapcsolásának egy lehetőségével, pontosabban nagyon egyszerű C#- ban írt kódból fordítunk DLL-t, amit meghívunk LabVIEW-ból. Az eljárás
PETER PAZMANY CATHOLIC UNIVERSITY Consortium members SEMMELWEIS UNIVERSITY, DIALOG CAMPUS PUBLISHER
SEMMELWEIS UNIVERSITY PETER PAMANY CATLIC UNIVERSITY Development of Complex Curricula for Molecular Bionics and Infobionics Programs within a consortial* framework** Consortium leader PETER PAMANY CATLIC
First experiences with Gd fuel assemblies in. Tamás Parkó, Botond Beliczai AER Symposium 2009.09.21 25.
First experiences with Gd fuel assemblies in the Paks NPP Tams Parkó, Botond Beliczai AER Symposium 2009.09.21 25. Introduction From 2006 we increased the heat power of our units by 8% For reaching this
Kezdőlap > Termékek > Szabályozó rendszerek > EASYLAB és TCU-LON-II szabályozó rendszer LABCONTROL > Érzékelő rendszerek > Típus DS-TRD-01
Típus DS-TRD FOR EASYLAB FUME CUPBOARD CONTROLLERS Sash distance sensor for the variable, demand-based control of extract air flows in fume cupboards Sash distance measurement For fume cupboards with vertical
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Factor Analysis
Factor Analysis Factor analysis is a multiple statistical method, which analyzes the correlation relation between data, and it is for data reduction, dimension reduction and to explore the structure. Aim
Contact us Toll free (800) fax (800)
Table of Contents Thank you for purchasing our product, your business is greatly appreciated. If you have any questions, comments, or concerns with the product you received please contact the factory.
Supplementary Table 1. Cystometric parameters in sham-operated wild type and Trpv4 -/- rats during saline infusion and
WT sham Trpv4 -/- sham Saline 10µM GSK1016709A P value Saline 10µM GSK1016709A P value Number 10 10 8 8 Intercontractile interval (sec) 143 (102 155) 98.4 (71.4 148) 0.01 96 (92 121) 109 (95 123) 0.3 Voided
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 200. május 4. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 200. május 4. 8:00 Az írásbeli vizsga időtartama: 80 perc Pótlapok száma Tisztázati Piszkozati OKTATÁSI
A katalógusban szereplő adatok változásának jogát fenntartjuk. 2015. 02-es kiadás
RUGÓKATALÓGUS A Biotek Kft. több mint 20 év tudásával és tapasztalatával valamint kiváló minőségű rögzítéstechnikai és gépépítő elemek nagy választékával kínál megoldásokat termékek tervezéséhez és gyártásához.
Utasítások. Üzembe helyezés
HASZNÁLATI ÚTMUTATÓ Üzembe helyezés Utasítások Windows XP / Vista / Windows 7 / Windows 8 rendszerben történő telepítéshez 1 Töltse le az AORUS makróalkalmazás telepítőjét az AORUS hivatalos webhelyéről.
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2015. május 19. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2015. május 19. 8:00 Az írásbeli vizsga időtartama: 180 perc Pótlapok száma Tisztázati Piszkozati EMBERI
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Hypothesis Testing. Petra Petrovics.
Hypothesis Testing Petra Petrovics PhD Student Inference from the Sample to the Population Estimation Hypothesis Testing Estimation: how can we determine the value of an unknown parameter of a population
A évi fizikai Nobel-díj
A 2012. évi fizikai Nobel-díj "for ground-breaking experimental methods that enable measuring and manipulation of individual quantum systems" Serge Haroche David Wineland Ecole Normale Superieure, Párizs
Phenotype. Genotype. It is like any other experiment! What is a bioinformatics experiment? Remember the Goal. Infectious Disease Paradigm
It is like any other experiment! What is a bioinformatics experiment? You need to know your data/input sources You need to understand your methods and their assumptions You need a plan to get from point
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2013. május 23. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2013. május 23. 8:00 Az írásbeli vizsga időtartama: 180 perc Pótlapok száma Tisztázati Piszkozati EMBERI
Supplementary materials to: Whole-mount single molecule FISH method for zebrafish embryo
Supplementary materials to: Whole-mount single molecule FISH method for zebrafish embryo Yuma Oka and Thomas N. Sato Supplementary Figure S1. Whole-mount smfish with and without the methanol pretreatment.
7 th Iron Smelting Symposium 2010, Holland
7 th Iron Smelting Symposium 2010, Holland Október 13-17 között került megrendezésre a Hollandiai Alphen aan den Rijn városában található Archeon Skanzenben a 7. Vasolvasztó Szimpózium. Az öt napos rendezvényen
Hogyan szűrjük a röntgensugarat?
Hogyan szűrjük a röntgensugarat? (A röntgencsőegység állandó szűrésének nemzetközi szabványáról) Porubszky Tamás OSSKI Munkahelyi Sugáregészségügyi Osztály E-mail: porubszky@osski.hu 1 IEC 60522 (IEC 522):
4-42 ELECTRONICS WX210 - WX240
4-42 ELECTRONICS WX210 - WX240 PCS 40000499-en Fig. 8 WX210 - WX240 ELECTRONICS 4-43 PCS COMPONENTS 40000471-en Load-limit regulator Legend Fig. 1 Fig. 2 1 Power supply 2 PWM1 output, proportional valve
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2011. május 13. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2011. május 13. 8:00 Az írásbeli vizsga időtartama: 180 perc Pótlapok száma Tisztázati Piszkozati NEMZETI
T Á J É K O Z T A T Ó. A 1108INT számú nyomtatvány a http://www.nav.gov.hu webcímen a Letöltések Nyomtatványkitöltő programok fülön érhető el.
T Á J É K O Z T A T Ó A 1108INT számú nyomtatvány a http://www.nav.gov.hu webcímen a Letöltések Nyomtatványkitöltő programok fülön érhető el. A Nyomtatványkitöltő programok fület választva a megjelenő
Mapping Sequencing Reads to a Reference Genome
Mapping Sequencing Reads to a Reference Genome High Throughput Sequencing RN Example applications: Sequencing a genome (DN) Sequencing a transcriptome and gene expression studies (RN) ChIP (chromatin immunoprecipitation)
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2012. május 25. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2012. május 25. 8:00 Az írásbeli vizsga időtartama: 180 perc Pótlapok száma Tisztázati Piszkozati NEMZETI
Ültetési és öntözési javaslatok. Planting and watering instructions
Ültetési és öntözési javaslatok Planting and watering instructions 1 Önöntöző-rendszer Sub-irrigation 2 Kedves növénykedvelő A LECHUZA önöntöző rendszerrel növényeink természetüknél fogva gyönyörű virágokat
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2008. május 26. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA 2008. május 26. 8:00 Az írásbeli vizsga időtartama: 180 perc Pótlapok száma Tisztázati Piszkozati OKTATÁSI
A vitorlázás versenyszabályai a 2013-2016. évekre angol-magyar nyelvű kiadásának változási és hibajegyzéke
A vitorlázás versenyszabályai a 2013-2016. évekre angol-magyar nyelvű kiadásának változási és hibajegyzéke A dokumentum A vitorlázás versenyszabályai a 2013-2016. évekre angol-magyar nyelvű kiadásában
Csatlakozás a BME eduroam hálózatához Setting up the BUTE eduroam network
Csatlakozás a BME eduroam hálózatához Setting up the BUTE eduroam network Table of Contents Windows 7... 2 Windows 8... 6 Windows Phone... 11 Android... 12 iphone... 14 Linux (Debian)... 20 Sebők Márton
HAMBURG Használati útmutató Vezérlőmodul UKSM 24VDC Cikkszám: 260.033
HABURG Használati útmutató Vezérlőmodul UKS 24VDC Cikkszám: 260.033 Brandschutz-Technik und Rauchabzug GmbH Schnackenburgallee 41d D-22525 Hamburg Germany +49 40 89 71 20-0 Fax: +49 40 89 71 20-20 Internet:
USER MANUAL Guest user
USER MANUAL Guest user 1 Welcome in Kutatótér (Researchroom) Top menu 1. Click on it and the left side menu will pop up 2. With the slider you can make left side menu visible 3. Font side: enlarging font
THS710A, THS720A, THS730A & THS720P TekScope Reference
THS710A, THS720A, THS730A & THS720P TekScope Reference 070-9741-01 Getting Started 1 Connect probes or leads. 2 Choose SCOPE 3 or METER mode. Press AUTORANGE. Copyright Tektronix, Inc. Printed in U.S.A.
MAKING MODERN LIVING POSSIBLE. Danfoss Heating Solutions
MAKING MODERN LIVING POSSIBLE Danfoss Danfoss Link Link HC Hidronikus HC Hydronic szabályozó Controller Szerelési Installation útmutató Guide Danfoss Heating Solutions Szerelési útmutató Tartalomjegyzék
3. MINTAFELADATSOR KÖZÉPSZINT. Az írásbeli vizsga időtartama: 30 perc. III. Hallott szöveg értése
Oktatáskutató és Fejlesztő Intézet TÁMOP-3.1.1-11/1-2012-0001 XXI. századi közoktatás (fejlesztés, koordináció) II. szakasz ANGOL NYELV 3. MINTAFELADATSOR KÖZÉPSZINT Az írásbeli vizsga időtartama: 30 perc
Flowering time. Col C24 Cvi C24xCol C24xCvi ColxCvi
Flowering time Rosette leaf number 50 45 40 35 30 25 20 15 10 5 0 Col C24 Cvi C24xCol C24xCvi ColxCvi Figure S1. Flowering time in three F 1 hybrids and their parental lines as measured by leaf number
Computer Architecture
Computer Architecture Locality-aware programming 2016. április 27. Budapest Gábor Horváth associate professor BUTE Department of Telecommunications ghorvath@hit.bme.hu Számítógép Architektúrák Horváth
Adatbázisok 1. Rekurzió a Datalogban és SQL-99
Adatbázisok 1 Rekurzió a Datalogban és SQL-99 Expressive Power of Datalog Without recursion, Datalog can express all and only the queries of core relational algebra. The same as SQL select-from-where,
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében. Dicse Jenő üzletfejlesztési igazgató
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében Dicse Jenő üzletfejlesztési igazgató How to apply modern e-learning to improve the training of firefighters Jenő Dicse Director of
A rosszindulatú daganatos halálozás változása 1975 és 2001 között Magyarországon
A rosszindulatú daganatos halálozás változása és között Eredeti közlemény Gaudi István 1,2, Kásler Miklós 2 1 MTA Számítástechnikai és Automatizálási Kutató Intézete, Budapest 2 Országos Onkológiai Intézet,
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Nonparametric Tests. Petra Petrovics.
Nonparametric Tests Petra Petrovics PhD Student Hypothesis Testing Parametric Tests Mean o a population Population proportion Population Standard Deviation Nonparametric Tests Test or Independence Analysis
HAL SST CL P 30 W 230 V E14
HAL SST CL P 30 W CLASSIC SUPERSTAR P Halogen lamps, classic mini-ball shape Areas of application _ General illumination _ Mood lighting _ Entrance lighting _ Mirror lighting Product benefits _ Simple
Háromfázisú generátor Háromfázisú áram előállítása
Háromfázisú generátor Háromfázisú áram előállítása S1 1 Tartósín, L=325 mm, mágneses DS102-3G S1 2 Futósín, h=70 mm DS103-7G S1 1 Csapágy, csúszótalpon keresztfurattal DS402-3B S1 2 Tekercstartó csappal
FÖLDRAJZ ANGOL NYELVEN GEOGRAPHY
Földrajz angol nyelven középszint 0623 ÉRETTSÉGI VIZSGA 2007. május 15. FÖLDRAJZ ANGOL NYELVEN GEOGRAPHY KÖZÉPSZINTŰ ÍRÁSBELI ÉRETTSÉGI VIZSGA INTERMEDIATE LEVEL WRITTEN EXAM JAVÍTÁSI-ÉRTÉKELÉSI ÚTMUTATÓ
Léptetőmotorok. Előnyök: Hátrányok:
Léptetőmotorok A léptetőmotorok lényeges tulajdonsága, hogy egy körülforduláshoz hány lépés szükséges. Ezt megadhatják fokban, ekkor az egy lépésre eső szögelfordulást adják meg. Illetve megadhatják az
Néhány folyóiratkereső rendszer felsorolása és példa segítségével vázlatos bemutatása Sasvári Péter
Néhány folyóiratkereső rendszer felsorolása és példa segítségével vázlatos bemutatása Sasvári Péter DOI: http://doi.org/10.13140/rg.2.2.28994.22721 A tudományos közlemények írása minden szakma művelésének
Genome 373: Hidden Markov Models I. Doug Fowler
Genome 373: Hidden Markov Models I Doug Fowler Review From Gene Prediction I transcriptional start site G open reading frame transcriptional termination site promoter 5 untranslated region 3 untranslated
2 level 3 innovation tiles. 3 level 2 innovation tiles. 3 level 1 innovation tiles. 2 tribe pawns of each color. 3 height 3 tribe pawns.
2 darab 3-as szintű találmány jelző Origin kártyaszövegek fordítása Vágd ki a az egyes kártyákhoz tartozó lapokat a vonalak és a színes terület mentén, majd csúsztasd be a kártyavédő fóliába úgy, hogy
Cloud computing. Cloud computing. Dr. Bakonyi Péter.
Cloud computing Cloud computing Dr. Bakonyi Péter. 1/24/2011 1/24/2011 Cloud computing 2 Cloud definició A cloud vagy felhő egy platform vagy infrastruktúra Az alkalmazások és szolgáltatások végrehajtására
Can/be able to. Using Can in Present, Past, and Future. A Can jelen, múlt és jövő idejű használata
Can/ Can is one of the most commonly used modal verbs in English. It be used to express ability or opportunity, to request or offer permission, and to show possibility or impossibility. A az egyik leggyakrabban
Word and Polygon List for Obtuse Triangular Billiards II
Word and Polygon List for Obtuse Triangular Billiards II Richard Evan Schwartz August 19, 2008 Abstract This is the list of words and polygons we use for our paper. 1 Notation To compress our notation
AZ ACM NEMZETKÖZI PROGRAMOZÓI VERSENYE
AZ ACM NEMZETKÖZI PROGRAMOZÓI VERSENYE Kuki Attila, kuki@math.klte.hu Kossuth Lajos Tudományegyetem, Információ Technológia Tanszék Abstract This paper is dedicated to the Scholastic Programming Contest
Dynamic freefly DIVE POOL LINES
Dynamic freefly 3.rész Part 3 DIVE POOL LINES A dynamic repülés három fajta mozgásból áll: Dynamic freeflying is composed of three types of movements: -Lines (vízszintes "szlalom") (horizontal "slalom")
Nemzetközi Kenguru Matematikatábor
Nemzetközi Kenguru Matematikatábor 2011. augusztus 19-27., Werbellinsee, Németország BESZÁMOLÓ Bevezető Idén hetedik alkalommal került megrendezére a Nemzetközi Kenguru Matematikatábor (7. Internationale
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Nonparametric Tests
Nonparametric Tests Petra Petrovics Hypothesis Testing Parametric Tests Mean of a population Population proportion Population Standard Deviation Nonparametric Tests Test for Independence Analysis of Variance
Dependency preservation
Adatbázis-kezelés. (4 előadás: Relácó felbontásai (dekomponálás)) 1 Getting lossless decomposition is necessary. But of course, we also want to keep dependencies, since losing a dependency means, that
Választási modellek 3
Választási modellek 3 Prileszky István Doktori Iskola 2018 http://www.sze.hu/~prile Forrás: A Self Instructing Course in Mode Choice Modeling: Multinomial and Nested Logit Models Prepared For U.S. Department
NYOMÁSOS ÖNTÉS KÖZBEN ÉBREDŐ NYOMÁSVISZONYOK MÉRÉTECHNOLÓGIAI TERVEZÉSE DEVELOPMENT OF CAVITY PRESSURE MEASUREMENT FOR HIGH PRESURE DIE CASTING
Anyagmérnöki Tudományok, 39/1 (2016) pp. 82 86. NYOMÁSOS ÖNTÉS KÖZBEN ÉBREDŐ NYOMÁSVISZONYOK MÉRÉTECHNOLÓGIAI TERVEZÉSE DEVELOPMENT OF CAVITY PRESSURE MEASUREMENT FOR HIGH PRESURE DIE CASTING LEDNICZKY
SQL/PSM kurzorok rész
SQL/PSM kurzorok --- 2.rész Tankönyv: Ullman-Widom: Adatbázisrendszerek Alapvetés Második, átdolgozott kiadás, Panem, 2009 9.3. Az SQL és a befogadó nyelv közötti felület (sormutatók) 9.4. SQL/PSM Sémában
Szundikáló macska Sleeping kitty
Model: Peter Budai 999. Diagrams: Peter Budai 999.. Oda-visszahajtás átlósan. Fold and unfold diagonally. 2. Behajtunk középre. Fold to the center. 3. Oda-visszahajtások derékszögben. Fold and unfold at
openbve járműkészítés Leírás a sound.cfg fájlhoz használható parancsokról
Leírás az openbve-vel kompatibilis sound.cfg fájl készítéséhez használható parancsokról 1. oldal openbve járműkészítés Leírás a sound.cfg fájlhoz használható parancsokról A leírás az openbve-hez készíthető
ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 201. május 20. ELEKTRONIKAI ALAPISMERETEK ANGOL NYELVEN EMELT SZINTŰ ÍRÁSBELI VIZSGA 201. május 20. 8:00 Az írásbeli vizsga időtartama: 20 perc Pótlapok száma Tisztázati Piszkozati EMBERI
LED UTCAI LÁMPATESTEK STREET LIGHTING
LED UTCAI LÁMPATESTEK STREET LIGHTING LED Utcai lámpatestek Street Lights 1. Öntött ADC12 alumínium ház NOBEL porszórt festéssel 3. Edzett optikai lencsék irányított sugárzási szöggel 5. Meanwell meghajtó
EN United in diversity EN A8-0206/419. Amendment
22.3.2019 A8-0206/419 419 Article 2 paragraph 4 point a point i (i) the identity of the road transport operator; (i) the identity of the road transport operator by means of its intra-community tax identification
Abigail Norfleet James, Ph.D.
Abigail Norfleet James, Ph.D. Left side of brain develops first in girls, right in boys o Probably source of girls verbal skills o And source of boys spatial skills Pre-frontal lobes Control impulses and
KIEGÉSZÍTŽ FELADATOK. Készlet Bud. Kap. Pápa Sopr. Veszp. Kecsk. 310 4 6 8 10 5 Pécs 260 6 4 5 6 3 Szomb. 280 9 5 4 3 5 Igény 220 200 80 180 160
KIEGÉSZÍTŽ FELADATOK (Szállítási probléma) Árut kell elszállítani három telephelyr l (Kecskemét, Pécs, Szombathely) öt területi raktárba, melyek Budapesten, Kaposváron, Pápán, Sopronban és Veszprémben
A logaritmikus legkisebb négyzetek módszerének karakterizációi
A logaritmikus legkisebb négyzetek módszerének karakterizációi Csató László laszlo.csato@uni-corvinus.hu MTA Számítástechnikai és Automatizálási Kutatóintézet (MTA SZTAKI) Operációkutatás és Döntési Rendszerek
NEUTRÍNÓ DETEKTOROK. A SzUPER -KAMIOKANDE példája
NEUTRÍNÓ DETEKTOROK A SzUPER -KAMIOKANDE példája Kamiokande = Kamioka bánya Nucleon Decay Experiment = nukleon bomlás kísérlet 1 TÉMAKÖRÖK A Szuper-Kamiokande mérőberendezés A Nap-neutrínó rejtély Legújabb
fátyolka tojásgy jtœ lap [CHRegg] összeszereléséhez
Útmutató fátyolka tojásgy jtœ lap [CHRegg] összeszereléséhez (Assembling instructions to [CHRegg] lacewing egg concentrator) Tartozékok: 1 = csalétket tartalmazó alufólia tasak 2 = tojásgy jtœ lap tépœzár
General information for the participants of the GTG Budapest, 2017 meeting
General information for the participants of the GTG Budapest, 2017 meeting Currency is Hungarian Forint (HUF). 1 EUR 310 HUF, 1000 HUF 3.20 EUR. Climate is continental, which means cold and dry in February
Cloud computing Dr. Bakonyi Péter.
Cloud computing Dr. Bakonyi Péter. 1/24/2011 Cloud computing 1/24/2011 Cloud computing 2 Cloud definició A cloud vagy felhő egy platform vagy infrastruktúra Az alkalmazások és szolgáltatások végrehajtására
FAMILY STRUCTURES THROUGH THE LIFE CYCLE
FAMILY STRUCTURES THROUGH THE LIFE CYCLE István Harcsa Judit Monostori A magyar társadalom 2012-ben: trendek és perspektívák EU összehasonlításban Budapest, 2012 november 22-23 Introduction Factors which
Geokémia gyakorlat. 1. Geokémiai adatok értelmezése: egyszerű statisztikai módszerek. Geológus szakirány (BSc) Dr. Lukács Réka
Geokémia gyakorlat 1. Geokémiai adatok értelmezése: egyszerű statisztikai módszerek Geológus szakirány (BSc) Dr. Lukács Réka MTA-ELTE Vulkanológiai Kutatócsoport e-mail: reka.harangi@gmail.com ALAPFOGALMAK:
KELER KSZF Zrt. bankgarancia-befogadási kondíciói. Hatályos: 2014. július 8.
KELER KSZF Zrt. bankgarancia-befogadási kondíciói Hatályos: 2014. július 8. A KELER KSZF a nem-pénzügyi klíringtagjaitól, és az energiapiaci alklíringtagjaitól a KELER KSZF Általános Üzletszabályzata szerinti
Supplementary Figure 1
Supplementary Figure 1 Plot of delta-afe of sequence variants detected between resistant and susceptible pool over the genome sequence of the WB42 line of B. vulgaris ssp. maritima. The delta-afe values
Kvantum-informatika és kommunikáció 2015/2016 ősz. A kvantuminformatika jelölésrendszere szeptember 11.
Kvantum-informatika és kommunikáció 2015/2016 ősz A kvantuminformatika jelölésrendszere 2015. szeptember 11. Mi lehet kvantumbit? Kvantum eszközök (1) 15=5 3 Bacsárdi Képek forrása: IBM's László, Almaden
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY A feladatsor három részből áll 1. A vizsgáztató társalgást kezdeményez a vizsgázóval. 2. A vizsgázó egy szituációs feladatban vesz részt a
IES TM Evaluating Light Source Color Rendition
IES TM-30-15 Evaluating Light Source Color Rendition "Original" "CRI = 80" Desaturated "CRI = 80" Saturated More metrics Color Fidelity Color Discrimination Color Preference Metrics/Measures R f (IES TM-30-15)
A jövedelem alakulásának vizsgálata az észak-alföldi régióban az 1997-99. évi adatok alapján
A jövedelem alakulásának vizsgálata az észak-alföldi régióban az 1997-99. évi adatok alapján Rózsa Attila Debreceni Egyetem Agrártudományi Centrum, Agrárgazdasági és Vidékfejlesztési Intézet, Számviteli
KELET-ÁZSIAI DUPLANÁDAS HANGSZEREK ÉS A HICHIRIKI HASZNÁLATA A 20. SZÁZADI ÉS A KORTÁRS ZENÉBEN
Liszt Ferenc Zeneművészeti Egyetem 28. számú művészet- és művelődéstörténeti tudományok besorolású doktori iskola KELET-ÁZSIAI DUPLANÁDAS HANGSZEREK ÉS A HICHIRIKI HASZNÁLATA A 20. SZÁZADI ÉS A KORTÁRS
Ensemble Kalman Filters Part 1: The basics
Ensemble Kalman Filters Part 1: The basics Peter Jan van Leeuwen Data Assimilation Research Centre DARC University of Reading p.j.vanleeuwen@reading.ac.uk Model: 10 9 unknowns P[u(x1),u(x2),T(x3),.. Observations:
Cashback 2015 Deposit Promotion teljes szabályzat
Cashback 2015 Deposit Promotion teljes szabályzat 1. Definitions 1. Definíciók: a) Account Client s trading account or any other accounts and/or registers maintained for Számla Az ügyfél kereskedési számlája
FÖLDRAJZ ANGOL NYELVEN
Földrajz angol nyelven középszint 1112 ÉRETTSÉGI VIZSGA 2014. május 15. FÖLDRAJZ ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI ÉRETTSÉGI VIZSGA JAVÍTÁSI-ÉRTÉKELÉSI ÚTMUTATÓ EMBERI ERŐFORRÁSOK MINISZTÉRIUMA Paper
BKI13ATEX0030/1 EK-Típus Vizsgálati Tanúsítvány/ EC-Type Examination Certificate 1. kiegészítés / Amendment 1 MSZ EN 60079-31:2014
(1) EK-TípusVizsgálati Tanúsítvány (2) A potenciálisan robbanásveszélyes környezetben történő alkalmazásra szánt berendezések, védelmi rendszerek 94/9/EK Direktíva / Equipment or Protective Systems Intended
DOAS változások, összefoglaló
DOAS 3.835.2.0 változások, összefoglaló 1149 Budapest, Egressy út 17-21. Telefon: +36 1 469 4021; fax: +36 1 469 4029 1 / 6 Tartalomjegyzék 1. Start Csomag /Start package...3 1.1. Általános modul / General