ADFOCS Corpus size for estimates
|
|
- Veronika Balogné
- 6 évvel ezelőtt
- Látták:
Átírás
1 ADFOCS 2004 Prabhakar Raghavan Lecture 2 Corpus size for estimates Consider n = 1M documents, each with about 1K terms. Avg 6 bytes/term incl spaces/punctuation 6GB of data. Say there are m = 500K distinct terms among these.
2 Don t build the matrix 500K x 1M matrix has half-a-trillion 0 s and 1 s. But it has no more than one billion 1 s. matrix is extremely sparse. So we devised the inverted index Devised query processing for it Where do we pay in storage? Where do we pay in storage? Terms Term N docs Tot Freq ambitious be brutus 2 2 capitol caesar 2 3 did enact hath I 1 2 i' it julius killed 1 2 let me noble so the 2 2 told you was 2 2 with Doc # Freq Pointers
3 Storage analysis First will consider space for pointers Basic Boolean index only Devise compression schemes Then will do the same for dictionary No analysis for positional indexes, etc. Pointers: two conflicting forces A term like Calpurnia occurs in maybe one doc out of a million - would like to store this pointer using log 2 1M ~ 20 bits. A term like the occurs in virtually every doc, so 20 bits/pointer is too expensive. Prefer 0/1 vector in this case.
4 Postings file entry Store list of docs containing a term in increasing order of doc id. Brutus: 33,47,154,159,202 Consequence: suffices to store gaps. 33,14,107,5,43 Hope: most gaps encoded with far fewer than 20 bits. Variable encoding For Calpurnia, will use ~20 bits/gap entry. For the, will use ~1 bit/gap entry. If the average gap for a term is G, want to use ~log 2 G bits/gap entry. Key challenge: encode every integer (gap) with ~ as few bits as needed for that integer.
5 γ codes for gap encoding Length Offset Represent a gap G as the pair <length,offset> length is in unary and uses log 2 G +1 bits to specify the length of the binary encoding of offset = G -2 log 2 G e.g., 9 represented as <1110,001>. Encoding G takes 2 log 2 G +1 bits. Exercise Given the following sequence of γ coded gaps, reconstruct the postings sequence: From these γ decode and reconstruct gaps, then full postings.
6 What we ve just done Encoded each gap as tightly as possible, to within a factor of 2. For better tuning (and a simple analysis) - need a handle on the distribution of gap values. Zipf s law The kth most frequent term has frequency proportional to 1/k. Use this for a crude analysis of the space used by our postings file pointers. Not yet ready for analysis of dictionary space.
7 Zipf s law log-log plot Rough analysis based on Zipf Most frequent term occurs in n docs n gaps of 1 each. Second most frequent term in n/2 docs n/2 gaps of 2 each kth most frequent term in n/k docs n/k gaps of k each - use 2log 2 k +1 bits for each gap; net of ~(2n/k).log 2 k bits for kth most frequent term.
8 Sum over k from 1 to m=500k Do this by breaking values of k into groups: group i consists of 2 i-1 k < 2 i. Group i has 2 i-1 components in the sum, each contributing at most (2ni)/2 i-1. Recall n=1m Summing over i from 1 to 19, we get a net estimate of 340Mbits ~45MB for our index. Work out calculation. Caveats This is not the entire space for our index: does not account for dictionary storage; as we get further, we ll store even more stuff in the index. Assumes Zipf s law applies to occurrence of terms in docs. All gaps for a term taken to be the same. Does not talk about query processing.
9 More practical caveat γ codes are neat but in reality, machines have word boundaries 16, 32 bits etc Compressing and manipulating at individual bitgranularity is overkill in practice Slows down architecture In practice, simpler word-aligned compression (see Scholer reference) better Dictionary and postings files Term Doc # Freq ambitious be brutus brutus capitol caesar caesar 2 2 did enact hath I 1 2 i' it julius killed 1 2 let me noble so the the told you was was with Term N docs Tot Freq ambitious be brutus 2 2 capitol caesar 2 3 did enact hath I 1 2 i' it julius killed 1 2 let me noble so the 2 2 told you was 2 2 with Usually in memory Gap-encoded, on disk Doc # Freq
10 Inverted index storage Next up: Dictionary storage Dictionary in main memory, postings on disk This is common, especially for something like a search engine where high throughput is essential, but can also store most of it on disk with small, in-memory index Tradeoffs between compression and query processing speed Cascaded family of techniques How big is the lexicon V? Grows (but more slowly) with corpus size Empirically okay model: m = kn b where b 0.5, k ; N = # tokens For instance TREC disks 1 and 2 (2 Gb; 750,000 newswire articles): ~ 500,000 terms V is decreased by case-folding, stemming Indexing all numbers could make it extremely large (so usually don t*) Spelling errors contribute a fair bit of size Exercise: Can one derive this from Zipf s Law?
11 Dictionary storage - first cut Array of fixed-width entries 500,000 terms; 28 bytes/term = 14MB. Terms Freq. Postings ptr. a 999,712 aardvark 71.. zzzz 99 Allows for fast binary search into dictionary 20 bytes 4 bytes each Exercises Is binary search really a good idea? What are the alternatives?
12 Fixed-width terms are wasteful Most of the bytes in the Term column are wasted we allot 20 bytes for 1 letter terms. And still can t handle supercalifragilisticexpialidocious. Written English averages ~4.5 characters. Exercise: Why is/isn t this the number to use for estimating the dictionary size? Explain this. Short words dominate token counts. Average word in English: ~8 characters. Compressing the term list Store dictionary as a (long) string of characters: Pointer to next word shows end of current word Hope to save up to 60% of dictionary space..systilesyzygeticsyzygialsyzygyszaibelyiteszczecinszomo. Freq Postings ptr. Term ptr. Binary search these pointers Total string length = 500K x 8B = 4MB Pointers resolve 4M positions: log 2 4M = 22bits = 3bytes
13 Total space for compressed list 4 bytes per term for Freq. 4 bytes per term for pointer to Postings. 3 bytes per term pointer Avg. 8 bytes per term in term string 500K terms 9.5MB Now avg. 11 bytes/term, not 20. Blocking Store pointers to every kth on term string. Example below: k=4. Need to store term lengths (1 extra byte).7systile9syzygetic8syzygial6syzygy11szaibelyite8szczecin9szomo. Freq. Postings ptr. Term ptr Save 9 bytes on 3 pointers. Lose 4 bytes on term lengths.
14 Net Where we used 3 bytes/pointer without blocking 3 x 4 = 12 bytes for k=4 pointers, now we use 3+4=7 bytes for 4 pointers. Shaved another ~0.5MB; can save more with larger k. Why not go with larger k? Exercise Estimate the space usage (and savings compared to 9.5MB) with blocking, for block sizes of k = 4, 8 and 16.
15 Impact on search Binary search down to 4-term block; Then linear search through terms in block. 8 documents: binary tree ave. = 2.6 compares Blocks of 4 (binary tree), ave. = 3 compares = ( )/8 =( )/ Exercise Estimate the impact on search performance (and slowdown compared to k=1) with blocking, for block sizes of k = 4, 8 and 16.
16 Total space By increasing k, we could cut the pointer space in the dictionary, at the expense of search time; space 9.5MB ~8MB Adding in the 45MB for the postings, total 53MB for the simple Boolean inverted index Some complicating factors Accented characters Do we want to support accent-sensitive as well as accent-insensitive characters? E.g., query resume expands to resume as well as résumé But the query résumé should be executed as only résumé Alternative, search application specifies If we store the accented as well as plain terms in the dictionary string, how can we support both query versions?
17 Index size Stemming/case folding cut number of terms by ~40% number of pointers by 10-20% total space by ~30% Stop words Rule of 30: ~30 words account for ~30% of all term occurrences in written text Eliminating 150 commonest terms from indexing will cut almost 25% of space Extreme compression (see MG) Front-coding: Sorted words commonly have long common prefix store differences only (for last k-1 in a block of k) 8automata8automate9automatic10automation 8{automat}a1 e2 ic3 ion Encodes automat Extra length beyond automat. Begins to resemble general string compression.
18 Extreme compression Using perfect hashing to store terms within their pointers not good for vocabularies that change. Partition dictionary into pages use B-tree on first terms of pages pay a disk seek to grab each page if we re paying 1 disk seek anyway to get the postings, only another seek/query term. Compression: Two alternatives Lossless compression: all information is preserved, but we try to encode it compactly What IR people mostly do Lossy compression: discard some information Using a stoplist can be thought of in this way Techniques such as Latent Semantic Indexing (TH) can be viewed as lossy compression One could prune from postings entries unlikely to turn up in the top k list for query on word Especially applicable to web search with huge numbers of documents but short queries (e.g., Carmel et al. SIGIR 2002)
19 Top k lists Don t store all postings entries for each term Only the best ones Which ones are the best ones? More on this subject later, when we get into ranking Index construction
20 Index construction Thus far, considered index space What about index construction time? What strategies can we use with limited main memory? Somewhat bigger corpus Number of docs = n = 40M Number of terms = m = 1M Use Zipf to estimate number of postings entries: n + n/2 + n/ n/m ~ n ln m = 560M entries No positional info yet Check for yourself
21 Recall index construction Documents are parsed to extract words and these are saved with the Document ID. Doc 1 I did enact Julius Caesar I was killed i' the Capitol; Brutus killed me. Doc 2 So let it be with Caesar. The noble Brutus hath told you Caesar was ambitious Term Doc # I 1 did 1 enact 1 julius 1 caesar 1 I 1 was 1 killed 1 i' 1 the 1 capitol 1 brutus 1 killed 1 me 1 so 2 let 2 it 2 be 2 with 2 caesar 2 the 2 noble 2 brutus 2 hath 2 told 2 you 2 caesar 2 was 2 ambitious 2 Key step After all documents have been parsed the inverted file is sorted by terms We focus on this sort step. Term Doc # I 1 did 1 enact 1 julius 1 caesar 1 I 1 was 1 killed 1 i' 1 the 1 capitol 1 brutus 1 killed 1 me 1 so 2 let 2 it 2 be 2 with 2 caesar 2 the 2 noble 2 brutus 2 hath 2 told 2 you 2 caesar 2 was 2 ambitious 2 Term Doc # ambitious 2 be 2 brutus 1 brutus 2 capitol 1 caesar 1 caesar 2 caesar 2 did 1 enact 1 hath 1 I 1 I 1 i' 1 it 2 julius 1 killed 1 killed 1 let 2 me 1 noble 2 so 2 the 1 the 2 told 2 you 2 was 1 was 2 with 2
22 Index construction As we build up the index, cannot exploit compression tricks parse docs one at a time. The final postings entry for any term is incomplete until the end. (actually you can exploit compression, but this becomes a lot more complex) At bytes per postings entry, demands several temporary gigabytes System parameters for design Disk seek ~ 1 millisecond Block transfer from disk ~ 1 microsecond per byte (following a seek) All other ops ~ 10 microseconds E.g., compare two postings entries and decide their merge order
23 Bottleneck Parse and build postings entries one doc at a time Now sort postings entries by term (then by doc within each term) Doing this with random disk seeks would be too slow If every comparison took 1 disk seek, and n items could be sorted with nlog 2 n comparisons, how long would this take? Sorting with fewer disk seeks 12-byte (4+4+4) records (term, doc, freq). These are generated as we parse docs. Must now sort 560M such 12-byte records by term. Define a Block = 10M such records can easily fit a couple into memory. Will sort within blocks first, then merge the blocks into one long sorted order.
24 Sorting 56 blocks of 10M records First, read each block and sort within: Quicksort takes about 2 x (10M ln 10M) steps Exercise: estimate total time to read each block from disk and and quicksort it. 56 times this estimate - gives us 56 sorted runs of 10M records each. Need 2 copies of data on disk, throughout. Merging 56 sorted runs Merge tree of log 2 56 ~ 6 layers. During each layer, read into memory runs in blocks of 10M, merge, write back Disk
25 Merge tree 1 runs? 2 runs? 4 runs? 7 runs, 80M/run 14 runs, 40M/run 28 runs, 20M/run Sorted runs Merging 56 runs Time estimate for disk transfer: 6 x (56runs x 120MB x 10-6 sec) x 2 ~ 22hrs. Disk block transfer time. Why is this an Overestimate? Work out how these transfers are staged, and the total time for merging.
26 Exercise - fill in this table Step Time 1 56 initial quicksorts of 10M records each 2 Read 2 sorted blocks for merging, write back 3 Merge 2 sorted blocks? 4 5 Add (2) + (3) = time to read/merge/write 56 times (4) = total merge time Large memory indexing Suppose instead that we had 16GB of memory for the above indexing task. Exercise: how much time to index? Repeat with a couple of values of n, m. In practice, spidering interlaced with indexing. Spidering bottlenecked by WAN speed and many other factors - more on this later.
27 Improvements on basic merge Compressed temporary files compress terms in temporary dictionary runs How do we merge compressed runs to generate a compressed run? Given two γ-encoded runs, merge them into a new γ-encoded run To do this, first γ-decode a run into a sequence of gaps, then actual records: 33,14,107,5 33, 47, 154, ,12,109,5 13, 25, 134, 139 Merging compressed runs Now merge: 13, 25, 33, 47, 134, 139, 154, 159 Now generate new gap sequence 13,12,8,14,87,5,15,5 Finish by γ-encoding the gap sequence But what was the point of all this? If we were to uncompress the entire run in memory, we save no memory How do we gain anything?
28 Zipper uncompress/decompress When merging two runs, bring their γ-encoded versions into memory Do NOT uncompress the entire gap sequence at once only a small segment at a time Merge the uncompressed segments Compress merged segments again Compressed inputs Uncompressed segments Compressed, merged output Improving on binary merge tree Merge more than 2 runs at a time Merge k>2 runs at a time for a shallower tree maintain heap of candidates from each run
29 Dynamic indexing Docs come in over time postings updates for terms already in dictionary new terms added to dictionary Docs get deleted Simplest approach Maintain big main index New docs go into small auxiliary index Search across both, merge results Deletions Invalidation bit-vector for deleted docs Filter docs output on a search result by this invalidation bit-vector Periodically, re-index into one main index
30 Resources MG 3.3, 3.4, 4.2, 5 F. Scholer, H.E. Williams and J. Zobel. Compression of Inverted Indexes For Fast Query Evaluation. Proc. ACM-SIGIR
Computer Architecture
Computer Architecture Locality-aware programming 2016. április 27. Budapest Gábor Horváth associate professor BUTE Department of Telecommunications ghorvath@hit.bme.hu Számítógép Architektúrák Horváth
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY A feladatsor három részbol áll 1. A vizsgáztató társalgást kezdeményez a vizsgázóval. 2. A vizsgázó egy szituációs feladatban vesz részt a
Construction of a cube given with its centre and a sideline
Transformation of a plane of projection Construction of a cube given with its centre and a sideline Exercise. Given the center O and a sideline e of a cube, where e is a vertical line. Construct the projections
Using the CW-Net in a user defined IP network
Using the CW-Net in a user defined IP network Data transmission and device control through IP platform CW-Net Basically, CableWorld's CW-Net operates in the 10.123.13.xxx IP address range. User Defined
Széchenyi István Egyetem www.sze.hu/~herno
Oldal: 1/6 A feladat során megismerkedünk a C# és a LabVIEW összekapcsolásának egy lehetőségével, pontosabban nagyon egyszerű C#- ban írt kódból fordítunk DLL-t, amit meghívunk LabVIEW-ból. Az eljárás
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel Timea Farkas Click here if your download doesn"t start
Mapping Sequencing Reads to a Reference Genome
Mapping Sequencing Reads to a Reference Genome High Throughput Sequencing RN Example applications: Sequencing a genome (DN) Sequencing a transcriptome and gene expression studies (RN) ChIP (chromatin immunoprecipitation)
Lopocsi Istvánné MINTA DOLGOZATOK FELTÉTELES MONDATOK. (1 st, 2 nd, 3 rd CONDITIONAL) + ANSWER KEY PRESENT PERFECT + ANSWER KEY
Lopocsi Istvánné MINTA DOLGOZATOK FELTÉTELES MONDATOK (1 st, 2 nd, 3 rd CONDITIONAL) + ANSWER KEY PRESENT PERFECT + ANSWER KEY FELTÉTELES MONDATOK 1 st, 2 nd, 3 rd CONDITIONAL I. A) Egészítsd ki a mondatokat!
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY A feladatsor három részből áll 1. A vizsgáztató társalgást kezdeményez a vizsgázóval. 2. A vizsgázó egy szituációs feladatban vesz részt a
Correlation & Linear Regression in SPSS
Petra Petrovics Correlation & Linear Regression in SPSS 4 th seminar Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Correlation
On The Number Of Slim Semimodular Lattices
On The Number Of Slim Semimodular Lattices Gábor Czédli, Tamás Dékány, László Ozsvárt, Nóra Szakács, Balázs Udvari Bolyai Institute, University of Szeged Conference on Universal Algebra and Lattice Theory
Genome 373: Hidden Markov Models I. Doug Fowler
Genome 373: Hidden Markov Models I Doug Fowler Review From Gene Prediction I transcriptional start site G open reading frame transcriptional termination site promoter 5 untranslated region 3 untranslated
ANGOL NYELVI SZINTFELMÉRŐ 2013 A CSOPORT. on of for from in by with up to at
ANGOL NYELVI SZINTFELMÉRŐ 2013 A CSOPORT A feladatok megoldására 45 perc áll rendelkezésedre, melyből körülbelül 10-15 percet érdemes a levélírási feladatra szánnod. Sok sikert! 1. Válaszd ki a helyes
Minta ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA II. Minta VIZSGÁZTATÓI PÉLDÁNY
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA II. A feladatsor három részből áll VIZSGÁZTATÓI PÉLDÁNY 1. A vizsgáztató társalgást kezdeményez a vizsgázóval. 2. A vizsgázó egy szituációs feladatban vesz részt a
3. MINTAFELADATSOR KÖZÉPSZINT. Az írásbeli vizsga időtartama: 30 perc. III. Hallott szöveg értése
Oktatáskutató és Fejlesztő Intézet TÁMOP-3.1.1-11/1-2012-0001 XXI. századi közoktatás (fejlesztés, koordináció) II. szakasz ANGOL NYELV 3. MINTAFELADATSOR KÖZÉPSZINT Az írásbeli vizsga időtartama: 30 perc
discosnp demo - Peterlongo Pierre 1 DISCOSNP++: Live demo
discosnp demo - Peterlongo Pierre 1 DISCOSNP++: Live demo Download and install discosnp demo - Peterlongo Pierre 3 Download web page: github.com/gatb/discosnp Chose latest release (2.2.10 today) discosnp
T Á J É K O Z T A T Ó. A 1108INT számú nyomtatvány a http://www.nav.gov.hu webcímen a Letöltések Nyomtatványkitöltő programok fülön érhető el.
T Á J É K O Z T A T Ó A 1108INT számú nyomtatvány a http://www.nav.gov.hu webcímen a Letöltések Nyomtatványkitöltő programok fülön érhető el. A Nyomtatványkitöltő programok fület választva a megjelenő
USER MANUAL Guest user
USER MANUAL Guest user 1 Welcome in Kutatótér (Researchroom) Top menu 1. Click on it and the left side menu will pop up 2. With the slider you can make left side menu visible 3. Font side: enlarging font
INDEXSTRUKTÚRÁK III.
2MU05_Bitmap.pdf camü_ea INDEXSTRUKTÚRÁK III. Molina-Ullman-Widom: Adatbázisrendszerek megvalósítása Panem, 2001könyv 5.4. Bittérkép indexek fejezete alapján Oracle: Indexek a gyakorlatban Oracle Database
Unit 10: In Context 55. In Context. What's the Exam Task? Mediation Task B 2: Translation of an informal letter from Hungarian to English.
Unit 10: In Context 55 UNIT 10 Mediation Task B 2 Hungarian into English In Context OVERVIEW 1. Hungarian and English in Context 2. Step By Step Exam Techniques Real World Link Students who have studied
ENGLISH 24 English is fun Letter #1 Letters In the age of e-mails and cell phones writing a letter might seem out of fashion. However, learners of a foreign language should know how to do it. Here you
Create & validate a signature
IOTA TUTORIAL 7 Create & validate a signature v.0.0 KNBJDBIRYCUGVWMSKPVA9KOOGKKIRCBYHLMUTLGGAV9LIIPZSBGIENVBQ9NBQWXOXQSJRIRBHYJ9LCTJLISGGBRFRTTWD ABBYUVKPYFDJWTFLICYQQWQVDPCAKNVMSQERSYDPSSXPCZLVKWYKYZMREAEYZOSPWEJLHHFPYGSNSUYRZXANDNQTTLLZA
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Hypothesis Testing. Petra Petrovics.
Hypothesis Testing Petra Petrovics PhD Student Inference from the Sample to the Population Estimation Hypothesis Testing Estimation: how can we determine the value of an unknown parameter of a population
(Asking for permission) (-hatok/-hetek?; Szabad ni? Lehet ni?) Az engedélykérés kifejezésére a következő segédigéket használhatjuk: vagy vagy vagy
(Asking for permission) (-hatok/-hetek?; Szabad ni? Lehet ni?) SEGÉDIGÉKKEL Az engedélykérés kifejezésére a következő segédigéket használhatjuk: vagy vagy vagy A fenti felsorolásban a magabiztosság/félénkség
Tudományos Ismeretterjesztő Társulat
Sample letter number 5. International Culture Festival PO Box 34467 Harrogate HG 45 67F Sonnenbergstraße 11a CH-6005 Luzern Re: Festival May 19, 2009 Dear Ms Atkinson, We are two students from Switzerland
Ültetési és öntözési javaslatok. Planting and watering instructions
Ültetési és öntözési javaslatok Planting and watering instructions 1 Önöntöző-rendszer Sub-irrigation 2 Kedves növénykedvelő A LECHUZA önöntöző rendszerrel növényeink természetüknél fogva gyönyörű virágokat
ANGOL NYELVI SZINTFELMÉRŐ 2014 A CSOPORT
ANGOL NYELVI SZINTFELMÉRŐ 2014 A CSOPORT A feladatok megoldására 45 perc áll rendelkezésedre, melyből körülbelül 10-15 percet érdemes a fogalmazási feladatra szánnod. Megoldásaid a válaszlapra írd! 1.
FAMILY STRUCTURES THROUGH THE LIFE CYCLE
FAMILY STRUCTURES THROUGH THE LIFE CYCLE István Harcsa Judit Monostori A magyar társadalom 2012-ben: trendek és perspektívák EU összehasonlításban Budapest, 2012 november 22-23 Introduction Factors which
ANGOL NYELVI SZINTFELMÉRŐ 2012 A CSOPORT. to into after of about on for in at from
ANGOL NYELVI SZINTFELMÉRŐ 2012 A CSOPORT A feladatok megoldására 45 perc áll rendelkezésedre, melyből körülbelül 10-15 percet érdemes a levélírási feladatra szánnod. Sok sikert! 1. Válaszd ki a helyes
1. MINTAFELADATSOR KÖZÉPSZINT. Az írásbeli vizsga időtartama: 30 perc. III. Hallott szöveg értése
Oktatáskutató és Fejlesztő Intézet TÁMOP-3.1.1-11/1-2012-0001 XXI. századi közoktatás (fejlesztés, koordináció) II. szakasz ANGOL NYELV 1. MINTAFELADATSOR KÖZÉPSZINT Az írásbeli vizsga időtartama: 30 perc
Szundikáló macska Sleeping kitty
Model: Peter Budai 999. Diagrams: Peter Budai 999.. Oda-visszahajtás átlósan. Fold and unfold diagonally. 2. Behajtunk középre. Fold to the center. 3. Oda-visszahajtások derékszögben. Fold and unfold at
Cluster Analysis. Potyó László
Cluster Analysis Potyó László What is Cluster Analysis? Cluster: a collection of data objects Similar to one another within the same cluster Dissimilar to the objects in other clusters Cluster analysis
}w!"#$%&'()+,-./012345<ya
Flexible Similarity Search of Seman c Vectors Using Fulltext Search Engines Michal Růžička, Vít Novotný, Petr Sojka; Jan Pomikálek, Radim Řehůřek Masaryk University, Faculty of Informa cs, Brno, Czech
EN United in diversity EN A8-0206/419. Amendment
22.3.2019 A8-0206/419 419 Article 2 paragraph 4 point a point i (i) the identity of the road transport operator; (i) the identity of the road transport operator by means of its intra-community tax identification
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében. Dicse Jenő üzletfejlesztési igazgató
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében Dicse Jenő üzletfejlesztési igazgató How to apply modern e-learning to improve the training of firefighters Jenő Dicse Director of
Where are the parrots? (Hol vannak a papagájok?)
Where are the parrots? (Hol vannak a papagájok?) Hi Agents! This is your final test so get ready. Work your way through the exercises and when you have finished, the letters will spell out the name of
Tudományos Ismeretterjesztő Társulat
Sample letter number 3. Russell Ltd. 57b Great Hawthorne Industrial Estate Hull East Yorkshire HU 19 5BV 14 Bebek u. Budapest H-1105 10 December, 2009 Ref.: complaint Dear Sir/Madam, After seeing your
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Correlation & Linear. Petra Petrovics.
Correlation & Linear Regression in SPSS Petra Petrovics PhD Student Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise
Lecture 11: Genetic Algorithms
Lecture 11 1 Linear and Combinatorial Optimization Lecture 11: Genetic Algorithms Genetic Algorithms - idea Genetic Algorithms - implementation and examples Lecture 11 2 Genetic algorithms Algorithm is
Correlation & Linear Regression in SPSS
Correlation & Linear Regression in SPSS Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise 1 - Correlation File / Open
Phenotype. Genotype. It is like any other experiment! What is a bioinformatics experiment? Remember the Goal. Infectious Disease Paradigm
It is like any other experiment! What is a bioinformatics experiment? You need to know your data/input sources You need to understand your methods and their assumptions You need a plan to get from point
SQL/PSM kurzorok rész
SQL/PSM kurzorok --- 2.rész Tankönyv: Ullman-Widom: Adatbázisrendszerek Alapvetés Második, átdolgozott kiadás, Panem, 2009 9.3. Az SQL és a befogadó nyelv közötti felület (sormutatók) 9.4. SQL/PSM Sémában
Cashback 2015 Deposit Promotion teljes szabályzat
Cashback 2015 Deposit Promotion teljes szabályzat 1. Definitions 1. Definíciók: a) Account Client s trading account or any other accounts and/or registers maintained for Számla Az ügyfél kereskedési számlája
3. MINTAFELADATSOR EMELT SZINT. Az írásbeli vizsga időtartama: 30 perc. III. Hallott szöveg értése
Oktatáskutató és Fejlesztő Intézet TÁMOP-3.1.1-11/1-2012-0001 XXI. századi közoktatás (fejlesztés, koordináció) II. szakasz ANGOL NYELV 3. MINTAFELADATSOR EMELT SZINT Az írásbeli vizsga időtartama: 30
A jövedelem alakulásának vizsgálata az észak-alföldi régióban az 1997-99. évi adatok alapján
A jövedelem alakulásának vizsgálata az észak-alföldi régióban az 1997-99. évi adatok alapján Rózsa Attila Debreceni Egyetem Agrártudományi Centrum, Agrárgazdasági és Vidékfejlesztési Intézet, Számviteli
Ensemble Kalman Filters Part 1: The basics
Ensemble Kalman Filters Part 1: The basics Peter Jan van Leeuwen Data Assimilation Research Centre DARC University of Reading p.j.vanleeuwen@reading.ac.uk Model: 10 9 unknowns P[u(x1),u(x2),T(x3),.. Observations:
Longman Exams Dictionary egynyelvű angol szótár nyelvvizsgára készülőknek
Longman Exams Dictionary egynyelvű angol szótár nyelvvizsgára készülőknek Egynyelvű angol nagyszótár haladó nyelvtanulóknak és nyelvvizsgázóknak 212,000 szócikkel A szótárban minden definíció egyszerű
Szövegbányászat és dokumentum kezelés
Szövegbányászat és dokumentum kezelés 1. Szöveg bányászat alapfogalmai Szövegbányászat Szövegbányászat = szöveg + bányászat Rövid történeti áttekintés: 1958 (Luhn): lényeges szavak kiemelése a szövegből
Intézményi IKI Gazdasági Nyelvi Vizsga
Intézményi IKI Gazdasági Nyelvi Vizsga Név:... Születési hely:... Születési dátum (év/hó/nap):... Nyelv: Angol Fok: Alapfok 1. Feladat: Olvasáskészséget mérő feladat 20 pont Olvassa el a szöveget és válaszoljon
Adatbázisok 1. Rekurzió a Datalogban és SQL-99
Adatbázisok 1 Rekurzió a Datalogban és SQL-99 Expressive Power of Datalog Without recursion, Datalog can express all and only the queries of core relational algebra. The same as SQL select-from-where,
STUDENT LOGBOOK. 1 week general practice course for the 6 th year medical students SEMMELWEIS EGYETEM. Name of the student:
STUDENT LOGBOOK 1 week general practice course for the 6 th year medical students Name of the student: Dates of the practice course: Name of the tutor: Address of the family practice: Tel: Please read
EXKLUZÍV AJÁNDÉKANYAGOD A Phrasal Verb hadsereg! 2. rész
A Phrasal Verb hadsereg! 2. rész FONTOS! Ha ennek az ajándékanyag sorozatnak nem láttad az 1. részét, akkor mindenképpen azzal kezdd! Fekete Gábor www.goangol.hu A sorozat 1. részét itt éred el: www.goangol.hu/ajandekok/phrasalverbs
Utolsó frissítés / Last update: február Szerkesztő / Editor: Csatlós Árpádné
Utolsó frissítés / Last update: 2016. február Szerkesztő / Editor: Csatlós Árpádné TARTALOM / Contents BEVEZETŐ / Introduction... 2 FELNŐTT TAGBÉLYEGEK / Adult membership stamps... 3 IFJÚSÁGI TAGBÉLYEGEK
KELER KSZF Zrt. bankgarancia-befogadási kondíciói. Hatályos: 2014. július 8.
KELER KSZF Zrt. bankgarancia-befogadási kondíciói Hatályos: 2014. július 8. A KELER KSZF a nem-pénzügyi klíringtagjaitól, és az energiapiaci alklíringtagjaitól a KELER KSZF Általános Üzletszabályzata szerinti
Proxer 7 Manager szoftver felhasználói leírás
Proxer 7 Manager szoftver felhasználói leírás A program az induláskor elkezdi keresni az eszközöket. Ha van olyan eszköz, amely virtuális billentyűzetként van beállítva, akkor azokat is kijelzi. Azokkal
KN-CP50. MANUAL (p. 2) Digital compass. ANLEITUNG (s. 4) Digitaler Kompass. GEBRUIKSAANWIJZING (p. 10) Digitaal kompas
KN-CP50 MANUAL (p. ) Digital compass ANLEITUNG (s. 4) Digitaler Kompass MODE D EMPLOI (p. 7) Boussole numérique GEBRUIKSAANWIJZING (p. 0) Digitaal kompas MANUALE (p. ) Bussola digitale MANUAL DE USO (p.
Emelt szint SZÓBELI VIZSGA VIZSGÁZTATÓI PÉLDÁNY VIZSGÁZTATÓI. (A részfeladat tanulmányozására a vizsgázónak fél perc áll a rendelkezésére.
Emelt szint SZÓBELI VIZSGA VIZSGÁZTATÓI PÉLDÁNY VIZSGÁZTATÓI PÉLDÁNY A feladatsor három részből áll 1. A vizsgáztató társalgást kezdeményez a vizsgázóval. 2. A vizsgázó egy vita feladatban vesz részt a
Tudok köszönni tegezve és önözve, és el tudok búcsúzni. I can greet people in formal and informal ways. I can also say goodbye to them.
Mérleg Your checklist Az alábbiakban a MagyarOK 1. tankönyv témáinak listáját találja. A mondatok mellett a kapcsolódó oldalak és gyakorlatok számát is megadtuk, hogy megkönnyítsük az ismétlést. This document
First experiences with Gd fuel assemblies in. Tamás Parkó, Botond Beliczai AER Symposium 2009.09.21 25.
First experiences with Gd fuel assemblies in the Paks NPP Tams Parkó, Botond Beliczai AER Symposium 2009.09.21 25. Introduction From 2006 we increased the heat power of our units by 8% For reaching this
Statistical Inference
Petra Petrovics Statistical Inference 1 st lecture Descriptive Statistics Inferential - it is concerned only with collecting and describing data Population - it is used when tentative conclusions about
PIACI HIRDETMÉNY / MARKET NOTICE
PIACI HIRDETMÉNY / MARKET NOTICE HUPX DAM Másnapi Aukció / HUPX DAM Day-Ahead Auction Iktatási szám / Notice #: Dátum / Of: 18/11/2014 HUPX-MN-DAM-2014-0023 Tárgy / Subject: Változások a HUPX másnapi piac
Előszó.2. Starter exercises. 3. Exercises for kids.. 9. Our comic...17
2011. december Tartalom Előszó.2 Starter exercises. 3 Exercises for kids.. 9 Our comic....17 1 Előszó Kedves angolul tanulók! A 2010/2011- es tanévben elkezdett újságunkat szeretnénk továbbra is szerkeszteni
Angol C2 1 1 074 nyelvi programkövetelmény
Angol C2 1 1 074 nyelvi programkövetelmény A javaslattevő alapadatai Javaslatot benyújtó neve Katedra Nyelviskola Kft. A nyelvi képzésre vonatkozó adatok Nyelv megnevezése Nyelvi képzés szintje Nyelvi
ios alkalmazásfejlesztés Koltai Róbert
ios alkalmazásfejlesztés Koltai Róbert robert.koltai@ponte.hu Mi az a block? Utasítások sorozata { }-ek között, amit egy objektumként tuduk kezelni. ios 4.0 és Mac OSX 10.6 óta 2 Egy példa a felépítésére
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Nonparametric Tests
Nonparametric Tests Petra Petrovics Hypothesis Testing Parametric Tests Mean of a population Population proportion Population Standard Deviation Nonparametric Tests Test for Independence Analysis of Variance
FÖLDRAJZ ANGOL NYELVEN
Földrajz angol nyelven középszint 0821 ÉRETTSÉGI VIZSGA 2009. május 14. FÖLDRAJZ ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI ÉRETTSÉGI VIZSGA JAVÍTÁSI-ÉRTÉKELÉSI ÚTMUTATÓ OKTATÁSI ÉS KULTURÁLIS MINISZTÉRIUM Paper
7. osztály Angol nyelv
7. osztály Angol nyelv I. Kommunikációs szándékok A társadalmi érintkezéshez szükséges kommunikációs szándékok Köszönés Elköszönés Good morning. Hello. Hi. Goodbye. Bye-bye. See you soon. Bemutatkozás,
OLYMPICS! SUMMER CAMP
OLYMPICS! SUMMER CAMP YOUNG BUSINESS CAMP 3D DESIGN CAMP OLYMPICS SUMMER CAMP 20 24 JUNE AND 27 JUNE 1 JULY AGE: 6-14 Our ESB native-speaking teachers will provide a strong English learning content throughout
1. Gyakorlat: Telepítés: Windows Server 2008 R2 Enterprise, Core, Windows 7
1. Gyakorlat: Telepítés: Windows Server 2008 R2 Enterprise, Core, Windows 7 1.1. Új virtuális gép és Windows Server 2008 R2 Enterprise alap lemez létrehozása 1.2. A differenciális lemezek és a két új virtuális
Utolsó frissítés / Last update: Szeptember / September Szerkesztő / Editor: Csatlós Árpádné
Utolsó frissítés / Last update: 2018. Szeptember / September Szerkesztő / Editor: Csatlós Árpádné TARTALOM / Contents BEVEZETŐ / Introduction... 2 FELNŐTT TAGBÉLYEGEK / Adult membership stamps... 3 IFJÚSÁGI
Abigail Norfleet James, Ph.D.
Abigail Norfleet James, Ph.D. Left side of brain develops first in girls, right in boys o Probably source of girls verbal skills o And source of boys spatial skills Pre-frontal lobes Control impulses and
Tavaszi Sporttábor / Spring Sports Camp. 2016. május 27 29. (péntek vasárnap) 27 29 May 2016 (Friday Sunday)
Tavaszi Sporttábor / Spring Sports Camp 2016. május 27 29. (péntek vasárnap) 27 29 May 2016 (Friday Sunday) SZÁLLÁS / ACCOMODDATION on a Hotel Gellért*** szálloda 2 ágyas szobáiban, vagy 2x2 ágyas hostel
2-5 játékos részére, 10 éves kortól
- 5 játékos részére, 0 éves kortól Tervezők: Wolfgang Kramer és Michael Kiesling Grafikai tervező: Oliver Freudenreich DE Ravensburger, KniffDesign (játékszabály) Szerkesztő: Philipp Sprick Magyar fordítás:
ADFOCS Prabhakar Raghavan Lecture 3. A zone is an identified region within a doc
ADFOCS 2004 Prabhakar Raghavan Lecture 3 Zones A zone is an identified region within a doc E.g., Title, Abstract, Bibliography Generally culled from marked-up input or document metadata (e.g., powerpoint)
TestLine - Angol teszt Minta feladatsor
Minta felaatsor venég Téma: Általános szintfelmérő Aláírás:... Dátum: 2016.05.29 08:18:49 Kérések száma: 25 kérés Kitöltési iő: 1:17:27 Nehézség: Összetett Pont egység: +6-2 Értékelés: Alaértelmezett értékelés
Travel Getting Around
- Location I am lost. Not knowing where you are Can you show me where it is on the map? Asking for a specific location on a map Where can I find? Asking for a specific Eltévedtem. Meg tudná nekem mutatni
Cloud computing. Cloud computing. Dr. Bakonyi Péter.
Cloud computing Cloud computing Dr. Bakonyi Péter. 1/24/2011 1/24/2011 Cloud computing 2 Cloud definició A cloud vagy felhő egy platform vagy infrastruktúra Az alkalmazások és szolgáltatások végrehajtására
1. feladat: Hallgasd meg az angol szöveget, legalább egyszer.
1. feladat: Hallgasd meg az angol szöveget, legalább egyszer. 2. feladat: Hallgasd meg a második hanganyagot, a magyarázatom, és utána azonnal hallgasd meg az eredeti szöveget, figyeld meg, mennyivel jobban
PAST ÉS PAST PERFECT SUBJUNCTIVE (múlt idejű kötőmód)
PAST ÉS PAST PERFECT SUBJUNCTIVE (múlt idejű kötőmód) Past és Past Perfect Subjunctive formáját csak néhány esetben kell használnunk. A célhatározói mellékmondatoknál és a feltételes mondatok II. és III.
Please stay here. Peter asked me to stay there. He asked me if I could do it then. Can you do it now?
Eredeti mondat Please stay here. Kérlek, maradj itt. Can you do it now? Meg tudod csinálni most? Will you help me tomorrow? Segítesz nekem holnap? I ll stay at home today. Ma itthon maradok. I woke up
Lexington Public Schools 146 Maple Street Lexington, Massachusetts 02420
146 Maple Street Lexington, Massachusetts 02420 Surplus Printing Equipment For Sale Key Dates/Times: Item Date Time Location Release of Bid 10/23/2014 11:00 a.m. http://lps.lexingtonma.org (under Quick
ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP
ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP CHILD S DATA / GYERMEK ADATAI PLEASE FILL IN THIS INFORMATION WITH DATA BASED ON OFFICIAL DOCUMENTS / KÉRJÜK, TÖLTSE KI A HIVATALOS DOKUMENTUMOKBAN SZEREPLŐ ADATOK
Pletykaalapú gépi tanulás teljesen elosztott környezetben
Pletykaalapú gépi tanulás teljesen elosztott környezetben Hegedűs István Jelasity Márk témavezető Szegedi Tudományegyetem MTA-SZTE Mesterséges Intelligencia Kutatócsopot Motiváció Az adat adatközpontokban
Website review acci.hu
Website review acci.hu Generated on September 30 2016 21:54 PM The score is 37/100 SEO Content Title Acci.hu - Ingyenes apróhirdető Length : 30 Perfect, your title contains between 10 and 70 characters.
Performance Modeling of Intelligent Car Parking Systems
Performance Modeling of Intelligent Car Parking Systems Károly Farkas Gábor Horváth András Mészáros Miklós Telek Technical University of Budapest, Hungary EPEW 2014, Florence, Italy Outline Intelligent
mondat ami nélkül ne indulj el külföldre
51 mondat ami nélkül ne indulj el külföldre 51 mondat ami nélkül ne indulj el külföldre 1. Good morning / afternoon / evening. Jó reggelt / napot / estét. 2. How are you? / How is it going? Hogy van? /
Budapest By Vince Kiado, Klösz György
Budapest 1900 2000 By Vince Kiado, Klösz György Download Ebook : budapest 1900 2000 in PDF Format. also available for mobile reader If you are looking for a book Budapest 1900-2000 by Vince Kiado;Klosz
Decision where Process Based OpRisk Management. made the difference. Norbert Kozma Head of Operational Risk Control. Erste Bank Hungary
Decision where Process Based OpRisk Management made the difference Norbert Kozma Head of Operational Risk Control Erste Bank Hungary About Erste Group 2010. 09. 30. 2 Erste Bank Hungary Erste Group entered
Angol érettségi témakörök 12.KL, 13.KM, 12.F
Angol érettségi témakörök 12.KL, 13.KM, 12.F TÉMÁK VIZSGASZINTEK Középszint 1. Személyes vonatkozások, család - A vizsgázó személye, életrajza, életének fontos állomásai (fordulópontjai) - Családi élet,
Daloló Fülelő Halász Judit Szabó T. Anna: Tatoktatok Javasolt nyelvi szint: A2 B1 / Resommended European Language Level: A2 B1
Daloló Fülelő Halász Judit Szabó T. Anna: Tatoktatok Javasolt nyelvi szint: A2 B1 / Resommended European Language Level: A2 B1 1. Első hallgatás / First listening Hallgassa meg Halász Judit dalát a Youtube-on!
SAJTÓKÖZLEMÉNY Budapest 2011. július 13.
SAJTÓKÖZLEMÉNY Budapest 2011. július 13. A MinDig TV a legdinamikusabban bıvülı televíziós szolgáltatás Magyarországon 2011 elsı öt hónapjában - A MinDig TV Extra a vezeték nélküli digitális televíziós
Can/be able to. Using Can in Present, Past, and Future. A Can jelen, múlt és jövő idejű használata
Can/ Can is one of the most commonly used modal verbs in English. It be used to express ability or opportunity, to request or offer permission, and to show possibility or impossibility. A az egyik leggyakrabban
Dependency preservation
Adatbázis-kezelés. (4 előadás: Relácó felbontásai (dekomponálás)) 1 Getting lossless decomposition is necessary. But of course, we also want to keep dependencies, since losing a dependency means, that
7 th Iron Smelting Symposium 2010, Holland
7 th Iron Smelting Symposium 2010, Holland Október 13-17 között került megrendezésre a Hollandiai Alphen aan den Rijn városában található Archeon Skanzenben a 7. Vasolvasztó Szimpózium. Az öt napos rendezvényen
Statistical Dependence
Statistical Dependence Petra Petrovics Statistical Dependence Deinition: Statistical dependence exists when the value o some variable is dependent upon or aected by the value o some other variable. Independent
Cloud computing Dr. Bakonyi Péter.
Cloud computing Dr. Bakonyi Péter. 1/24/2011 Cloud computing 1/24/2011 Cloud computing 2 Cloud definició A cloud vagy felhő egy platform vagy infrastruktúra Az alkalmazások és szolgáltatások végrehajtására
(NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV
Kommunikációs rendszerek programozása (NGB_TA024_1) MÉRÉSI JEGYZŐKÖNYV (5. mérés) SIP telefonközpont készítése Trixbox-szal 1 Mérés helye: Széchenyi István Egyetem, L-1/7 laboratórium, 9026 Győr, Egyetem
Vitorláshal Angelfish
Model: Peter udai 996. Diagrams: Peter udai 998.. Oda-visszahajtás felezve. Fordítsd meg a papírt! Fold in half and unfold. Turn the paper over. 2. Oda-visszahajtás átlósan. Fold and unfold diagonally.
Társasjáték az Instant Tanulókártya csomagokhoz
Társasjáték az Instant Tanulókártya csomagokhoz Játssz, szórakozz, tanulj! Hogyan tanulj játszva az Instant Tanulókártyákkal? Használati utasítás Az Instant Tanulókártya családhoz tartozó társasjátékkal
Contact us Toll free (800) fax (800)
Table of Contents Thank you for purchasing our product, your business is greatly appreciated. If you have any questions, comments, or concerns with the product you received please contact the factory.