A comprehensive study of parameter determination in a joint MRS and TEM data analysis scheme
|
|
- Barnabás Mészáros
- 6 évvel ezelőtt
- Látták:
Átírás
1 Near Surface Geophysics, 2013, 11, xxx-xxx doi: / A comprehensive study of parameter determination in a joint MRS and TEM data analysis scheme Ahmad A. Behroozmand *, Esben Dalgaard, Anders Vest Christiansen and Esben Auken Department of Geoscience, Aarhus University, Denmark Received May 2012, revision accepted March 2013 ABSTRACT We present a comprehensive study of the parameter determination of magnetic resonance sounding (MRS) models in a joint MRS and transient electromagnetic (TEM) data analysis scheme. The para meter determination is assessed by calculating the model parameter uncertainties based on an a posteriori model covariance matrix. An entire MRS data set, dependent on pulse moment and time gate values, together with TEM data, is used for all analyses and realistic noise levels are assigned to the data. Sensitivity analyses are studied for the determination of water content as a key parameter estimated during inversion of MRS data. We show the results for different suites of (three-layer) models, in which we investigate the effect of resistivity, water content, relaxation time, loop side length, number of pulse moments and measurement dead time on the determination of water content in a water-bearing layer. For all suites of models the effect of a top conductive and a top resistive layer are compared. Moreover, we analyse all models for a long (40 ms) and short (10 ms) measurement dead time. The effect of noise level on the parameter determination is also analysed. We conclude that, in general, the resistivity of the water-bearing layer (layer of interest, LOI) does not affect the determination of water content in the LOI but the resistivity of the top layer increases depth resolution; the water content of the LOI does not influence its determination considerably in cases where the signal has a relatively long relaxation time in the LOI; determination of the water content in the LOI is improved by increasing the relaxation time of the signal in the LOI; short measurement dead time will improve the parameter determination for signals with a relatively short relaxation time; increasing loop side length and the number of pulse moments do not necessarily improve the parameter determination. INTRODUCTION Magnetic resonance sounding (MRS), also called surface nuclear magnetic resonance (surface NMR), is an increasingly popular geophysical method for detailed characterization of groundwater resources because of its direct sensitivity to water molecules in the subsurface (e.g., Hertrich 2008). Protons of water molecules are excited at a natural equilibrium state within the Earth s magnetic field. A high-intensity current tuned at the Larmor frequency is passed through a large transmitter loop deployed at the surface. The exciting field tips the magnetization vector away from its equilibrium orientation along the Earth s magnetic field. After switching the current off, the NMR decaying signal (Free Induction Decay, FID) is measured with a wire loop on the surface. MRS data can be inverted with different approaches such as step-wise inversion, which utilizes a fixed MRS kernel consisting in the initial amplitude inversion (Legchenko and Shushakov * ahmad@geo.au.dk 1998) or an adaptive MRS kernel during the inversion (Braun and Yaramanci 2008; Braun et al. 2009), time-step inversion (Legchenko and Valla 2002; Mohnke and Yaramanci 2005), fulldecay (QT) inversion (Müller-Petke and Yaramanci 2010; Behroozmand et al. 2012b) and a joint inversion of MRS and TEM/DC data (Behroozmand et al. 2012a; Günther and Müller- Petke 2012). As inversion results most often the water content and relaxation time distributions are presented as a function of depth. Regardless of the inversion method, it is essential to assess the determination of the parameters in the inverted model. In the past there have been a few studies on the resolution of MRS parameters. For instance, Müller-Petke and Yaramanci (2008) studied the resolution of MRS data depending on the loop size, maximum pulse moment and the subsurface resistivity based on singular value decomposition of the MRS forward operator; the trade-off between measurement dead time and relaxation time is described in Dlugosch et al. (2011); Legchenko et al. (2002) defined the maximum depth of detection as the depth of the top 2013 European Association of Geoscientists & Engineers 1
2 2 A.A. Behroozmand of a 1 m thick infinite horizontal layer of water (100% water content); Günther and Müller-Petke (2012) and Müller-Petke et al. (2011) computed parameter uncertainties by variation of individual parameters; Schirov and Rojkowski (2002) and Lehmann- Horn et al. (2012) studied the sensitivity of MRS data in the presence of electrical conductivity anomalies; Walsh et al. (2011) showed the improved resolution of early-time signals using a shorter measurement dead time. In this paper, we assess model parameter determination by calculating the parameter uncertainties based on a linearized approximation to an a posteriori model covariance matrix. Doing this, we include the full system transfer function, including data noise and system parameters that are crucial in order to obtain reliable uncertainty estimates. The analyses were computed for conductive layered half-spaces. The entire MRS data set (Müller-Petke and Yaramanci 2010; Behroozmand et al. 2012b) is used during analyses, rather than initial amplitude data, in order to utilize the full information content of the MRS data. Behroozmand et al. (2012a) showed an improvement in MRS parameter determination by joint inversion of MRS and TEM data and discussed the advantage of TEM over DC resistivity (geo-electrics) because of its higher depth penetration. Hence, the analyses in this paper were carried out assuming both MRS and TEM datasets in a full joint implementation. Since water content is the key MRS parameter to be determined, we focus on the resolution of the water content. Compared to other studies, we carried out sensitivity analyses of many different models of conductive layered half-spaces, varying water contents, resistivities, loop side length, measurement dead time, the number of pulse moments, relaxation time and depth to the waterbearing layer. As to measurement dead time, we analysed for all models those typically obtained from the two commercially available types of MRS equipment (the Numis Poly of IRIS-Instruments and the GMR of Vista Clara Inc.). The rest of the specifications were based on the Numis Poly equipment. Finally, we analysed the effect of noise level on the parameter determination. in which V(q,t) is the entire cube of the measured signal integrated into time windows called gate, K(q, z) is the 1D MRS kernel depending on pulse moment and depth, z, and W(z) denotes water content distribution. The SE model is a function of the relaxation time T 2 * and the stretching exponent C at each depth. Natural noise contribution In order to give meaning to the sensitivity analysis of MRS data and in order to make the synthetic data comparable with field conditions, we selected all measurement parameters from field data acquired with the NUMIS Poly equipment. The noise contamination is likewise chosen carefully to resemble field conditions: where V resp are the perturbed synthetic data; V is the forward response; G(0,1) denotes the Gaussian distribution with a mean value of 0 and a standard deviation of 1; STD uni represents uniform noise added to the data in order to consider non-specified noise contributions like structural noise; V noise is the background noise contribution. For simulation of the MRS synthetic data, the forward response was contaminated by a Gaussian noise distribution with a standard deviation of 64 nv together with a uniform relative (2) METHODOLOGY In this section we will briefly introduce the implementation of the MRS forward response, noise models and model parameter determination from an a posteriori model covariance matrix. MRS forward modelling For the forward modelling of MRS data, the entire data set was simulated at different pulse moments (q) and different time gate values (t). A detailed description of the efficient full decay forward modelling of MRS data is presented in Behroozmand et al. (2012b). The stretched-exponential (SE) approach (Kenyon et al. 1988) approximates the multi-exponential behaviour of the MRS signal and the 1D forward response is given by (1) FIGURE 1 Three different noise levels ((a) high noise level, after 40 FIDs stacked together; (b) medium noise level, after 32 FIDs stacked together; (c) low noise level, after 6 FIDs stacked together) detected in the MRS field campaigns in Denmark. The plots show the data errors before gating, which are obtained from imaginary parts of the rotated data.
3 Parameter determination in a joint MRS and TEM data analysis scheme 3 noise of 3% of the data values, which are assigned to V noise and STD uni in equation (2). The 64 nv noise distribution was applied to the data before gating and the noise on the data was assumed to be uncorrelated. This realistic noise level was assigned to the MRS data to make the analysis results comparable with real field scenarios. In order to illustrate this, Fig. 1 represents three different background noise levels detected in some of our MRS field campaigns in Denmark; a) high noise level, after 40 FIDs stacked together, b) medium noise level, after 32 FIDs stacked together and c) low noise level, after 6 FIDs stacked together. The plots show the data errors before gating that are obtained from the imaginary parts of the rotated data (Müller-Petke et al. 2011). For the TEM data the background noise is given by (Auken et al. 2008) in which b = 3nV is considered as the noise level at 1 ms. In addition, the uniform standard deviation is set to 2% for db/dt responses using a noise calculation similar to equation (2). Parameter uncertainty estimation Based on a linear approximation to the a posteriori model covariance matrix C est, the estimation of the model parameter uncertainty is given by (Tarantola and Valette 1982; Auken and Christiansen 2004) where G is the Jacobian matrix of the forward mapping, R is the roughness of the constrained parameters and C obs, C prior and C R are the covariance matrices of the observed data, the a priori information and the roughness constraints. The parameter uncertainty estimates are then obtained by the square root of the diagonal elements of C est. The off-diagonal elements of C est describe the correlation between the model parameters but will not be dealt with in this paper. For the sensitivity analysis of MRS parameters, few layer 1D models were considered and no a priori information was applied to any of the model parameters. Hence, equation (4) becomes: The analyses were carried out on the logarithm of the model parameters, which provides a standard deviation factor STDF, on the parameter m i, given by Therefore, under a lognormal assumption, it is 68% likely that a given model parameter m falls in the interval (3) (4) (5) (6) (7) TABLE 1 Parameter uncertainty intervals and the colours used for analysis. Degree of parameter determination STDF Interval Very well determined <1.1 Well determined Determined Poorly determined Very poorly determined Undetermined >3.0 TABLE 2 Color The basic model used for analyses. Note that for analyses of the model parameters, one of the model parameters varies, as a sweeping parameter, together with depth to the LOI. Parameter Layer 1 Layer 2 Layer 3 ρ (Ohm-m) 10 and W (%) T * (ms) C thk (m) Inf This is a good approximation for mildly non-linear problems. We classified the parameter uncertainties in six intervals as stated in Table 1, ranging from STDF < 1.1 for very well determined parameters to STDF > 3.0 for completely undetermined para meters. Since the calculated uncertainties are based on a linear approximation of the forward mapping, the analysis must be considered qualitatively and not quantitatively, especially for large STDFs. SYNTHETIC EXAMPLES For all analyses, a coincident square loop configuration with a side length of 100 m and 1 turn was used for simulating MRS data. The MRS responses (FIDs) consisted of 24 pulse moments distributed between As. A Larmor frequency of 2130 Hz was considered and the Earth s magnetic field was set at an inclination of 70 degrees and a declination of 2 degrees. A 40 ms transmit pulse was used and the FID was calculated in a 500 ms time interval. In order to take the effect of a short measurement dead time in our analyses into account, we considered measurement dead times of both 40 ms (typically used with the Numis Poly/Plus equipment) and 10 ms (relevant to the GMR equipment, Vista Clara Inc.). Relaxation processes during the pulse were not included here. Based on the assumed noise model, we analysed the uncertainty estimates of the model parameters derived from the model covariance matrix in equation (5). The basic model consists of three layers; a silty clay top layer underlain by a 10 m aquifer, overlying another silty clay layer at the bottom. Throughout this paper, the second layer is referred to as the layer of interest (LOI).
4 4 A.A. Behroozmand Table 2 shows the basic model. All layers contain 30% of water while they have relaxation times of 20, 200 and 20 ms, respectively. These relaxation times may correspond to fine, medium to large and fine pore structures (e.g., Schirov et al. 1991). A homogeneous layered half-space is assumed so the C value is set to 1 for all layers and is free to change during analyses. We carried out the analyses for both a conductive (10 ohmm) and a resistive (100 ohm-m) top layer in order to see the effect of conductivity of the top layer. The parameters of each layer are named as the parameter abbreviation followed by the layer number. For instance, RHO1, W2, T 2* 3 and THK2 refer to resistivity of the first layer, water content of the second layer, relaxation time of the third layer and thickness of the second layer, respectively. For simulation of the TEM data, we used the specifications of the WalkTEM instrument, developed at the Department of Geoscience, Aarhus University. It employs a 40 by 40 m square transmitter loop and measures in a dual-moment set-up using a low and a high moment of 1 A and 8 A (magnetic moments of 1600 and Am 2 ) (Nyboe et al. 2010). Current turn-off ramps of 3 microseconds and 5.5 microseconds are assigned to the low- and high-moment current waveforms, respectively. The first data are calculated at a (gate) time of 8.2 microseconds, while the last measurement (gate) time is at 1.4 ms (about 10 gates per decade). The transmitter current waveform is an alternating square wave with 10 ms current on time followed by 10 ms measuring time. A central loop configuration was used for measurements, in which a receiver coil located in the centre of the transmitter loop measures the transient earth response. The analyses can be done for any 1D model but we will show a few examples giving insight into the resolution capabilities of MRS. We divided the parameters we want to sweep into two groups: the model parameters and the system parameters. We considered the following as the most important model parameters to sweep: resistivity of both the first (RHO1) and second layers (RHO2), water content of both the first (W1) and second layers (W2) and relaxation time of the second layer (T 2* 2). We also swept the following system parameters: loop side length (LS), number of pulse moments (#q) and measurement dead time (DT). Moreover, we studied the dependency of the results on different noise levels. Models 1A and 1B the effect of resistivity The first suite of models in our study (model 1A) investigates the effect from varying the resistivity of the LOI (RHO2) on the uncertainty of the water content in the LOI (W2). The model and the analyses are shown in the first column of Fig. 2 (panels a1, b1 and c1). Panel a1 sketches the resistivity model with the fixed parameters shown in black and the sweeping parameters in red. The depth to the LOI sweeps from m in 14 steps while RHO2 sweeps between ohm-m in 7 steps. The same sweeping values of depth to the LOI are used for all mod- FIGURE 2 Sensitivity analyses for models 1A (the effect of RHO2) and 1B (the effect of RHO1). Panels a1 and a2 sketch the resistivity models. Dashed red lines show the sweeping parameters, while fixed parameters are shown with solid black lines. Red arrows show the sweeping intervals. The rest of the parameters are as stated in Table 2. The results present resolution of the parameter W2 in colours; see the legend and Table 1. The panels in rows 2 and 3 show analyses of the same models for different measurement dead times of 40 ms and 10 ms, respectively. For site specifications see the text. els. The total number of analysed models in Fig. 2 thus consists of 14 7 = 98 models. The remaining model parameters are as given in Table 2.
5 Parameter determination in a joint MRS and TEM data analysis scheme 5 FIGURE 3 An example of MRS and TEM responses used in sensitivity analyses, together with their standard deviation. The responses are simulated for the model containing RHO2 = 100 ohm-m and depth to the LOI of 5 m in Fig. 2, panel b1 (depicted in column 5 and row 1). (a,b) The MRS forward responses for q = 0.1 As and q = 13.9 As. c) The TEM forward response in db/dt for the low-moment (grey) and high-moment data (black). The results are shown as colour boxes, changing from green (very well determined parameter, STDF < 1.1) to dark blue (completely undetermined parameter, STDF > 3.0). In the b panels (b1 and b2) the dead time is 40 ms while for the c panels (c1 and c2) it is only 10 ms. If we use the terms given in Table 1, all parameters uncertainties shown in warm colours are resolved to a given degree, while uncertainties shown in cold colours are unresolved. In panel b1, the analyses show that the resistivity of the water-bearing layer (LOI) has a negligible effect on the resolution of W2. A slight improvement is observed for RHO2s of 1 and 3 ohm-m in deep parts, which is due to a better TEM resolution of these very conductive layers. Larger resistivity values have no influence on the determination of W2. The latter was also concluded by Braun and Yaramanci (2008). W2 is very well determined (green colour) down to 40 m for all models, well to poorly determined at a depth of 50 m and almost undetermined afterwards. Panel c1, with a dead time of only 10 ms, generally matches the results in panel b1, except that the lower boundary of the resolved structure moves deeper to depths of 70 m. Considering the site specifications, i.e., loop size etc., a relatively shallow part of the structure (down to 40 m) is very well determined (green colour) in panels b1 and c1, which is due to the high conductivity of the top layer (RHO1 = 10 ohm-m). In order to investigate the effect of the resistivity of the top layer, panels b2 and c2 in Fig. 2 have RHO1 as the sweeping parameter. Panel a2 shows the resistivity model. The resistivity RHO1 varies between ohm-m and RHO2 is set to 100 ohm-m. Increasing the resistivity of the top layer increases the resolution at depth as expected, forming a sloped feature for the resolved parameters as shown in panel b2. The lower boundary of the resolved structure varies from 20 m for RHO1 of 1 ohm-m down to 100 m for RHO1 of 1000 ohm-m. Panel c2 shows about the same as panel b2 indicating that the dead time in this case has little influence on the model parameter determination. It is noteworthy that analyses of both models 1A and 1B represent identical structures of very well determined parameters (green colour) in rows b) and c) (comparing panels b1 and c1 and panels b2 and c2). In other words, for these two suites of models, the measurement dead times of 10 ms and 40 ms lead to the same analysis of very well determined parameters. This is explained by the high-relaxation time in the LOI (200 ms), meaning that the FID is long enough to be characterized properly anyway. We will show this effect later in models 3A and 3B. For completeness we show an example of the MRS and TEM data together with their standard deviation in Fig. 3. The responses assume RHO2 = 100 ohm-m and a depth to the LOI of 5 m (the model in column 5 and row 1 in panel b1). Panels a and b show the MRS response on a logarithmic scale for small (0.1 As) and large (13.9 As) pulse moments and the corresponding noise on the data. The TEM response is shown in panel c. The lowmoment (LM) data are shown in grey, while black represents the high-moment (HM) data.
6 6 A.A. Behroozmand Models 2A and 2B the effect of water content Model 2A studies the effect of water content (in the LOI, W2) on its resolution. The water content model is sketched in Fig. 4, panel a1. The water content of the first and third layers was set to 30% and W2 varied between 5 45% (9 values, equally spaced). Therefore, each panel of the analyses contains 14 9 = 126 analysed models. Resistivity values of 10, 100 and 10 ohm-m were assigned to the layers and the rest of the parameter values were as stated in Table 2. As a main result of these model analyses, the water content of the LOI does not considerably influence how well it is determined. Again this is mainly due to the high relaxation time in the LOI (200 ms) and the lowrelaxation times (20 ms) in the other layers. The results are shown in panel b1. The estimated W2 is well determined down to 40 m (due to the top conductive layer), poorly determined at a depth of 50 m and undetermined afterwards. As panel c1 shows, a decreasing measurement dead time provides more information in the depth interval from m. However, similar to panel b1, the effect of W2 on its resolution is negligible for well determined parts of the structure. Column 2 of Fig. 4 deals with model 2B for which the water content of the top layer varies as the sweeping parameter, as sketched in panel a2. The same values, as in model 2A, between 5 45% were considered for W1 and W2 was set to 30%. The rest of the parameters were set to their values as in model 2A. Variation of W1 has no influence on the determination of parameter W2, as shown in panel b2. This is due to a short relaxation time (20 ms) of the top layer, i.e., for the considered range of W1 the contribution of the top layer to the FIDs vanishes before the measurement starts. For a measurement dead time of 10 ms (panel c2), the same analysis structure is observed and more depth information is provided. Similar to models 1A and 1B, the depth resolution of the well determined part of the structure is not improved by decreasing the measurement dead time because of a relatively high- relaxation time of the LOI. Models 3A and 3B the effect of relaxation time The last suite of analysed models with sweeping model parameters considers the effect of the relaxation time of the LOI (T 2* 2) on the resolution of W2. Panel a1 in Fig. 5 shows the resistivity models. The layers have resistivity values of 10, 100 and 10 ohm-m, respectively. All layers contain a water content of 30% and the rest of the parameters follow the values in Table 2. The sweeping parameters are depth to the LOI and the relaxation time of the LOI that varies between ms (9 values), i.e., form different contexts from a very fine pore structure (silty clay) to a large pore structure (coarse sand and gravel) (Schirov et al. 1991). Hence, 14 9 = 126 models were analysed in each panel. In panel b1, i.e., considering a measurement dead time of 40 ms, the very well determined structure (green colour) starts from a T 2* 2 value of 75 ms. Nothing is resolved for a relaxation time of 20 ms even at shallow depths. As expected, increasing the FIGURE 4 Sensitivity analyses for models 2A (the effect of W2) and 2B (the effect of W1). Panels a1 and a2 sketch the water content models. Dashed red lines show the sweeping parameters, while fixed parameters are shown with solid black lines. Red arrows show the sweeping intervals. The rest of the parameters are as stated in Table 2. The results present resolution of the parameter W2 in colours; see the legend and Table 1. The panels in rows 2 and 3 show analyses of the same models for different measurement dead times of 40 ms and 10 ms, respectively. For site specifications see the text. relaxation time at the LOI will improve the determination of W2 both at shallow intervals and at larger depths. Both relaxation times of 200 and 300 ms (two last columns) represent identical parameter determination. The same feature of improvement in
7 Parameter determination in a joint MRS and TEM data analysis scheme 7 times, which is due to the shorter measurement dead time. Moreover, improved depth information is obtained when decreasing the dead time and the lower boundary of the resolved structure moves down from 50 m to 80 m. Column 2 in Fig. 5 shows model 3B together with the analyses. The model differs from model 3A in terms of resistivity of the top layer, which is increased to 100 ohm-m. Compared to panel b1, depth resolution is significantly improved in panel b2 because of the high resistivity of the top layer. This effect is more pronounced for long T 2 * values. Similar to the results in panel c1, a shorter measurement dead time improves the results, particularly for short T 2 * values (panel c2). Improvement with depth of the resolved structure is less pronounced here compared to model 3A where the top layer is conductive. In summary, the short measurement dead time highly improves parameter determinations especially for signals with a short relaxation time. Improvement in parameter determination at larger depths is largest when a top resistive layer exists. The next three synthetic models present the effect of system parameters on the determination of W2. FIGURE 5 Sensitivity analyses for models 3A and 3B, both showing the effect of T 2* 2. The models differ in resistivity of the top layer. Panels a1 and a2 sketch the resistivity models. Dashed red lines show the sweeping parameters, while fixed parameters are shown with solid black lines. Red arrows show the sweeping intervals. The rest of the parameters are as stated in Table 2. The results present resolution of the parameter W2 in colours; see the legend and Table 1. The panels in rows 2 and 3 show analyses of the same models for different measurement dead times of 40 ms and 10 ms, respectively. For site specifications see the text. W2 determination is seen in panel c1 in which the measurement dead time is set to 10 ms. Compared to panel b1, the parameter determination is improved considerably for short relaxation Models 4A and 4B the effect of loop side length In this part, we study the effect of the parameter loop side length on the determination of parameter W2. These analyses were carried out to investigate how the resolution and depth information are improved by enlarging the loop. The results are shown in Fig. 6. The resistivity models (panels a1 and a2) are the same as in Fig. 5, i.e., resistivity values of 10, 100 and 10 ohm-m from top to bottom and other parameters are as stated in Table 2. Loop side length values of 25, 50, 75, 100 and 150 m were considered for the analyses, which form 14 5 = 70 analysed models in each panel. For a measurement dead time of 40 ms, increasing the loop side length does not necessarily improve the determination of W2 as shown in Fig. 6, panel b1. This matter is also highlighted in Müller-Petke and Yaramanci (2008). Depth information is improved by increasing the loop side length up to 75 m, while no considerable improvement is achieved by further increasing the loop side length from 75 m to 150 m. The same behaviour is observed when decreasing the dead time to 10 ms (panel c1), except that, most importantly, depth resolution is improved and the lower boundary of the resolved structure moves down to 80 m. Note that the estimation of the very well determined structure (green part) does not depend on the measurement dead time. Similar to panel b1, the parameter W2 is almost equally determined for loop side lengths of 75, 100 and 150 m. This is an interesting result that helps to save time and effort in the field and makes MRS sounding possible in a more confined space without loss of information. For the case of the top resistive layer (model 4B, column 2), depth information is generally improved by increasing the loop side length, for both long (40 ms, panel b2) and short (10 ms, panel c2) dead times. In addition, a slight improvement of infor-
8 8 A.A. Behroozmand mation on depth is achieved when employing the shorter dead time but very well resolved parameters (green colour) are determined as well as in panel b2. It should be mentioned that the noise levels were scaled with the loop size. Furthermore, it is noteworthy that these results are obtained by considering the same q max for all loop sizes, which does not exactly occur in a real case. It means that the instrument limitation in sending an identical maximum current for different loop sizes was not taken into account. Models 5A and 5B the effect of measurement dead time In this part, we sweep the measurement dead time together with the depth to the LOI. Five values of 5, 10, 20, 30 and 40 ms were assigned to the measurement dead times, forming 14 5 = 70 analysed models in each panel, as shown in Fig. 7. Similar resistivity models as in Fig. 5 are used and the rest of the parameters follow the values in Table 2. In the case of a top conductive layer (panel b1), depth resolution is generally weakened by increasing the dead FIGURE 6 Sensitivity analyses for models 4A and 4B. Both show the effect of loop side length. The models differ in resistivity of the top layer, as sketched in panels a1 and a2. Dashed red lines show the sweeping parameters, while fixed parameters are shown with solid black lines. Red arrows show the sweeping intervals. The rest of the parameters are as stated in Table 2. The results present resolution of the parameter W2 in colours; see the legend and Table 1. The panels in rows 2 and 3 show analyses of the same models for different measurement dead times of 40 ms and 10 ms, respectively. For site specifications see the text. FIGURE 7 Sensitivity analyses for models 5A and 5B. Both show the effect of measurement dead time. The models differ in resistivity of the top layer. Panels a1 and a2 sketch the resistivity models. Dashed red lines show the sweeping parameters, while fixed parameters are shown with solid black lines. Red arrows show the sweeping intervals. The rest of the parameters are as stated in Table 2. The results present resolution of the parameter W2 in colours; see the legend and Table 1. For site specifications see the text.
9 Parameter determination in a joint MRS and TEM data analysis scheme 9 time value up to 30 ms and the same resolutions are achieved for dead time values of 30 and 40 ms. It should be noted that for model 5A, the very well determined part of the structure (green colour) does not vary for the given dead time values. This is due to the fact that a long relaxation time of 200 ms in the LOI allows characterizing the FIDs even if long dead time values are applied. For the case of a top resistive layer (panel a2), no significant improvement is observed (panel b2) but the depth resolution is increased as expected. Through the structure, closely identical estimates of W2 are achieved for all dead time values. The results of this analysis underline the importance of the measurement dead time for the resolution of a given model. Models 6A and 6B the effect of the number of pulse moments This suite of synthetic models deals with the effect of the number of pulse moments q, which is the product of current amplitude and pulse duration. Müller-Petke and Yaramanci (2008) studied the effect of q max itself. The number of pulse moments is one of the key parameters determining the total time it takes to perform a full sounding. During a measurement, a series of increasing pulse moments provide depth information. In addition, pulse moments need to be sampled densely enough in order to provide sufficient resolution of the subsurface when calculating the MRS kernel. The aim of studying models 6A and 6B is to find the sufficient number of pulse moments required for the best model parameter determination of a given model. In other words, to investigate how increasing the number of pulse moments increases the determination of model parameters (here W2). The same resistivity models as in Fig. 5 are considered as shown in Fig. 8 (panels a1 and a2) and the rest of the parameters are as stated in Table 2. Seven values of 2, 4, 8, 12, 16, 20 and 24 are considered as the number of pulse moments #q, which are spaced between pulse moment values of 0.11 and As. Therefore, 14 7 = 98 analysed models are investigated in each panel. Panel b1 shows that the determination of W2 is improved by increasing #q up to 16. After this, almost no increase in the resolution is achieved by increasing #q. Decreasing dead time (panel c1) will increase depth information as seen for other models and, like in panel b1, closely identical determination of W2 is obtained for #q of 16, 20 and 24. In the case of a top resistive layer (model 6B, column 2), the analyses result in the same conclusion as for model 6A, meaning that 16 pulse moments are sufficient for determination of W2 in the given models. Taking advantage of this knowledge, the time saved is 33% on this model, compared to using 24 pulse moments. Note that the sufficient number of pulse moments might change for different models but increasing the number of pulse moments does not necessarily increase the parameter determination. This matter is also highlighted in Legchenko and Shushakov (1998). The effect of noise level This last suite of synthetic models investigates the influence of noise level on the parameter determination. We repeated the FIGURE 8 Sensitivity analyses for models 6A and 6B. Both show the effect of the number of pulse moments #q. The models differ in resistivity of the top layer, as sketched in panels a1 and a2. Dashed red lines show the sweeping parameters, while fixed parameters are shown with solid black lines. Red arrows show the sweeping intervals. The rest of the parameters are as stated in Table 2. The results present resolution of the parameter W2 in colours; see the legend and Table 1. The panels in rows 2 and 3 show analyses of the same models for different measurement dead times of 40 ms and 10 ms, respectively. For site specifications see the text. analyses of model 3B (panel b2 in Fig. 5) considering different background noise levels of 16, 64 and 256 nv in equation (2). The results are shown in Fig. 9. The same resistivity and MRS
10 10 A.A. Behroozmand FIGURE 9 Influence of noise level on the parameter determination. The analyses were repeated for model 3B (panel b2 in Fig. 5) considering different background noise levels of 16 (left), 64 (middle, the same as panel b2 in Fig. 5) and 256 nv (right) in equation (2). The rest of the parameters are as stated in Fig. 5 column 2. The results present resolution of the parameter W2 in colours; see the legend and Table 1. For site specifications see the text. parameters as in Fig. 5 column 2 are used for analyses. As clearly seen, increasing the noise level weakens the parameter determination over the x-axis (T 2* 2) and in depth. CONCLUSION We studied the parameter determination of MRS models in a joint application of MRS and TEM data. The analyses are presented for many different models in which the effects of the model and the system parameters on the determination of water content are investigated. These parameters consist in resistivity, water content, relaxation time, loop side length, number of pulse moments and measurement dead time. The results are compared for cases of both a conductive and a resistive top layer and for two measurement dead times of 40 ms and 10 ms, which are typically obtained with the two kinds of commercially available MRS equipment. Moreover, we showed the effect of noise level on the parameter determination. As the main results of the investigated models, the resistivity of the water-bearing layer (LOI) has a negligible effect on the resolution of W2, whereas increasing resistivity of the top layer increases the resolution at depth as expected (Fig. 2). The water content of the LOI does not influence its determination considerably and variation of W1 has no influence on the determination of W2 (Fig. 4). Increasing T 2* 2 will improve the determination of W2 both at shallow intervals and at larger depths and depth resolution is significantly improved when a top resistive layer exists (Figs 5b1 and 5b2). Moreover, the parameter determination is considerably improved for short relaxation times (Figs 5c1 and 5c2). This highlights the effect of a short measurement dead time for signals with a short relaxation time. Increasing the loop side length does not necessarily improve the determination of W2 (Figs 6b1 and 6c1). The same result is concluded in the case of a resistive top layer (model 4B), except that the depth information is improved (Figs 6b2 and 6c2). A short measurement dead time will improve the parameter determination if the signal has a relatively short relaxation time in the LOI (Figs 5 and 7). Increasing the number of pulse moments does not necessarily improve the parameter determination (Fig. 8). For given geological information of the measurement site, a pre-survey analysis will help to optimize the measurement time and the resolution of model parameters. ACKNOWLEDGEMENTS This work was carried out as part of the Danish Council of Strategic Research Project titled HyGEM Integrating geophysics, geology, and hydrology for improved groundwater and environmental management, the RiskPoint project (Assessing the Risks Posed by Point Source Contamination to Groundwater and Surface Water Resources, grant number ) and NICA (Nitrate Reduction in Geologically Heterogeneous Catchments), the two latter projects supported by the Danish Agency for Science Technology and Innovation. We would also like to thank Nikolaj Foged and Gianluca Fiandaca, Aarhus University, for many useful discussions during the work with the analyses. We would like to thank two anonymous reviewers whose fruitful comments helped improve the clarity of this paper. REFERENCES Auken E. and Christiansen A.V Layered and laterally constrained 2D inversion of resistivity data. Geophysics 69, Auken E., Christiansen A.V., Jacobsen L. and Sørensen K.I A resolution study of buried valleys using laterally constrained inversion of TEM data. Journal of Applied Geophysics 65, Behroozmand A.A., Auken E., Fiandaca G. and Christiansen A.V. 2012a. Improvement in MRS parameter estimation by joint and laterally constrained inversion of MRS and TEM data. Geophysics 74, WB191 WB200.
11 Parameter determination in a joint MRS and TEM data analysis scheme 11 Behroozmand A.A., Auken E., Fiandaca G., Christiansen A.V. and Christensen N.B. 2012b. Efficient full decay inversion of MRS data with a stretched-exponential approximation of the T2* distribution. Geophysical Journal International 190, Braun M., Kamm J. and Yaramanci U Simultaneous inversion of magnetic resonance sounding in terms of water content, resistivity and decay times. Near Surface Geophysics 7, Braun M. and Yaramanci U Inversion of resistivity in Magnetic Resonance Sounding. Journal of Applied Geophysics 66, Dlugosch R., Mueller-Petke M., Günther T., Costabel S. and Yaramanci U Assessment of the potential of a new generation of surface nuclear magnetic resonance instruments. Near Surface Geophysics 9, Günther T. and Müller-Petke M Hydraulic properties at the North Sea island Borkum derived from joint inversion of magnetic resonance and electrical resistivity sounding. Hydrology and Earth System Sciences Discussions 9, Hertrich M Imaging of groundwater with nuclear magnetic resonance. Progress in Nuclear Magnetic Resonance Spectroscopy 53, Kenyon W.E., Day P.I., Straley C. and Willemsen J.F Three-part study of NMR longitudinal relaxation properties of water-saturated sandstones. SPE Formation Evaluation 3, Legchenko A., Baltassat J.M., Beauce A. and Bernard J Nuclear magnetic resonance as a geophysical tool for hydrogeologists. Journal of Applied Geophysics 50, Legchenko A.V. and Shushakov O.A Inversion of surface NMR data. Geophysics 63, Legchenko A. and Valla P A review of the basic principles for proton magnetic resonance sounding measurements. Journal of Applied Geophysics 50, Lehmann-Horn J.A., Hertrich M., Greenhalgh S.A. and Green A. G On the sensitivity of surface NMR in the presence of electrical conductivity anomalies. Geophysical Journal International 189, Mohnke O. and Yaramanci U Forward modeling and inversion of MRS relaxation signals using multi-exponential decomposition. Near Surface Geophysics 3, Müller-Petke M., Dlugosch R. and Yaramanci U Evaluation of surface nuclear magnetic resonance-estimated subsurface water content. New Journal of Physics 13. Müller-Petke M. and Yaramanci U Resolution studies for Magnetic Resonance Sounding (MRS) using the singular value decomposition. Journal of Applied Geophysics 66, Müller-Petke M. and Yaramanci U QT inversion Comprehensive use of the complete surface NMR data set. Geophysics 75, WA199 WA209. Nyboe N.S., Jørgensen F. and Sørensen K.I Integrated inversion of TEM and seismic data facilitated by high penetration depths of a segmented receiver setup. Near Surface Geophysics 8, Schirov M.D., Legchenko A. and Creer G A New Non-invasive Groundwater Detection Technology for Australia. Exploration Geophysics 22, Schirov M.D. and Rojkowski A.D On the accuracy of parameters determination from SNMR measurements. Journal of Applied Geophysics 50, Tarantola A. and Valette B Generalized nonlinear inverse problems solved using an east squares criterion. Reviews of Geophysics and Space Physics 20, Walsh D.O., Grunewald E., Turner P., Hinnell A. and Ferre P Practical limitations and applications of short dead time surface NMR. Near Surface Geophysics 9,
12
Correlation & Linear Regression in SPSS
Petra Petrovics Correlation & Linear Regression in SPSS 4 th seminar Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Correlation
Construction of a cube given with its centre and a sideline
Transformation of a plane of projection Construction of a cube given with its centre and a sideline Exercise. Given the center O and a sideline e of a cube, where e is a vertical line. Construct the projections
Enhancing SNMR model resolution by selecting an optimum combination of pulse moments, stacking, and gating
Near Surface Geophysics, 2016, 14, xxx-xxx doi:10.3997/1873-0604.2016004 Enhancing SNMR model resolution by selecting an optimum combination of pulse moments, stacking, and gating E. Dalgaard 1,3*, M.
Supporting Information
Supporting Information Cell-free GFP simulations Cell-free simulations of degfp production were consistent with experimental measurements (Fig. S1). Dual emmission GFP was produced under a P70a promoter
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Nonparametric Tests
Nonparametric Tests Petra Petrovics Hypothesis Testing Parametric Tests Mean of a population Population proportion Population Standard Deviation Nonparametric Tests Test for Independence Analysis of Variance
Correlation & Linear Regression in SPSS
Correlation & Linear Regression in SPSS Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise 1 - Correlation File / Open
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Correlation & Linear. Petra Petrovics.
Correlation & Linear Regression in SPSS Petra Petrovics PhD Student Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Exercise
Ensemble Kalman Filters Part 1: The basics
Ensemble Kalman Filters Part 1: The basics Peter Jan van Leeuwen Data Assimilation Research Centre DARC University of Reading p.j.vanleeuwen@reading.ac.uk Model: 10 9 unknowns P[u(x1),u(x2),T(x3),.. Observations:
STUDENT LOGBOOK. 1 week general practice course for the 6 th year medical students SEMMELWEIS EGYETEM. Name of the student:
STUDENT LOGBOOK 1 week general practice course for the 6 th year medical students Name of the student: Dates of the practice course: Name of the tutor: Address of the family practice: Tel: Please read
FAMILY STRUCTURES THROUGH THE LIFE CYCLE
FAMILY STRUCTURES THROUGH THE LIFE CYCLE István Harcsa Judit Monostori A magyar társadalom 2012-ben: trendek és perspektívák EU összehasonlításban Budapest, 2012 november 22-23 Introduction Factors which
Statistical Inference
Petra Petrovics Statistical Inference 1 st lecture Descriptive Statistics Inferential - it is concerned only with collecting and describing data Population - it is used when tentative conclusions about
Computer Architecture
Computer Architecture Locality-aware programming 2016. április 27. Budapest Gábor Horváth associate professor BUTE Department of Telecommunications ghorvath@hit.bme.hu Számítógép Architektúrák Horváth
Performance Modeling of Intelligent Car Parking Systems
Performance Modeling of Intelligent Car Parking Systems Károly Farkas Gábor Horváth András Mészáros Miklós Telek Technical University of Budapest, Hungary EPEW 2014, Florence, Italy Outline Intelligent
On The Number Of Slim Semimodular Lattices
On The Number Of Slim Semimodular Lattices Gábor Czédli, Tamás Dékány, László Ozsvárt, Nóra Szakács, Balázs Udvari Bolyai Institute, University of Szeged Conference on Universal Algebra and Lattice Theory
Cluster Analysis. Potyó László
Cluster Analysis Potyó László What is Cluster Analysis? Cluster: a collection of data objects Similar to one another within the same cluster Dissimilar to the objects in other clusters Cluster analysis
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Factor Analysis
Factor Analysis Factor analysis is a multiple statistical method, which analyzes the correlation relation between data, and it is for data reduction, dimension reduction and to explore the structure. Aim
Rezgésdiagnosztika. Diagnosztika 02 --- 1
Rezgésdiagnosztika Diagnosztika 02 --- 1 Diagnosztika 02 --- 2 A rezgéskép elemzésével kimutatható gépészeti problémák Minden gép, mely tartalmaz forgó részt (pl. motor, generátor, szivattyú, ventilátor,
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Nonparametric Tests. Petra Petrovics.
Nonparametric Tests Petra Petrovics PhD Student Hypothesis Testing Parametric Tests Mean o a population Population proportion Population Standard Deviation Nonparametric Tests Test or Independence Analysis
Using the CW-Net in a user defined IP network
Using the CW-Net in a user defined IP network Data transmission and device control through IP platform CW-Net Basically, CableWorld's CW-Net operates in the 10.123.13.xxx IP address range. User Defined
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Hypothesis Testing. Petra Petrovics.
Hypothesis Testing Petra Petrovics PhD Student Inference from the Sample to the Population Estimation Hypothesis Testing Estimation: how can we determine the value of an unknown parameter of a population
3. MINTAFELADATSOR KÖZÉPSZINT. Az írásbeli vizsga időtartama: 30 perc. III. Hallott szöveg értése
Oktatáskutató és Fejlesztő Intézet TÁMOP-3.1.1-11/1-2012-0001 XXI. századi közoktatás (fejlesztés, koordináció) II. szakasz ANGOL NYELV 3. MINTAFELADATSOR KÖZÉPSZINT Az írásbeli vizsga időtartama: 30 perc
Széchenyi István Egyetem www.sze.hu/~herno
Oldal: 1/6 A feladat során megismerkedünk a C# és a LabVIEW összekapcsolásának egy lehetőségével, pontosabban nagyon egyszerű C#- ban írt kódból fordítunk DLL-t, amit meghívunk LabVIEW-ból. Az eljárás
Cashback 2015 Deposit Promotion teljes szabályzat
Cashback 2015 Deposit Promotion teljes szabályzat 1. Definitions 1. Definíciók: a) Account Client s trading account or any other accounts and/or registers maintained for Számla Az ügyfél kereskedési számlája
Contact us Toll free (800) fax (800)
Table of Contents Thank you for purchasing our product, your business is greatly appreciated. If you have any questions, comments, or concerns with the product you received please contact the factory.
A rosszindulatú daganatos halálozás változása 1975 és 2001 között Magyarországon
A rosszindulatú daganatos halálozás változása és között Eredeti közlemény Gaudi István 1,2, Kásler Miklós 2 1 MTA Számítástechnikai és Automatizálási Kutató Intézete, Budapest 2 Országos Onkológiai Intézet,
EN United in diversity EN A8-0206/419. Amendment
22.3.2019 A8-0206/419 419 Article 2 paragraph 4 point a point i (i) the identity of the road transport operator; (i) the identity of the road transport operator by means of its intra-community tax identification
Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz
Bevezetés a kvantum-informatikába és kommunikációba 2015/2016 tavasz Kvantumkapuk, áramkörök 2016. március 3. A kvantummechanika posztulátumai (1-2) 1. Állapotleírás Zárt fizikai rendszer aktuális állapota
FÖLDRAJZ ANGOL NYELVEN
Földrajz angol nyelven középszint 0821 ÉRETTSÉGI VIZSGA 2009. május 14. FÖLDRAJZ ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI ÉRETTSÉGI VIZSGA JAVÍTÁSI-ÉRTÉKELÉSI ÚTMUTATÓ OKTATÁSI ÉS KULTURÁLIS MINISZTÉRIUM Paper
Hasznos és kártevő rovarok monitorozása innovatív szenzorokkal (LIFE13 ENV/HU/001092)
Hasznos és kártevő rovarok monitorozása innovatív szenzorokkal (LIFE13 ENV/HU/001092) www.zoolog.hu Dr. Dombos Miklós Tudományos főmunkatárs MTA ATK TAKI Innovative Real-time Monitoring and Pest control
Genome 373: Hidden Markov Models I. Doug Fowler
Genome 373: Hidden Markov Models I Doug Fowler Review From Gene Prediction I transcriptional start site G open reading frame transcriptional termination site promoter 5 untranslated region 3 untranslated
Mapping Sequencing Reads to a Reference Genome
Mapping Sequencing Reads to a Reference Genome High Throughput Sequencing RN Example applications: Sequencing a genome (DN) Sequencing a transcriptome and gene expression studies (RN) ChIP (chromatin immunoprecipitation)
First experiences with Gd fuel assemblies in. Tamás Parkó, Botond Beliczai AER Symposium 2009.09.21 25.
First experiences with Gd fuel assemblies in the Paks NPP Tams Parkó, Botond Beliczai AER Symposium 2009.09.21 25. Introduction From 2006 we increased the heat power of our units by 8% For reaching this
Implementation of water quality monitoring
Joint Ipoly/Ipel Catchment Management HUSK/1101/2.1.1/0153 Implementation of water quality monitoring Dr. Adrienne Clement clement@vkkt.bme.hu Budapest University of Technology and Economics Department
A jövedelem alakulásának vizsgálata az észak-alföldi régióban az 1997-99. évi adatok alapján
A jövedelem alakulásának vizsgálata az észak-alföldi régióban az 1997-99. évi adatok alapján Rózsa Attila Debreceni Egyetem Agrártudományi Centrum, Agrárgazdasági és Vidékfejlesztési Intézet, Számviteli
Sebastián Sáez Senior Trade Economist INTERNATIONAL TRADE DEPARTMENT WORLD BANK
Sebastián Sáez Senior Trade Economist INTERNATIONAL TRADE DEPARTMENT WORLD BANK Despite enormous challenges many developing countries are service exporters Besides traditional activities such as tourism;
Utasítások. Üzembe helyezés
HASZNÁLATI ÚTMUTATÓ Üzembe helyezés Utasítások Windows XP / Vista / Windows 7 / Windows 8 rendszerben történő telepítéshez 1 Töltse le az AORUS makróalkalmazás telepítőjét az AORUS hivatalos webhelyéről.
Utolsó frissítés / Last update: február Szerkesztő / Editor: Csatlós Árpádné
Utolsó frissítés / Last update: 2016. február Szerkesztő / Editor: Csatlós Árpádné TARTALOM / Contents BEVEZETŐ / Introduction... 2 FELNŐTT TAGBÉLYEGEK / Adult membership stamps... 3 IFJÚSÁGI TAGBÉLYEGEK
Hulladéklerakók és környezetük állapotfelmérése geofizikai módszereinek fejlesztése
Hulladéklerakók és környezetük állapotfelmérése geofizikai módszereinek fejlesztése OTKA szám: T 42686 Témavezető: Prof. Dr. Gyulai Ákos ME Geofizikai Tanszék Miskolc 247 Prof.Dr. Gyulai Ákos: Budapest.
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel Timea Farkas Click here if your download doesn"t start
Választási modellek 3
Választási modellek 3 Prileszky István Doktori Iskola 2018 http://www.sze.hu/~prile Forrás: A Self Instructing Course in Mode Choice Modeling: Multinomial and Nested Logit Models Prepared For U.S. Department
Szundikáló macska Sleeping kitty
Model: Peter Budai 999. Diagrams: Peter Budai 999.. Oda-visszahajtás átlósan. Fold and unfold diagonally. 2. Behajtunk középre. Fold to the center. 3. Oda-visszahajtások derékszögben. Fold and unfold at
Statistical Dependence
Statistical Dependence Petra Petrovics Statistical Dependence Deinition: Statistical dependence exists when the value o some variable is dependent upon or aected by the value o some other variable. Independent
Geokémia gyakorlat. 1. Geokémiai adatok értelmezése: egyszerű statisztikai módszerek. Geológus szakirány (BSc) Dr. Lukács Réka
Geokémia gyakorlat 1. Geokémiai adatok értelmezése: egyszerű statisztikai módszerek Geológus szakirány (BSc) Dr. Lukács Réka MTA-ELTE Vulkanológiai Kutatócsoport e-mail: reka.harangi@gmail.com ALAPFOGALMAK:
A BÜKKI KARSZTVÍZSZINT ÉSZLELŐ RENDSZER KERETÉBEN GYŰJTÖTT HIDROMETEOROLÓGIAI ADATOK ELEMZÉSE
KARSZTFEJLŐDÉS XIX. Szombathely, 2014. pp. 137-146. A BÜKKI KARSZTVÍZSZINT ÉSZLELŐ RENDSZER KERETÉBEN GYŰJTÖTT HIDROMETEOROLÓGIAI ADATOK ELEMZÉSE ANALYSIS OF HYDROMETEOROLIGYCAL DATA OF BÜKK WATER LEVEL
7 th Iron Smelting Symposium 2010, Holland
7 th Iron Smelting Symposium 2010, Holland Október 13-17 között került megrendezésre a Hollandiai Alphen aan den Rijn városában található Archeon Skanzenben a 7. Vasolvasztó Szimpózium. Az öt napos rendezvényen
Abigail Norfleet James, Ph.D.
Abigail Norfleet James, Ph.D. Left side of brain develops first in girls, right in boys o Probably source of girls verbal skills o And source of boys spatial skills Pre-frontal lobes Control impulses and
USER MANUAL Guest user
USER MANUAL Guest user 1 Welcome in Kutatótér (Researchroom) Top menu 1. Click on it and the left side menu will pop up 2. With the slider you can make left side menu visible 3. Font side: enlarging font
Create & validate a signature
IOTA TUTORIAL 7 Create & validate a signature v.0.0 KNBJDBIRYCUGVWMSKPVA9KOOGKKIRCBYHLMUTLGGAV9LIIPZSBGIENVBQ9NBQWXOXQSJRIRBHYJ9LCTJLISGGBRFRTTWD ABBYUVKPYFDJWTFLICYQQWQVDPCAKNVMSQERSYDPSSXPCZLVKWYKYZMREAEYZOSPWEJLHHFPYGSNSUYRZXANDNQTTLLZA
Supplementary Table 1. Cystometric parameters in sham-operated wild type and Trpv4 -/- rats during saline infusion and
WT sham Trpv4 -/- sham Saline 10µM GSK1016709A P value Saline 10µM GSK1016709A P value Number 10 10 8 8 Intercontractile interval (sec) 143 (102 155) 98.4 (71.4 148) 0.01 96 (92 121) 109 (95 123) 0.3 Voided
i1400 Image Processing Guide A-61623_zh-tw
i1400 Image Processing Guide A-61623_zh-tw ................................................................. 1.............................................................. 1.........................................................
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében. Dicse Jenő üzletfejlesztési igazgató
A modern e-learning lehetőségei a tűzoltók oktatásának fejlesztésében Dicse Jenő üzletfejlesztési igazgató How to apply modern e-learning to improve the training of firefighters Jenő Dicse Director of
Phenotype. Genotype. It is like any other experiment! What is a bioinformatics experiment? Remember the Goal. Infectious Disease Paradigm
It is like any other experiment! What is a bioinformatics experiment? You need to know your data/input sources You need to understand your methods and their assumptions You need a plan to get from point
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY A feladatsor három részbol áll 1. A vizsgáztató társalgást kezdeményez a vizsgázóval. 2. A vizsgázó egy szituációs feladatban vesz részt a
Expansion of Red Deer and afforestation in Hungary
Expansion of Red Deer and afforestation in Hungary László Szemethy, Róbert Lehoczki, Krisztián Katona, Norbert Bleier, Sándor Csányi www.vmi.szie.hu Background and importance large herbivores are overpopulated
Összefoglalás. Summary
Parlagoltatásos, zöld- és istállótrágyázásos vetésforgók összehasonlítása a talajtömörödöttség tükrében Szőllősi István Antal Tamás Nyíregyházi Főiskola, Műszaki és Mezőgazdasági Főiskolai Kar Jármű és
építészet & design ipari alkalmazás teherautó felépítmény
A Design-Composit egy kompozitpaneleket gyártó vállalat, mely teherautó felépítményekhez, az építészet számára és design termékekhez készít paneleket. We are an innovative manufacturer of composite panels
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet. Correlation & Regression
Correlation & Regression Types of dependence association between nominal data mixed between a nominal and a ratio data correlation among ratio data Correlation describes the strength of a relationship,
Étkezési búzák mikotoxin tartalmának meghatározása prevenciós lehetıségek
Étkezési búzák mikotoxin tartalmának meghatározása prevenciós lehetıségek Téren, J., Gyimes, E., Véha, A. 2009. április 15. PICK KLUB Szeged 1 A magyarországi búzát károsító Fusarium fajok 2 A betakarítás
Tudományos Ismeretterjesztő Társulat
Sample letter number 5. International Culture Festival PO Box 34467 Harrogate HG 45 67F Sonnenbergstraße 11a CH-6005 Luzern Re: Festival May 19, 2009 Dear Ms Atkinson, We are two students from Switzerland
MATEMATIKA ANGOL NYELVEN MATHEMATICS
ÉRETTSÉGI VIZSGA 2005. május 10. MATEMATIKA ANGOL NYELVEN MATHEMATICS EMELT SZINTŰ ÍRÁSBELI VIZSGA HIGHER LEVEL WRITTEN EXAMINATION Az írásbeli vizsga időtartama: 240 perc Time allowed for the examination:
Supplementary materials to: Whole-mount single molecule FISH method for zebrafish embryo
Supplementary materials to: Whole-mount single molecule FISH method for zebrafish embryo Yuma Oka and Thomas N. Sato Supplementary Figure S1. Whole-mount smfish with and without the methanol pretreatment.
FELADATKIÍRÁSOK (ÁRAMLÁSTAN TANSZÉK)
FELADATKIÍRÁSOK (ÁRAMLÁSTAN TANSZÉK) Utoljára frissítve 2011.09.07. 10:41 2011-2012-I. félév (Az alábbi magyar és angol nyelvű BSc / MSc képzésekben induló önálló feladat, szakdolgozat, diplomaterv típusú
Utolsó frissítés / Last update: Szeptember / September Szerkesztő / Editor: Csatlós Árpádné
Utolsó frissítés / Last update: 2018. Szeptember / September Szerkesztő / Editor: Csatlós Árpádné TARTALOM / Contents BEVEZETŐ / Introduction... 2 FELNŐTT TAGBÉLYEGEK / Adult membership stamps... 3 IFJÚSÁGI
Felnőttképzés Európában
Felnőttképzés Európában Nincs szükség annyi diplomásra, amennyit képeznek Helyettük szakképzett emberekre lenne kereslet Az itthon OKJ-s képzés európai hagyományában két vonal érvényesül: - dán - német
IES TM Evaluating Light Source Color Rendition
IES TM-30-15 Evaluating Light Source Color Rendition "Original" "CRI = 80" Desaturated "CRI = 80" Saturated More metrics Color Fidelity Color Discrimination Color Preference Metrics/Measures R f (IES TM-30-15)
Néhány folyóiratkereső rendszer felsorolása és példa segítségével vázlatos bemutatása Sasvári Péter
Néhány folyóiratkereső rendszer felsorolása és példa segítségével vázlatos bemutatása Sasvári Péter DOI: http://doi.org/10.13140/rg.2.2.28994.22721 A tudományos közlemények írása minden szakma művelésének
INDEXSTRUKTÚRÁK III.
2MU05_Bitmap.pdf camü_ea INDEXSTRUKTÚRÁK III. Molina-Ullman-Widom: Adatbázisrendszerek megvalósítása Panem, 2001könyv 5.4. Bittérkép indexek fejezete alapján Oracle: Indexek a gyakorlatban Oracle Database
Pletykaalapú gépi tanulás teljesen elosztott környezetben
Pletykaalapú gépi tanulás teljesen elosztott környezetben Hegedűs István Jelasity Márk témavezető Szegedi Tudományegyetem MTA-SZTE Mesterséges Intelligencia Kutatócsopot Motiváció Az adat adatközpontokban
FÖLDRAJZ ANGOL NYELVEN GEOGRAPHY
Földrajz angol nyelven középszint 0513 ÉRETTSÉGI VIZSGA 2005. május 18. FÖLDRAJZ ANGOL NYELVEN GEOGRAPHY KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA STANDARD LEVEL WRITTEN EXAMINATION Duration of written examination:
General information for the participants of the GTG Budapest, 2017 meeting
General information for the participants of the GTG Budapest, 2017 meeting Currency is Hungarian Forint (HUF). 1 EUR 310 HUF, 1000 HUF 3.20 EUR. Climate is continental, which means cold and dry in February
Dependency preservation
Adatbázis-kezelés. (4 előadás: Relácó felbontásai (dekomponálás)) 1 Getting lossless decomposition is necessary. But of course, we also want to keep dependencies, since losing a dependency means, that
EN United in diversity EN A8-0206/473. Amendment
21.3.2019 A8-0206/473 473 Recital 12 d (new) (12d) Since there is no sufficient link of a driver with a territory of a Member State of transit, transit operations should not be considered as posting situations.
ANGOL NYELVI SZINTFELMÉRŐ 2013 A CSOPORT. on of for from in by with up to at
ANGOL NYELVI SZINTFELMÉRŐ 2013 A CSOPORT A feladatok megoldására 45 perc áll rendelkezésedre, melyből körülbelül 10-15 percet érdemes a levélírási feladatra szánnod. Sok sikert! 1. Válaszd ki a helyes
Skills Development at the National University of Public Service
Skills Development at the National University of Public Service Presented by Ágnes Jenei National University of Public Service Faculty of Public Administration Public Ethics and Communication 13. 12. 2013
EN United in diversity EN A8-0206/445. Amendment
21.3.2019 A8-0206/445 445 Title Proposal for a DIRECTIVE OF THE EUROPEAN PARLIAMENT AND OF THE COUNCIL amending Directive 2006/22/EC as regards enforcement requirements and laying down specific rules with
INTELLIGENT ENERGY EUROPE PROGRAMME BUILD UP SKILLS TRAINBUD. Quality label system
INTELLIGENT ENERGY EUROPE PROGRAMME BUILD UP SKILLS TRAINBUD WP4: Deliverable 4.5 Development of voluntary qualification system Quality label system 1 INTELLIGENT ENERGY EUROPE PROGRAMME BUILD UP SKILLS
Supplementary Figure 1
Supplementary Figure 1 Plot of delta-afe of sequence variants detected between resistant and susceptible pool over the genome sequence of the WB42 line of B. vulgaris ssp. maritima. The delta-afe values
KN-CP50. MANUAL (p. 2) Digital compass. ANLEITUNG (s. 4) Digitaler Kompass. GEBRUIKSAANWIJZING (p. 10) Digitaal kompas
KN-CP50 MANUAL (p. ) Digital compass ANLEITUNG (s. 4) Digitaler Kompass MODE D EMPLOI (p. 7) Boussole numérique GEBRUIKSAANWIJZING (p. 0) Digitaal kompas MANUALE (p. ) Bussola digitale MANUAL DE USO (p.
A logaritmikus legkisebb négyzetek módszerének karakterizációi
A logaritmikus legkisebb négyzetek módszerének karakterizációi Csató László laszlo.csato@uni-corvinus.hu MTA Számítástechnikai és Automatizálási Kutatóintézet (MTA SZTAKI) Operációkutatás és Döntési Rendszerek
4-42 ELECTRONICS WX210 - WX240
4-42 ELECTRONICS WX210 - WX240 PCS 40000499-en Fig. 8 WX210 - WX240 ELECTRONICS 4-43 PCS COMPONENTS 40000471-en Load-limit regulator Legend Fig. 1 Fig. 2 1 Power supply 2 PWM1 output, proportional valve
NYOMÁSOS ÖNTÉS KÖZBEN ÉBREDŐ NYOMÁSVISZONYOK MÉRÉTECHNOLÓGIAI TERVEZÉSE DEVELOPMENT OF CAVITY PRESSURE MEASUREMENT FOR HIGH PRESURE DIE CASTING
Anyagmérnöki Tudományok, 39/1 (2016) pp. 82 86. NYOMÁSOS ÖNTÉS KÖZBEN ÉBREDŐ NYOMÁSVISZONYOK MÉRÉTECHNOLÓGIAI TERVEZÉSE DEVELOPMENT OF CAVITY PRESSURE MEASUREMENT FOR HIGH PRESURE DIE CASTING LEDNICZKY
FIATAL MŰSZAKIAK TUDOMÁNYOS ÜLÉSSZAKA
FIATAL ŰSZAKIAK TUDOÁNYOS ÜLÉSSZAKA Kolozsvár, 1999. március 19-20. Zsákolt áruk palettázását végző rendszer szimulációs kapacitásvizsgálata Kádár Tamás Abstract This essay is based on a research work
Dr. Sasvári Péter Egyetemi docens
A KKV-k Informatikai Infrastruktúrájának vizsgálata a Visegrádi országokban The Analysis Of The IT Infrastructure Among SMEs In The Visegrád Group Of Countries Dr. Sasvári Péter Egyetemi docens MultiScience
Proxer 7 Manager szoftver felhasználói leírás
Proxer 7 Manager szoftver felhasználói leírás A program az induláskor elkezdi keresni az eszközöket. Ha van olyan eszköz, amely virtuális billentyűzetként van beállítva, akkor azokat is kijelzi. Azokkal
2. Local communities involved in landscape architecture in Óbuda
Év Tájépítésze pályázat - Wallner Krisztina 2. Közösségi tervezés Óbudán Óbuda jelmondata: Közösséget építünk, ennek megfelelően a formálódó helyi közösségeket bevonva fejlesztik a közterületeket. Békásmegyer-Ófaluban
már mindenben úgy kell eljárnunk, mint bármilyen viaszveszejtéses öntés esetén. A kapott öntvény kidolgozásánál még mindig van lehetőségünk
Budapest Régiségei XLII-XLIII. 2009-2010. Vecsey Ádám Fémeszterga versus viaszesztergálás Bev e z e t é s A méhviaszt, mint alapanyagot nehéz besorolni a műtárgyalkotó anyagok különböző csoportjaiba, mert
PIACI HIRDETMÉNY / MARKET NOTICE
PIACI HIRDETMÉNY / MARKET NOTICE HUPX DAM Másnapi Aukció / HUPX DAM Day-Ahead Auction Iktatási szám / Notice #: Dátum / Of: 18/11/2014 HUPX-MN-DAM-2014-0023 Tárgy / Subject: Változások a HUPX másnapi piac
(c) 2004 F. Estrada & A. Jepson & D. Fleet Canny Edges Tutorial: Oct. 4, '03 Canny Edges Tutorial References: ffl imagetutorial.m ffl cannytutorial.m
Canny Edges Tutorial: Oct. 4, '03 Canny Edges Tutorial References: ffl imagetutorial.m ffl cannytutorial.m ffl ~jepson/pub/matlab/isetoolbox/tutorials ffl ~jepson/pub/matlab/utvistoolbox/tutorials ffl
Decision where Process Based OpRisk Management. made the difference. Norbert Kozma Head of Operational Risk Control. Erste Bank Hungary
Decision where Process Based OpRisk Management made the difference Norbert Kozma Head of Operational Risk Control Erste Bank Hungary About Erste Group 2010. 09. 30. 2 Erste Bank Hungary Erste Group entered
MATEMATIKA ANGOL NYELVEN
ÉRETTSÉGI VIZSGA 2014. május 6. MATEMATIKA ANGOL NYELVEN EMELT SZINTŰ ÍRÁSBELI VIZSGA 2014. május 6. 8:00 Az írásbeli vizsga időtartama: 240 perc Pótlapok száma Tisztázati Piszkozati EMBERI ERŐFORRÁSOK
Összefoglalás. Summary. Bevezetés
A talaj kálium ellátottságának vizsgálata módosított Baker-Amacher és,1 M CaCl egyensúlyi kivonószerek alkalmazásával Berényi Sándor Szabó Emese Kremper Rita Loch Jakab Debreceni Egyetem Agrár és Műszaki
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY A feladatsor három részből áll 1. A vizsgáztató társalgást kezdeményez a vizsgázóval. 2. A vizsgázó egy szituációs feladatban vesz részt a
THS710A, THS720A, THS730A & THS720P TekScope Reference
THS710A, THS720A, THS730A & THS720P TekScope Reference 070-9741-01 Getting Started 1 Connect probes or leads. 2 Choose SCOPE 3 or METER mode. Press AUTORANGE. Copyright Tektronix, Inc. Printed in U.S.A.
Effect of the different parameters to the surface roughness in freeform surface milling
19 November 0, Budapest Effect of the different parameters to the surface roughness in freeform surface milling Balázs MIKÓ Óbuda University 1 Abstract Effect of the different parameters to the surface
Effect of sowing technology on the yield and harvest grain moisture content of maize (Zea mays L.) hybrids with different genotypes
A - MurányiE:Layout 1 2/18/16 9:34 AM Page 1 Effect of sowing technology on the yield and harvest grain moisture content of maize (Zea mays L.) hybrids with different genotypes Eszter Murányi University
Kvantum-informatika és kommunikáció 2015/2016 ősz. A kvantuminformatika jelölésrendszere szeptember 11.
Kvantum-informatika és kommunikáció 2015/2016 ősz A kvantuminformatika jelölésrendszere 2015. szeptember 11. Mi lehet kvantumbit? Kvantum eszközök (1) 15=5 3 Bacsárdi Képek forrása: IBM's László, Almaden
EEA, Eionet and Country visits. Bernt Röndell - SES
EEA, Eionet and Country visits Bernt Röndell - SES Európai Környezetvédelmi Ügynökség Küldetésünk Annak elősegítése, hogy az EU és a tagállamok a szükséges információk alapján hozhassák meg a környezet
A golyók felállítása a Pool-biliárd 8-as játékának felel meg. A golyók átmérıje 57.2 mm. 15 számozott és egy fehér golyó. Az elsı 7 egyszínő, 9-15-ig
A golyók elhelyezkedése a Snooker alaphelyzetet mutatja. A golyók átmérıje 52 mm, egyszínőek. 15 db piros, és 1-1 db fehér, fekete, rózsa, kék, barna, zöld, sárga. A garázsban állítjuk fel, ilyenkor az
FÖLDRAJZ ANGOL NYELVEN GEOGRAPHY
Földrajz angol nyelven középszint 0623 ÉRETTSÉGI VIZSGA 2007. május 15. FÖLDRAJZ ANGOL NYELVEN GEOGRAPHY KÖZÉPSZINTŰ ÍRÁSBELI ÉRETTSÉGI VIZSGA INTERMEDIATE LEVEL WRITTEN EXAM JAVÍTÁSI-ÉRTÉKELÉSI ÚTMUTATÓ
FÖLDRAJZ ANGOL NYELVEN
Földrajz angol nyelven középszint 1112 ÉRETTSÉGI VIZSGA 2014. május 15. FÖLDRAJZ ANGOL NYELVEN KÖZÉPSZINTŰ ÍRÁSBELI ÉRETTSÉGI VIZSGA JAVÍTÁSI-ÉRTÉKELÉSI ÚTMUTATÓ EMBERI ERŐFORRÁSOK MINISZTÉRIUMA Paper