ISO/IEC JTC1/SC2/WG2 Nxxxx
|
|
- János Hegedüs
- 9 évvel ezelőtt
- Látták:
Átírás
1 ISO/IEC JTC1/SC2/WG2 Nxxxx Universal Multiple-Octet Coded Character Set International Organization for Standardization Organisation Internationale de Normalisation Международная организация по стандартизации L2/ Doc Type: Working Group Document Title: Proposal for encoding generic punctuation used with the Szekler Hungarian Rovas script Source: Dr. Gábor Hosszú Status: Individual Contribution Action: For consideration by JTC1/SC2/WG2 and UTC Date: This document replaces part of N3527 (October 4th, 2008). This proposal is an alternative of the previous proposal N3664. It contains the proposal summary form. Please send any responses to this proposal to Gábor Hosszú ( Contents 1. Introduction Punctuation Unicode Character Properties Acknowledgements Bibliography Proposal Summary form Appendix I Examples of the punctuation in Szekler Hungarian Rovas relics Appendix II Documents that prove the international use of the word rovas In English language: rovas In French language: rovás In Polish language: rowasz In Serbian language: ровашко писмо In Slovakian language: rováš Introduction The Szekler Hungarian Rovas /rovaːʃ/ is a contemporary writing system of the Hungarians. Its directionality in the oldest time was right-to-left, and this remained the dominant writing direction. However, from the Middle Ages the left-to-right direction appeared and in the contemporary use a serious part of the Szekler Hungarian Rovas activity is based on the left-to-right direction. In case of the left-to-right direction, either the mirrored characters (according to Proposal for encoding generic punctuation with the Szekler Hungarian Rovas script - 1 of 22
2 the right-to-left direction) or the non-mirrored characters are used. The boustrophedon and the top-to-bottom directions are also possible, however, they are very infrequently applied.1,2 From the Middle Ages there are examples for the both writing directions, also in the contemporary usage there are left-to-right and right-to-left legacies. Directional overrides can be applied if necessary. When the direction of characters is changed, they can be mirrored, however, it is not obligatory. Since the Szekler Hungarian Rovas has no any relation with the Germanic Runes, therefore the use of the Hungarianorigin word rovas /rovaːʃ/ is used and not the term rune or runic since run- is a Germanic root as the German expert Andreas Stötzner pointed in The Szekler Hungarian Rovas is very different from the Germanic Runic scripts. The term rovas is not new in the English literature; it is used by many researchers in English, see subchapter 8.1 in Appendix II. On 4 October 2008 the Living Rovas Symposium in Gödöllő4 decided based on a poll that the official name of this script: the székely-magyar rovás in Hungarian and the Szekler Hungarian Rovas in English.5 Examples with pictures in Appendix II demonstrate the use of word rovas for the rovas script in different non-hungarian languages. Based on the facts above the annotations on the nameslist in and any other Unicode documents must use the proper name of the Szekler Hungarian Rovas script accepted by the user community in Even if general punctuation symbols were standardized earlier than the rovas characters, the annotations or any Unicode standard-related document should not contain differing name for the Szekler Hungarian Rovas script. This statement is one of the most important points of this proposal. 2. Punctuation In the contemporary use, the Szekler Hungarian Rovas script applies the usual European punctuation marks. However, due to the bidirectional property of the rovas script it needs additional punctuation marks in the Supplemental Punctuation block of the BMP as Table 2-1 presents.6 Rovas punctuation mark glyph, Name of the rovas punctuation mark REVERSED COMMA Examples of the glyph in relics and in publications - A page of Sándor Vér titled Életfa ( Tree of Life ) from 2001 (Vér, 2001), see Fig Cover page of the book including many rovas texts titled Engraved into stone, carved into wood, (Friedrich, Szakács, 2005), see Fig Printed table-calendar of Márton Forrai Jr. from 2008, see Fig. 74 and 5. - The Epilogue of the book Stars of Eger from 2009 (Gárdonyi, 2009), see Fig A part of the page 2 (in rovas script: II ) in the Appendix of the book Stars of Eger from 2009, see Fig A text from 2008 transcripted by Márton Forrai, jun., see Fig Sebestyén, 1915, pp Zomoráné Cseh, Stötzner, Andreas in Unicode mailing list on Friday November : Though we have the runic range named Runic and not Old Germanic we have the old turkish Runes named Old Turkic because *run-* is a germanic root and as such inappropriate to the turkish script., see (Stötzner, 2008) 4 Hosszú-Rumi-Sípos, The Szekler people are a special group of Hungarians who live in Szeklerland (Transylvania, Romania) who conserved this script through the centuries. 6 Roadmaps to Unicode (web site) 2 Proposal for encoding generic punctuation with the Szekler Hungarian Rovas script - 2 of 22
3 Rovas punctuation mark glyph { Name of the rovas punctuation mark Examples of the glyph in relics and in publications DOUBLE LOWREVERSED-9 QUOTATION MARK WORD SEPARATOR COLON Part of a page of the book titled New rovas writing textbook and study circle inspiration store, (Friedrich, 2006), see Fig The Rudimenta Hunnorum by János Telegdi from 1598 (Thelegdi, 1598), (Bodroghy, 1998), (Libisch, 2004), see Fig Part of a page of the book titled New rovas writing textbook and study circle inspiration store, (Friedrich, 2006), see Fig. 7-9 Table 2-1: The novel general punctuation marks used with the Szekler Hungarian Rovas script. For representing the CLOSE TWO DOT PUNCTUATION the TWO DOT PUNCTUATION (U+205A) from the General Punctuation block is not appropriate because the distance of the dots is too large. In the rovas relics and in publications (see the examples for the CLOSE TWO DOT PUNCTUATION in Table the distance between the dots does look to be fairly close together. In such way, the CLOSE TWO DOT PUNCTUATION used in the rovas documents (see Table 2-1) is definitely different from the shape of the U+003A COLON : or the TWO DOT PUNCTUATION (U+205A). Therefore an individual CLOSE TWO DOT PUNCTUATION punctuation character is necessary to encode in the Supplemental Punctuation block with the following Unicode properties: Category: Punctuation, Other [Po], Combine: 0, BIDI: Other Neutrals [ON], Mirror: N.1 3. Unicode Character Properties 2E00 Supplemental Punctuation (portion) 2E7F 2E , 2E33 { 2E34 2E35 Haralambous, 2007 Proposal for encoding generic punctuation with the Szekler Hungarian Rovas script - 3 of 22
4 Szekler Hungarian Rovas Punctuation 2E33 2E34 2E35, REVERSED COMMA used in Szekler Hungarian Rovas script with right-to-left and boustrophedon directionalities U+002C, comma U+060C arabic comma { DOUBLE LOW-REVERSED-9 QUOTATION MARK used in Szekler Hungarian Rovas script with right-to-left and boustrophedon directionalities U+201E double low-9 quotation mark CLOSE TWO DOT PUNCTUATION used in Szekler Hungarian Rovas script with right-to-left and boustrophedon directionalities U+003A : colon U+205A Two Dot Punctuation 4. Acknowledgements I would like to express my gratitude to Dr. Deborah W. Anderson researcher in the Department of Linguistics at the University of California at Berkeley for reviewing this proposal and for her useful advices. 5. Bibliography Bodroghy, Gabor Z. (1998): The Szekler Hungarian Rovas, Retrieved in 2008 from etr/rovas/hurov.html Forrai, jun., Márton ( ): communications. Friedrich, Klára (2006): Új Rovásírás Tankönyv és Szakköri Ötlettár, Published by Gábor Szakács in 2006, Budapest. Friedrich, Klára & Szakács, Gábor (2005): Rovásírás játék nem csak gyerekeknek. ( Rovas Writing Game not for children, only ) Published by Gábor Szakács in 2005, Budapest. Gárdonyi, Géza (2009): Egri csillagok (Stars of Eger). Transcripted into Szekler Hungarian Rovas script by Tamás Rumi, László Sípos and Tamás Somfai. Edited by Tamás Rumi. Published in 2009 by Imgent Kft. WOU Hungary Kft, ISBN: Gosztonyi, Kalman, Dr. (middle of the 20th century): An alphabet from his manuscript created in the middle of the 20th century (edited version) from Tamás Rumi, Hungary. Source: Dr. András Zakar: Magyar őstörténet felé (Toward the Hungarian Ancient History), Erdélyi Világszövetség (World Association of the Transylvanians), Buenos Aires, Haralambous, Yannis (2007): Fonts & Encodings. From Unicode to Advanced Typography and Everything in Between (Translated by P. Scott Horne). Published by O Reilly, September 26, ISN-13: Retrieved in 2008 from Hosszú, Gábor - Rumi, Tamás - Sípos, László (2008): Az élő rovás. Nemzeti írásunk a szabványosítás útján ( The Living Rovas. Our National Script on the Way of Standardization ). Conference Proceedings. Conference is organized by Tamás Rumi, László Sípos and Dr. Gábor Hosszú and the Community of Hungarian Rovas Writers, Gödöllő, Petőfi Sándor Művelődési Központ (Cultural Centre Petőfi Sándor ) October 4th, 2008, Proceedings published by Imagent and the WOU Hungary, Budapest, Hungary. ISBN: Libisch, Győző (2004): Rovás Kincsek. A Régi Magyar Írás Emléktára. ( Rovas Wonders. The Memorial Archive of the Ancient Hungarian Writing ). Publisher: Két Kerék Alapítvány (Two Wheels Foundation), Budapest, 2004, First Edition. ISBN Roadmaps to Unicode (web site). Unicode, Inc. Retrieved in September 1, 2008 from Proposal for encoding generic punctuation with the Szekler Hungarian Rovas script - 4 of 22
5 Róna-Tas, András (1992): A magyar írásbeliség török eredetéhez (ír és betű szavaink etimológiája), in: Sándor Klára (ed.), Rovásírás a Kárpát-medencében. In series: Magyar Őstörténeti Könyvtár 4. Publisher: Szegedi Tudományegyetem, Altajisztikai Tanszék, Szeged, Salgó, Gabriella (2008): Písmo rováš v mimovyucovacom procese. Rovásírás a szabadidős tevékenységben. ( Rovas scripting as a freetime activity ). Thesis in the Konstantin University of Philosophy, Nyitra (Slovakia), Sebestyén, Gyula (1915): A magyar rovásírás hiteles emlékei ( The authentic relics of the Szekler Hungarian Rovas Writing ). Budapest, Hungarian Academy of Sciences (MTA), 1915, p Stötzner, Andreas (2008): Contribution in the Unicode Mailing List, Friday November , Thelegdi, Ioannis (1598): Rudimenta, Priscae hunnorum linguae brevibus quaestionibus ac responcionibus comprehensa opera et studio, ( The Elements of the Old Language of the Huns ) Vékony, Gábor (2004): A székely írás emlékei, kapcsolatai, története ( The relics, relations and history of the Szekler writing ), Nap Kiadó, Budapest, 2004 ISBN Vér, Sándor (2001): Életfa ( Tree of Life ). Published by Bába és Társai, Szeged, in 2001 (First edition), 2003 (Second edition), 2008 (Third edition). ISBN , 144 pages. Zomoráné Cseh, Márta (2009): A székely-magyar rovás ábc-s könyv (The Szekler Hungarian Rovas alphabet book). Published by the Association of the Hungarian Scouts of Romania, Szamosújvár, ISBN: Proposal for encoding generic punctuation with the Szekler Hungarian Rovas script - 5 of 22
6 6. Proposal Summary form ISO/IEC JTC 1/SC 2/WG 2 PROPOSAL SUMMARY FORM TO ACCOMPANY SUBMISSIONS FOR ADDITIONS TO THE REPERTOIRE OF ISO/IEC Please fill all the sections A, B and C below. TP PT Please read Principles and Procedures Document (P & P) from for guidelines and details before filling this form. Please ensure you are using the latest Form from See also for latest Roadmaps. HTU UTH HTU UTH HTU UTH A. Administrative 1. Title: Proposal for encoding generic punctuation with the Szekler Hungarian Rovas script 2. Requester's name: Dr. Gábor Hosszú 3. Requester type (Member body/liaison/individual contribution): Individual Contribution 4. Submission date: August Requester's reference (if applicable): 6. Choose one of the following: This is a complete proposal: (or) More information will be provided later: No. B. Technical General 1. Choose one of the following: a. This proposal is for a new script (set of characters): No. Proposed name of script: b. The proposal is for addition of character(s) to an existing block: Name of the existing block: Supplemental Punctuation 2. Number of characters in proposal: 3. Proposed category (select one from below - see section 2.2 of P&P document): A-Contemporary X C-Major extinct B.1-Specialized (small collection) B.2-Specialized (large collection) D-Attested extinct E-Minor extinct F-Archaic Hieroglyphic or Ideographic 4. Is a repertoire including character names provided? 4 G-Obscure or questionable usage symbols a. If YES, are the names in accordance with the character naming guidelines in Annex L of P&P document? b. Are the character shapes attached in a legible form suitable for review? 5. Who will provide the appropriate computerized font (ordered preference: True Type, or PostScript format) for publishing the standard? Dr. Gábor Hosszú If available now, identify source(s) for the font (include address, , ftp-site, etc.) and indicate the tools used: Dr. Gábor Hosszú, FontCreator 6. References: a. Are references (to other character sets, dictionaries, descriptive texts etc.) provided? b. Are published examples of use (such as samples from newspapers, magazines, or other sources) 1 Form number: N3152-F (Original ; Revised , , , , , , , , , , , , ) TPPT Proposal for encoding generic punctuation with the Szekler Hungarian Rovas script - 6 of 22
7 of proposed characters attached? 7. Special encoding issues: Does the proposal address other aspects of character data processing (if applicable) such as input, presentation, sorting, searching, indexing, transliteration etc. (if yes please enclose information)? 8. Additional Information: Submitters are invited to provide any additional information about Properties of the proposed Character(s) or Script that will assist in correct understanding of and correct linguistic processing of the proposed character(s) or script. Examples of such properties are: Casing information, Numeric information, Currency information, Display behaviour information such as line breaks, widths etc., Combining behaviour, Spacing behaviour, Directional behaviour, Default Collation behaviour, relevance in Mark Up contexts, Compatibility equivalence and other Unicode normalization related information. See the Unicode standard at for such information on other scripts. Also see and associated Unicode Technical Reports for information needed for consideration by the Unicode Technical Committee for inclusion in the Unicode Standard. See below. HTU UTH HTU Proposal for encoding generic punctuation with the Szekler Hungarian Rovas script - 7 of 22 UTH
8 C. Technical - Justification 1. Has this proposal for addition of character(s) been submitted before? If YES explain N Has contact been made to members of the user community (for example: National Body, user groups of the script or characters, other experts, etc.)? If YES, with whom? Alpár Adorjáni, Zoltán Gábor Babarczi, László Báder, Péter Bajor, Zoltán Bajtai, Gábor Bakonyi, Gábor Balás, Gusztáv Balázs, Attila Lajos Balogh, György Barabás, Enikő Barabási, Zsolt, Barkó, István Barna, József Barta, Richard Bednarik, László Berényi, Zsolt Bicskey, László Bilisics, Béla Bodó, Géza Borsos, László Bóta, László Botos, Margaret Botos, Éva Budaházy, László Cesar, László Czabula, Béla Czapp, Győző Czettele, Károly Czirják, Dr. Csaba Dávid, Kornélia Csaláné Erdélyi, Péter Csánki, Tamás Császár, Csaba Csatlós, Sarolta Csicsay, Péter Csontos, Gábor Csörögi, Dr. Dezső Deák (president of the Association of the Rovas Writers of Szeged), József Dénes, Ferenc Dittler, Attila Diviki-Nagy, Sándor Dobos, Ilona Elek, Dr. Tamás Esze, Erika Fáber, Attila Fábián, László Fabó, Aladár Farkas, István Farkas, Árpád Fási, Árpád Fáy, Zsombor Fehér, Dr. Zsombor Fekete, Attila Ferenc, Domonka Gabriella Fodor, István Fodor, Márton Forrai jun., Zsolt Forrai, Viktória Főfainé Kiss, Attila Friedrich, Zoltán Fűr, Katalin Füzi, Péter Füzi, Dr. Magor Gáll, Ferenc Gergely, András Gimesi, jun., Attila Granpierre, József Gyenes, Zalán Hajdu, Árpád Hamvai, Zsuzsanna Haraszti, Ildikó Harsányi, Jolán Hegedűs, Dr. Mihály Hirt, László Hódos, Ádám Máté Horváth, Balázs Horváth, Judith Horváth, Mihály Horváth, Péter Ivanov, Lydia Jablonkay, Nándor Jankovich, Ádám Joó, Erzsébet Joóné Virág, Ferenc Jóri, Gábor Csaba Kárpáti, Pál Katona, György Kisfaludy, Gábor Kiss, József Kiss, Dr. Lajos Kollár, Balázs Kontics, Dr. László Kontur, Atilla Koricsánszky, Krisztián Kormos, Péter Koszta, Tamás Kovács, József Kutasi, Csaba Labant, Andrea Láng Péterné, Dr. Imre Lánszki, András Lénárth, Győző Libisch (leader of the Rovas Writing Section of the Society of the Friends of the Old Hungarian Culture), Károly Lovas, Ágnes Lukács, Róbert Madarász, János baskói Magyar, Dr. Kálmán Magyar, Szabolcs Magyaródy, György Mandics, Dr. Szabolcs Márka, Sebestyén Markolt, Sándor Marton, György Márton, József Meggyesi, Anikó Menyhárt, József Menyhárt, István Mészáros, Sándor Mórocz, Attila Mózes, Hajnalka Nagy, Beatrix Neer, Zsigmond Béla Németh, Gizelly Nyquist, Dr. Sándor Pákh, Ágnes Pápainé Stengel, Éva Papes, István Gergely Papp, Dr. Zénó Pasztuha Tocsek, László Pecze, Imre Pető, Dr. András Petre, József Prém, Attila Puskás, Dávid Puskás, Attila Répai, Balázs Romhányi, Géza Rózsa, Tamás Rumi, Gabriella Salgó, Márton Sándor, late Lajos Schédl, Ferenc Schell, András Siklósi, Gáspár Sinai, László Sípos, Ferenc Sólyom, Tamás Somfai, Boglárka Soós, Péter Stolmar, Tamás Straub, Róbert Szabados, Attila Szabó T., Gábor Szabó, Gábor Szakács (president of the Sándor Forrai Rovas Writer Association), Klára Szakács Gáborné Friedrich, Milán Szalai, Lajos Szalay, Zsuzsanna Szalay, Péter Szarka, Pál Szathmáry-Király, Sándor Szatmári, András Szeibert, Dr. Csaba Székely, André Szabolcs Szelp, István Szekeres, László Szép, Imre Szili, Miklós Szondi, Dr. József Teleki, Dr. Józsefné Teleki, András Tímár, András Tisza, Mária Tiszáné Bencsik, Ákos Tóth, Ferenc Tóthárpád, István Vadász Szatmári, Ferenc Váli, András Varga, Csaba Varga, Géza Varga, Zoltán Varga, József Kadocsa Vetráb, Sándor Vér, Zoltán Viola, Aladár Z. Urbán, László Zagyvai, Dr. András Záhonyi, Magdolna Zimányi, Jenő Zomora, Márta Zomoráné Cseh, Árpád Zubrits, Dr. György Zsombok et al., Community of the Hungarian Rovas Writers, If YES, available relevant documents: 3. Information on the user community for the proposed characters (for example: size, demographics, information technology use, or publishing use) is included? Continuous historical and contemporary use by Hungarians. Reference: The Rovas Writing Home Page: Future Spectator Rovas Writing Journal : Home Knowledge Camp Pages of Jankovich Nándor: Terembura. Hunnish Research Journal: Yudit Home Page: Rovas Writing Section of the Society of the Friends of the Old Hungarian Culture: Sándor Forrai Rovas Writer Association: Írástudó newsletter: Proposal for encoding generic punctuation with the Szekler Hungarian Rovas script - 8 of 22
9 Rovasírás: Rovas Editor: Rovasírás: The Szekler Hungarian Rovas Script, Research Institute of Writing History, Gabor Z. Bodroghy: The Szekler Hungarian Rovas, Community of the Hungarian Rovas Writers, Rovas site of Zoltán Fűr: Magyar rovas( Hungarian Rovas ) by Miklós Szondi: From rovas to script: The Falcon Bird Home Page by Péter Szarka: The rovas scripting home page by Márton Forrai jun.: The rovas pages of the Hungarian Scouts of Toronto: Rovas Writing Educating-Editing Home Page: Photo Gallery of Rovas Inscriptions: Béla Bodó s sage written exclusively with rovas letters: 4. The context of use for the proposed characters (type of use; common or rare) Common with increasing popularity Reference: 5. Are the proposed characters in current use by the user community? If YES, where? Reference: In Hungary, in Rumania (mainly in Szeklerland), in Slovakia, in Serbia, in Ukraine and in every place where Hungarians live. There are competitions of rovas users in Germany, in USA, in Canada among others. 6. After giving due considerations to the principles in the P&P document must the proposed characters be entirely in the BMP? If YES, is a rationale provided? If YES, reference: Each of them is generic punctuation character.. 7. Should the proposed characters be kept together in a contiguous range (rather than being scattered)? 8. Can any of the proposed characters be considered a presentation form of an existing character or character sequence? No If YES, is a rationale for its inclusion provided? If YES, reference: 9. Can any of the proposed characters be encoded using a composed character sequence of either existing characters or other proposed characters? If YES, is a rationale for its inclusion provided? If YES, reference: Their shape is definitely different. 10. Can any of the proposed character(s) be considered to be similar (in appearance or function) to an existing character? No If YES, is a rationale for its inclusion provided? If YES, reference: 11. Does the proposal include use of combining characters and/or use of composite sequences? If YES, is a rationale for such use provided? No If YES, reference: Is a list of composite sequences and their corresponding glyph images (graphic symbols) provided? No If YES, reference: 12. Does the proposal contain characters with any special properties such as control function or similar semantics? No If YES, describe in detail (include attachment if necessary) 13. Does the proposal contain any Ideographic compatibility character(s)? No Proposal for encoding generic punctuation with the Szekler Hungarian Rovas script - 9 of 22
10 If YES, is the equivalent corresponding unified ideographic character(s) identified? If YES, reference: 7. Appendix I Examples of the punctuation in Szekler Hungarian Rovas relics The following relics show examples for the use of those punctuation marks with the Szekler Hungarian Rovas script that need encoding. Figure 7-1: The Rudimenta Hunnorum by János Telegdi from 1598 (Thelegdi, 1598), (Bodroghy, 1998), (Libisch, 2004). Fig. 7-2 presents a page in the Sándor Vér s book titled Életfa ( Tree of Life ) published in Proposal for encoding generic punctuation with the Szekler Hungarian Rovas script - 10 of 22
11 Figure 7-2: A page of Sándor Vér titled Életfa ( Tree of Life ) from 2001 (Vér, 2001). Fig. 7-3 presents the cover page of the book titled in Hungarian Engraved into stone, carved into wood of Klára Friedrich and Gábor Szakács from Friedrich Szakács, 2005 Proposal for encoding generic punctuation with the Szekler Hungarian Rovas script - 11 of 22
12 Figure 7-3: Cover page of the book including many rovas texts titled Engraved into stone, carved into wood ), (Friedrich, Szakács, 2005). Fig. 7-4 and 7-5 show the parts of some pages of the printed table-calendar made by Márton Forrai Jr. for 2009 in Proposal for encoding generic punctuation with the Szekler Hungarian Rovas script - 12 of 22
13 Figure 7-4: A part of the page for the 5th week in the printed table-calendar of Márton Forrai Jr. from Figure 7-5: A part of the page for the 8th week in the printed table-calendar of Márton Forrai Jr. from Fig. 7-6 and 7-7 present parts of the most popular book of Hungary is the novel Egri csillagok (Stars of Eger) by Géza Gárdonyi that is fully transcripted into Szekler Hungarian Rovas script and published in This book is the very first roman that is transcripted with exclusively Szekler Hungarian Rovas letters. Fig. 7-5 and 7-6 show the Epilogue and some pages of the Appendix of the book Stars of Eger. 1 Gárdonyi, 2009 Proposal for encoding generic punctuation with the Szekler Hungarian Rovas script - 13 of 22
14 Figure 7-6: The Epilogue of the book Stars of Eger from Gárdonyi, 2009 Proposal for encoding generic punctuation with the Szekler Hungarian Rovas script - 14 of 22
15 Figure 7-7: A part of the page 2 (in rovas script: II ) in the Appendix of the book Stars of Eger from Fig. 7-8 presents a text about the importance of the wife in a family in Szekler Hungarian Rovas. It was transcripted into rovas by Márton Forrai, jun. in 12 November Gárdonyi, 2009 Forrai, jun., Proposal for encoding generic punctuation with the Szekler Hungarian Rovas script - 15 of 22
16 Figure 7-8: A text from 2008 transcripted by Márton Forrai, jun..1 1 Forrai, jun., Proposal for encoding generic punctuation with the Szekler Hungarian Rovas script - 16 of 22
17 Figure 7-9: Part of the page 52 of the book New rovas writing textbook and study circle inspiration store, (Friedrich, 2006). Figure. 7-10: Part of the page 61 of the book New rovas writing textbook and study circle inspiration store, (Friedrich, 2006). 8. Appendix II Documents that prove the international use of the word rovas 8.1. In English language: rovas The following images demonstrate the use of the word rovas in various texts in English language. Figure 8.1-1: The use of the Székely-Hungarian Rovás Script expression on an Australian web page, Proposal for encoding generic punctuation with the Szekler Hungarian Rovas script - 17 of 22
18 Figure 8.1-2: The web page with the use of word rovás Figure 8.1-3: An English page about rovas tattoo, by using the word rovas for denoting the script: Figure 8.1-4: Page of Yves Kodratoff with using the word rovás : Proposal for encoding generic punctuation with the Szekler Hungarian Rovas script - 18 of 22
19 Figure 8.1-5: Web page of Gabor Z. Bodroghy from 1998, retrieved in Fig presents part of a web forum where the word rovás is used in a natural way. Figure 8.1-6: Part of a forum entry in 24 March :16 AM, retrieved in 2009 from In French language: rovás Figure and 2 give examples for the use of rovás in French text. The author clearly differentiate the between les rovás and the les alphabets runiques in the first figure and between the rovás and the runes is the second figure. 1 Bodroghy, 1998 Proposal for encoding generic punctuation with the Szekler Hungarian Rovas script - 19 of 22
20 Figure 8.2-1: Page of Yves Kodratoff with using the word rovás, retrieved in 9 August 2009 from Figure 8.2-2:Another part of page of Yves Kodratoff with using the word rovás, retrieved in 9 August 2009 from Next Google hit gives a part of a text where the les rovás is used in the French language without quotation marks. Figure 8.2-3:A web page where the les rovás word is used in the French language, sceen shot is from a Google result. The following figure gives another example for the use of rovás in French. Figure 8.2-4:A forum page, retrieved in 9 August 2009 from p=41632&sid=79688cd31b bd50f7023a2 Proposal for encoding generic punctuation with the Szekler Hungarian Rovas script - 20 of 22
21 8.3. In Polish language: rowasz In Polish language the word rovas is used in its Polish spelling, as rowasz. The pronunciation of the Polish word rowasz /rovaʃ/ practically equal to the pronunciation of the Hungarian origin rovás /rovaːʃ/. The following Figure demonstrates its use in Polish language. Figure 8.3-1: Part of the web page In Serbian language: ровашко писмо Fig presents the Serbian name of the rovas script: ровашко писмо, its pronunciation is /rovaːʃko pismo/, the Serbian spelling of the word rovas (писмо means script or writing ) in a declined form. Figure 8.4-1:The rovas title of the Serbian Wikipedia retrieved in 9 August 2009, Proposal for encoding generic punctuation with the Szekler Hungarian Rovas script - 21 of 22
22 8.5. In Slovakian language: rováš The following figure gives the cover page of the thesis book of Ms. Gabriella Salgó in the Konstantin University of Philosophy, Nyitra (Slovakia) titled Rovas scripting as a free time activity in The Slovakian title of the diploma work (thesis book) demonstrates the use of the word rovas in the Slovakian language in the form of rováš according to the Slovakian spelling. Figure 8.5-1: The cover page of the thesis book of Ms. Gabriella Salgó about the rovas scripting at the Konstantin University of Philosophy in 2008 (Salgó, 2008). 1 Salgó, 2008 Proposal for encoding generic punctuation with the Szekler Hungarian Rovas script - 22 of 22
Ez az irat átveszi az N3615 (2009-04-16) bizonyos részeinek helyét. This document replaces part of N3615 (2009-04- 16).
ISO/IEC JTC1/SC2/WG2 N3664 L2/09-240 2009-07-22 Universal Multiple-Octet Coded Character Set International Organization for Standardization Organisation Internationale de Normalisation Международная организация
USER MANUAL Guest user
USER MANUAL Guest user 1 Welcome in Kutatótér (Researchroom) Top menu 1. Click on it and the left side menu will pop up 2. With the slider you can make left side menu visible 3. Font side: enlarging font
EN United in diversity EN A8-0206/419. Amendment
22.3.2019 A8-0206/419 419 Article 2 paragraph 4 point a point i (i) the identity of the road transport operator; (i) the identity of the road transport operator by means of its intra-community tax identification
Státusz: Eseti jelentés For consideration by JTC1/SC2/WG2 Intézkedés: JTC1/SC2/WG2 általi megfontolásra Date/Kelt:
JTC1/SC2/WG2 N4110R L2/11-242R 2011-06-08 Universal Multiple-Octet Coded Character Set International Organization for Standardization Organisation Internationale de Normalisation Международная организация
ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP
ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP CHILD S DATA / GYERMEK ADATAI PLEASE FILL IN THIS INFORMATION WITH DATA BASED ON OFFICIAL DOCUMENTS / KÉRJÜK, TÖLTSE KI A HIVATALOS DOKUMENTUMOKBAN SZEREPLŐ ADATOK
STUDENT LOGBOOK. 1 week general practice course for the 6 th year medical students SEMMELWEIS EGYETEM. Name of the student:
STUDENT LOGBOOK 1 week general practice course for the 6 th year medical students Name of the student: Dates of the practice course: Name of the tutor: Address of the family practice: Tel: Please read
Széchenyi István Egyetem www.sze.hu/~herno
Oldal: 1/6 A feladat során megismerkedünk a C# és a LabVIEW összekapcsolásának egy lehetőségével, pontosabban nagyon egyszerű C#- ban írt kódból fordítunk DLL-t, amit meghívunk LabVIEW-ból. Az eljárás
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY A feladatsor három részből áll 1. A vizsgáztató társalgást kezdeményez a vizsgázóval. 2. A vizsgázó egy szituációs feladatban vesz részt a
ó Ú ő ó ó ó ö ó ó ő ö ó ö ö ő ö ó ö ö ö ö ó ó ó ó ó ö ó ó ó ó Ú ö ö ó ó Ú ú ó ó ö ó Ű ő ó ó ó ő ó ó ó ó ö ó ó ó ö ő ö ó ó ó Ú ó ó ö ó ö ó ö ő ó ó ó ó Ú ö ö ő ő ó ó ö ö ó ö ó ó ó ö ö ő ö Ú ó ó ó ü ú ú ű
Személyes adatváltoztatási formanyomtatvány- Magyarország / Personal Data Change Form - Hungary
Személyes adatváltoztatási formanyomtatvány- Magyarország / Personal Data Change Form - Hungary KITÖLTÉSI ÚTMUTATÓ: A formanyomtatványon a munkavállaló a személyes adatainak módosítását kezdeményezheti.
MINDENGYEREK KONFERENCIA
MINDENGYEREK KONFERENCIA ÉLMÉNYPEDAGÓGIAI SÁV PÁLYÁZATI FELHíVÁS A 2009-es konferenciához hasonlóan a 2011. évi MindenGyerek konferencián is megtalálható lesz az élménypedagógiai sáv. Az előző konferencia
On The Number Of Slim Semimodular Lattices
On The Number Of Slim Semimodular Lattices Gábor Czédli, Tamás Dékány, László Ozsvárt, Nóra Szakács, Balázs Udvari Bolyai Institute, University of Szeged Conference on Universal Algebra and Lattice Theory
Budapest By Vince Kiado, Klösz György
Budapest 1900 2000 By Vince Kiado, Klösz György Download Ebook : budapest 1900 2000 in PDF Format. also available for mobile reader If you are looking for a book Budapest 1900-2000 by Vince Kiado;Klosz
Construction of a cube given with its centre and a sideline
Transformation of a plane of projection Construction of a cube given with its centre and a sideline Exercise. Given the center O and a sideline e of a cube, where e is a vertical line. Construct the projections
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA I. VIZSGÁZTATÓI PÉLDÁNY A feladatsor három részbol áll 1. A vizsgáztató társalgást kezdeményez a vizsgázóval. 2. A vizsgázó egy szituációs feladatban vesz részt a
Személyes adatváltoztatási formanyomtatvány - Magyarország / Personal Data Change Form - Hungary
Személyes adatváltoztatási formanyomtatvány - Magyarország / Personal Data Change Form - Hungary Kitöltési útmutató: A formanyomtatványon a munkavállaló a személyes adatainak módosítását kezdeményezheti.
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel
Angol Középfokú Nyelvvizsgázók Bibliája: Nyelvtani összefoglalás, 30 kidolgozott szóbeli tétel, esszé és minta levelek + rendhagyó igék jelentéssel Timea Farkas Click here if your download doesn"t start
Minden amerikanisztika szakos vegye fel az az alábbi elıadásokat (a
Frissítve: aug 29. Tanszéki honlap: http://elteal.ieas-szeged.hu/ Tájékoztató elsıéves BA angol/amerikanisztika és angol/amerikanisztika minor szakos diákoknak az ıszi félévrıl Elıadások: Minden angol
Tanuló neve azonosító felvételi sorrend Megjegyzés
Élelmiszer- és vegyiáru eladó Tervezett létszám: 12 fő Süveges Attila 10. B 1 felvéve Földvári Beáta 10. B 2 felvéve Vadász Brigitta 10. B 3 felvéve Kun Ibolya 10. B 4 felvéve Baktai Vivien 10. B 5 felvéve
Unit 10: In Context 55. In Context. What's the Exam Task? Mediation Task B 2: Translation of an informal letter from Hungarian to English.
Unit 10: In Context 55 UNIT 10 Mediation Task B 2 Hungarian into English In Context OVERVIEW 1. Hungarian and English in Context 2. Step By Step Exam Techniques Real World Link Students who have studied
Rotary District 1911 DISTRICT TÁMOGATÁS IGÉNYLŐ LAP District Grants Application Form
1 A Future Vision pilot célja a Future Vision Plan (Jövőkép terv) egyszerűsített támogatási modelljének tesztelése, és a Rotaristák részvételének növelése a segélyezési folyamatokban. A teszt során a districteknek
Mangalica: The VM-MOE Treaty. Olmos és Tóth Kft. Monte Nevado
Mangalica: The VM-MOE Treaty The agreement 2013 the Goverment of Hungary decided to launch a strategic cooperation with the MOE. The deal is based in the Hungarian Pig Development Strategy (3 to 6 millon
Csatlakozás a BME eduroam hálózatához Setting up the BUTE eduroam network
Csatlakozás a BME eduroam hálózatához Setting up the BUTE eduroam network Table of Contents Windows 7... 2 Windows 8... 6 Windows Phone... 11 Android... 12 iphone... 14 Linux (Debian)... 20 Sebők Márton
Universal Multiple-Octet Coded Character Set. International Organization for Standardization. Organisation Internationale de Normalisation
ISO/IEC JTC1/SC2/WG2 N4267 xx/xx-xxx 2012-04-28 Universal Multiple-Octet Coded Character Set International Organization for Standardization Organisation Internationale de Normalisation Международная организация
Using the CW-Net in a user defined IP network
Using the CW-Net in a user defined IP network Data transmission and device control through IP platform CW-Net Basically, CableWorld's CW-Net operates in the 10.123.13.xxx IP address range. User Defined
ISO/IEC JTC1/SC2/WG2 N4007 2011-01-21
ISO/IEC JTC1/SC2/WG2 N4007 Universal Multiple-Octet Coded Character Set International Organization for Standardization Organisation Internationale de Normalisation Международная организация по стандартизации
Business Opening. Very formal, recipient has a special title that must be used in place of their name
- Opening English Hungarian Dear Mr. President, Tisztelt Elnök Úr! Very formal, recipient has a special title that must be used in place of their name Dear Sir, Formal, male recipient, name unknown Dear
DANS és Narcis. Burmeister Erzsébet. HUNOR találkozó, Budapest 2013. március 13.
DANS és Narcis Burmeister Erzsébet HUNOR találkozó, Budapest 2013. március 13. DANS DANS (Data Archiving and Network Services) http://www.dans.knaw.nl Kutatási adatok archiválása a saját fejlesztésű EASY
Tudományos Ismeretterjesztő Társulat
Sample letter number 5. International Culture Festival PO Box 34467 Harrogate HG 45 67F Sonnenbergstraße 11a CH-6005 Luzern Re: Festival May 19, 2009 Dear Ms Atkinson, We are two students from Switzerland
1. Gyakorlat: Telepítés: Windows Server 2008 R2 Enterprise, Core, Windows 7
1. Gyakorlat: Telepítés: Windows Server 2008 R2 Enterprise, Core, Windows 7 1.1. Új virtuális gép és Windows Server 2008 R2 Enterprise alap lemez létrehozása 1.2. A differenciális lemezek és a két új virtuális
ENGLISH 24 English is fun Letter #1 Letters In the age of e-mails and cell phones writing a letter might seem out of fashion. However, learners of a foreign language should know how to do it. Here you
ANGOL NYELVI SZINTFELMÉRŐ 2013 A CSOPORT. on of for from in by with up to at
ANGOL NYELVI SZINTFELMÉRŐ 2013 A CSOPORT A feladatok megoldására 45 perc áll rendelkezésedre, melyből körülbelül 10-15 percet érdemes a levélírási feladatra szánnod. Sok sikert! 1. Válaszd ki a helyes
Az Országos Széchényi Könyvtár
Az Országos Széchényi Könyvtár Download: Az Országos Széchényi Könyvtár PDF ebook Az Országos Széchényi Könyvtár PDF - Are you searching for Az Országos Széchényi Könyvtár Books? Now, you will be happy
1x1 Fordítóiroda 1x1 Translations
To the Office of Immigration and Nationality Budapest Application for the Proof of Nationality I request for the establishment of the existence of my Hungarian nationality. I need / do not need a certificate
FÖLDRAJZ ANGOL NYELVEN GEOGRAPHY
Földrajz angol nyelven középszint 0513 ÉRETTSÉGI VIZSGA 2005. május 18. FÖLDRAJZ ANGOL NYELVEN GEOGRAPHY KÖZÉPSZINTŰ ÍRÁSBELI VIZSGA STANDARD LEVEL WRITTEN EXAMINATION Duration of written examination:
3. MINTAFELADATSOR KÖZÉPSZINT. Az írásbeli vizsga időtartama: 30 perc. III. Hallott szöveg értése
Oktatáskutató és Fejlesztő Intézet TÁMOP-3.1.1-11/1-2012-0001 XXI. századi közoktatás (fejlesztés, koordináció) II. szakasz ANGOL NYELV 3. MINTAFELADATSOR KÖZÉPSZINT Az írásbeli vizsga időtartama: 30 perc
Expansion of Red Deer and afforestation in Hungary
Expansion of Red Deer and afforestation in Hungary László Szemethy, Róbert Lehoczki, Krisztián Katona, Norbert Bleier, Sándor Csányi www.vmi.szie.hu Background and importance large herbivores are overpopulated
Sex: Male Date of Birth: 02 August 1947 Citizenship: Hungarian
PERSONAL INFORMATION Dr. János Szlávik 3300 Eger, Tompa Mihály u. 8. +36-36-520-400/3082 +36-30-4365-541 szlavik@ektf.hu www.gti.ektf.hu Sex: Male Date of Birth: 02 August 1947 Citizenship: Hungarian WORK
2. Local communities involved in landscape architecture in Óbuda
Év Tájépítésze pályázat - Wallner Krisztina 2. Közösségi tervezés Óbudán Óbuda jelmondata: Közösséget építünk, ennek megfelelően a formálódó helyi közösségeket bevonva fejlesztik a közterületeket. Békásmegyer-Ófaluban
- Bevándoroltak részére kiadott személyazonosító igazolvány
HUNGARY - Bevándoroltak részére kiadott személyazonosító igazolvány (Blue booklet form or card format issued for permanent residents - from 1 January 2000 a new card format has been introduced and issued)
General information for the participants of the GTG Budapest, 2017 meeting
General information for the participants of the GTG Budapest, 2017 meeting Currency is Hungarian Forint (HUF). 1 EUR 310 HUF, 1000 HUF 3.20 EUR. Climate is continental, which means cold and dry in February
Computer Architecture
Computer Architecture Locality-aware programming 2016. április 27. Budapest Gábor Horváth associate professor BUTE Department of Telecommunications ghorvath@hit.bme.hu Számítógép Architektúrák Horváth
Üzleti élet Nyitás. Nagyon hivatalos, a címzettnek meghatározott rangja van, aminek szerepelnie kell
- Nyitás angol magyar Dear Mr. President, Tisztelt Elnök Úr! Nagyon hivatalos, a címzettnek meghatározott rangja van, aminek szerepelnie kell Dear Sir, Hivatalos, férfi címzett, ismeretlen név Dear Madam,
Üzleti élet Nyitás. Nagyon hivatalos, a címzettnek meghatározott rangja van, aminek szerepelnie kell
- Nyitás magyar angol Tisztelt Elnök Úr! Dear Mr. President, Nagyon hivatalos, a címzettnek meghatározott rangja van, aminek szerepelnie kell Tisztelt Uram! Hivatalos, férfi címzett, ismeretlen név Tisztelt
The Hungarian National Bibliography. Peter Dippold National Széchényi Library
The Hungarian National Bibliography Peter Dippold National Széchényi Library Historical overview 1711 David Czvittinger: Specimen Hungariae literatae 1803 István Sándor: Magyar Könyvesház = Hungarian Bibliography
OLYMPICS! SUMMER CAMP
OLYMPICS! SUMMER CAMP YOUNG BUSINESS CAMP 3D DESIGN CAMP OLYMPICS SUMMER CAMP 20 24 JUNE AND 27 JUNE 1 JULY AGE: 6-14 Our ESB native-speaking teachers will provide a strong English learning content throughout
Cloud computing. Cloud computing. Dr. Bakonyi Péter.
Cloud computing Cloud computing Dr. Bakonyi Péter. 1/24/2011 1/24/2011 Cloud computing 2 Cloud definició A cloud vagy felhő egy platform vagy infrastruktúra Az alkalmazások és szolgáltatások végrehajtására
Lexington Public Schools 146 Maple Street Lexington, Massachusetts 02420
146 Maple Street Lexington, Massachusetts 02420 Surplus Printing Equipment For Sale Key Dates/Times: Item Date Time Location Release of Bid 10/23/2014 11:00 a.m. http://lps.lexingtonma.org (under Quick
Contact us Toll free (800) fax (800)
Table of Contents Thank you for purchasing our product, your business is greatly appreciated. If you have any questions, comments, or concerns with the product you received please contact the factory.
Miskolci Egyetem Gazdaságtudományi Kar Üzleti Információgazdálkodási és Módszertani Intézet Factor Analysis
Factor Analysis Factor analysis is a multiple statistical method, which analyzes the correlation relation between data, and it is for data reduction, dimension reduction and to explore the structure. Aim
1 Itroduction. 2 Example: Close Ë in the Rudimenta? BAKONYI Gábor. (Hungary, Budapest, Csillaghegy) October 30, 2009
DISTINCT CLOSE Ë LETTER IN THE NATIVE HUNGARIAN TEXT NAMED RUDIMENTA? Working document about Fig.3. of N3697.pdf, Fig.3. of N3615.pdf, Fig.3. of N3531.pdf, N3483.pdf, etc... BAKONYI Gábor. (Hungary, Budapest,
Website review acci.hu
Website review acci.hu Generated on September 30 2016 21:54 PM The score is 37/100 SEO Content Title Acci.hu - Ingyenes apróhirdető Length : 30 Perfect, your title contains between 10 and 70 characters.
Hogyan használja az OROS online pótalkatrész jegyzéket?
Hogyan használja az OROS online pótalkatrész jegyzéket? Program indítása/program starts up Válassza ki a weblap nyelvét/choose the language of the webpage Látogasson el az oros.hu weboldalra, majd klikkeljen
Correlation & Linear Regression in SPSS
Petra Petrovics Correlation & Linear Regression in SPSS 4 th seminar Types of dependence association between two nominal data mixed between a nominal and a ratio data correlation among ratio data Correlation
KELER KSZF Zrt. bankgarancia-befogadási kondíciói. Hatályos: 2014. július 8.
KELER KSZF Zrt. bankgarancia-befogadási kondíciói Hatályos: 2014. július 8. A KELER KSZF a nem-pénzügyi klíringtagjaitól, és az energiapiaci alklíringtagjaitól a KELER KSZF Általános Üzletszabályzata szerinti
Tudok köszönni tegezve és önözve, és el tudok búcsúzni. I can greet people in formal and informal ways. I can also say goodbye to them.
Mérleg Your checklist Az alábbiakban a MagyarOK 1. tankönyv témáinak listáját találja. A mondatok mellett a kapcsolódó oldalak és gyakorlatok számát is megadtuk, hogy megkönnyítsük az ismétlést. This document
FAMILY STRUCTURES THROUGH THE LIFE CYCLE
FAMILY STRUCTURES THROUGH THE LIFE CYCLE István Harcsa Judit Monostori A magyar társadalom 2012-ben: trendek és perspektívák EU összehasonlításban Budapest, 2012 november 22-23 Introduction Factors which
Create & validate a signature
IOTA TUTORIAL 7 Create & validate a signature v.0.0 KNBJDBIRYCUGVWMSKPVA9KOOGKKIRCBYHLMUTLGGAV9LIIPZSBGIENVBQ9NBQWXOXQSJRIRBHYJ9LCTJLISGGBRFRTTWD ABBYUVKPYFDJWTFLICYQQWQVDPCAKNVMSQERSYDPSSXPCZLVKWYKYZMREAEYZOSPWEJLHHFPYGSNSUYRZXANDNQTTLLZA
Can/be able to. Using Can in Present, Past, and Future. A Can jelen, múlt és jövő idejű használata
Can/ Can is one of the most commonly used modal verbs in English. It be used to express ability or opportunity, to request or offer permission, and to show possibility or impossibility. A az egyik leggyakrabban
Az Open Data jogi háttere. Dr. Telek Eszter
Az Open Data jogi háttere Dr. Telek Eszter Egy kis ismétlés Open Data/Open Access/Open Knowledge gyökerei Open Source Software FLOSS (Free Libre Open Source Software) Szoftver esetében egyszerű alapok:
A rosszindulatú daganatos halálozás változása 1975 és 2001 között Magyarországon
A rosszindulatú daganatos halálozás változása és között Eredeti közlemény Gaudi István 1,2, Kásler Miklós 2 1 MTA Számítástechnikai és Automatizálási Kutató Intézete, Budapest 2 Országos Onkológiai Intézet,
EN United in diversity EN A8-0206/482. Amendment
21.3.2019 A8-0206/482 482 Recital 13 g (new) (13g) In recognition of the need for specific treatment for the transport sector, in which movement is the very essence of the work undertaken by drivers, the
Mr. Adam Smith Smith's Plastics 8 Crossfield Road Selly Oak Birmingham West Midlands B29 1WQ
- Cím Mr. J. Rhodes Rhodes & Rhodes Corp. 212 Silverback Drive California Springs CA 92926 Amerikai címzés forma: Házszám + utca neve Település neve + ország rövidítése + irányítószám Mr. Adam Smith Smith's
Emelt szint SZÓBELI VIZSGA VIZSGÁZTATÓI PÉLDÁNY VIZSGÁZTATÓI. (A részfeladat tanulmányozására a vizsgázónak fél perc áll a rendelkezésére.
Emelt szint SZÓBELI VIZSGA VIZSGÁZTATÓI PÉLDÁNY VIZSGÁZTATÓI PÉLDÁNY A feladatsor három részből áll 1. A vizsgáztató társalgást kezdeményez a vizsgázóval. 2. A vizsgázó egy vita feladatban vesz részt a
Tavaszi Sporttábor / Spring Sports Camp. 2016. május 27 29. (péntek vasárnap) 27 29 May 2016 (Friday Sunday)
Tavaszi Sporttábor / Spring Sports Camp 2016. május 27 29. (péntek vasárnap) 27 29 May 2016 (Friday Sunday) SZÁLLÁS / ACCOMODDATION on a Hotel Gellért*** szálloda 2 ágyas szobáiban, vagy 2x2 ágyas hostel
MAGYAR AFRIKA TÁRSASÁG AFRICAN-HUNGARIAN UNION
MAGYAR AFRIKA TÁRSASÁG AFRICAN-HUNGARIAN UNION AHU MAGYAR AFRIKA-TUDÁS TÁR AHU HUNGARIAN AFRICA-KNOWLEDGE DATABASE ------------------------------------------------------------------------------------ KUN
Road construction works
Road construction works Info Version 2 Url http://com.mercell.com/permalink/45294693.aspx External tender id 246818-2014 Tender type Tender Document type Additional information Procurement procedure Open
Magyar - Angol Orvosi Szotar - Hungarian English Medical Dictionary (English And Hungarian Edition) READ ONLINE
Magyar - Angol Orvosi Szotar - Hungarian English Medical Dictionary (English And Hungarian Edition) READ ONLINE Dieter Werner Unseld: Angol - Magyar, Magyar - - Angol - Magyar, Magyar - Angol orvosi sz
MAGYAR AFRIKA TÁRSASÁG AFRICAN-HUNGARIAN UNION
MAGYAR AFRIKA TÁRSASÁG AFRICAN-HUNGARIAN UNION AHU MAGYAR AFRIKA-TUDÁS TÁR AHU HUNGARIAN AFRICA-KNOWLEDGE DATABASE ---------------------------------------------------------------------------- SZABÓ-ZSOLDOS
Cloud computing Dr. Bakonyi Péter.
Cloud computing Dr. Bakonyi Péter. 1/24/2011 Cloud computing 1/24/2011 Cloud computing 2 Cloud definició A cloud vagy felhő egy platform vagy infrastruktúra Az alkalmazások és szolgáltatások végrehajtására
Munkahelykeresés. Önéletrajz és állásinterjú 12. ÉVFOLYAM. Felkészülés a felnőtt szerepekre. A modul szerzõje: Simon Gabriella SZKB_212_04
SZKB_212_04 Felkészülés a felnőtt szerepekre Munkahelykeresés Önéletrajz és állásinterjú A modul szerzõje: Simon Gabriella SZOCIÁLIS, ÉLETVITELI ÉS KÖRNYEZETI KOMPETENCIÁK 12. ÉVFOLYAM 66 Szociális, életviteli
2. Tavasz Kupa. Uszonyos és Búvárúszó Verseny Kiírása
2. Tavasz Kupa Uszonyos és Búvárúszó Verseny Kiírása 1,/ A verseny célja: Az uszonyos-, és búvárúszás népszerűsítése, versenyzők részére versenyzési lehetőség biztosítása. 2,/ A verseny rendezője: HÓD
Vizsgaszervező intézmény: Wigner Jenő Műszaki, Informatikai Középiskola és Kollégium (Eger, Rákóczi út 2) tel./fax: (36) , Fax:
Vizsgaszervező intézmény: Wigner Jenő Műszaki, Informatikai Középiskola és Kollégium (Eger, Rákóczi út 2) tel./fax: (36) 311-211, 515-115 Fax: 515-116 Tisztelt Vizsgázó! Ezúton tájékoztatjuk, hogy a(z)
PIACI HIRDETMÉNY / MARKET NOTICE
PIACI HIRDETMÉNY / MARKET NOTICE HUPX DAM Másnapi Aukció / HUPX DAM Day-Ahead Auction Iktatási szám / Notice #: HUPX-MN-DAM-2018-0001 Dátum / Of: 26/01/2018 Tárgy / Subject: Hatályos díjszabás és kedvezmények
ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP
ENROLLMENT FORM / BEIRATKOZÁSI ADATLAP CHILD S DATA / GYERMEK ADATAI PLEASE FILL IN THIS INFORMATION WITH DATA BASED ON OFFICIAL DOCUMENTS / KÉRJÜK TÖLTSE KI A HIVATALOS DOKUMENTUMOKBAN SZEREPLŐ ADATOK
István Micsinai Csaba Molnár: Analysing Parliamentary Data in Hungarian
István Micsinai Csaba Molnár: Analysing Parliamentary Data in Hungarian The Hungarian Comparative Agendas Project Participant of international Comparative Agendas Project Datasets on: Laws (1949-2014)
Kovách Ádám főszerkesztő-h. Angi János Kerepeszki Róbert Pallai László
Tudomány és kultúra Szerkesztik: ifj. Barta János főszerkesztő Kovách Ádám főszerkesztő-h. Angi János Kerepeszki Róbert Pallai László A szerkesztőség címe: Debreceni Szemle, Szerkesztőségi titkárság Debrecen,
BKI13ATEX0030/1 EK-Típus Vizsgálati Tanúsítvány/ EC-Type Examination Certificate 1. kiegészítés / Amendment 1 MSZ EN 60079-31:2014
(1) EK-TípusVizsgálati Tanúsítvány (2) A potenciálisan robbanásveszélyes környezetben történő alkalmazásra szánt berendezések, védelmi rendszerek 94/9/EK Direktíva / Equipment or Protective Systems Intended
Minta ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA II. Minta VIZSGÁZTATÓI PÉLDÁNY
ANGOL NYELV KÖZÉPSZINT SZÓBELI VIZSGA II. A feladatsor három részből áll VIZSGÁZTATÓI PÉLDÁNY 1. A vizsgáztató társalgást kezdeményez a vizsgázóval. 2. A vizsgázó egy szituációs feladatban vesz részt a
Revenue Stamp Album for Hungary Magyar illetékbélyeg album. Content (tartalom) Documentary Stamps (okmánybélyegek)
Revenue Stamp Album for Hungary Magyar illetékbélyeg album Content (tartalom) Documentary Stamps (okmánybélyegek) I. OPM Austrian Financial Administration in Hungary (osztrák pénzügyigazgatás) 2 II. Currency:
MAGYAR AFRIKA TÁRSASÁG AFRICAN-HUNGARIAN UNION
MAGYAR AFRIKA TÁRSASÁG AFRICAN-HUNGARIAN UNION AHU MAGYAR AFRIKA-TUDÁS TÁR AHU HUNGARIAN AFRICA-KNOWLEDGE DATABASE ---------------------------------------------------------------------------- MADAT Hírlevél,
Conference Proceeding
Conference Proceeding Publication in the conference book of IDK2016 is only available for applicants meeting the following criteria: The author or a co-author gave the presentation/poster-presentation
Manuscript Title: Identification of a thermostable fungal lytic polysaccharide monooxygenase and
1 2 3 4 5 Journal name: Applied Microbiology and Biotechnology Manuscript Title: Identification of a thermostable fungal lytic polysaccharide monooxygenase and evaluation of its effect on lignocellulosic
Directors and Officers Liability Insurance Questionnaire Adatlap vezetõ tisztségviselõk és felügyelõbizottsági tagok felelõsségbiztosításához
Directors and Officers Liability Insurance Questionnaire Adatlap vezetõ tisztségviselõk és felügyelõbizottsági tagok felelõsségbiztosításához 1. Name, legal form and address of company Társaság neve, címe,
Report on the main results of the surveillance under article 11 for annex II, IV and V species (Annex B)
0.1 Member State HU 0.2.1 Species code 1358 0.2.2 Species name Mustela putorius 0.2.3 Alternative species scientific name 0.2.4 Common name házigörény 1. National Level 1.1 Maps 1.1.1 Distribution Map
10. Gyakorlat: Alkalmazások publikálása Remote Desktop Szervízen keresztül
10. Gyakorlat: Alkalmazások publikálása Remote Desktop Szervízen keresztül 10.1. Jogosultságok és csoportok létrehozása 10.2. Az RDS szerver szerepkör telepítése a DC01-es szerverre 10.3. Az RDS01-es szerver
TÁJÉKOZTATÓ SPECIALIZÁCIÓKRÓL: 1) BUSINESS ENGLISH 2) FORDÍTÁS ÉS TOLMÁCSOLÁS ALAPJAI. 2016. március 10.
TÁJÉKOZTATÓ SPECIALIZÁCIÓKRÓL: 1) BUSINESS ENGLISH 2) FORDÍTÁS ÉS TOLMÁCSOLÁS ALAPJAI 2016. március 10. Jelentkezés mindkét specializációra Az elsős faliújságra kitett jelentkezési lapon lehet a felvételi
Proxer 7 Manager szoftver felhasználói leírás
Proxer 7 Manager szoftver felhasználói leírás A program az induláskor elkezdi keresni az eszközöket. Ha van olyan eszköz, amely virtuális billentyűzetként van beállítva, akkor azokat is kijelzi. Azokkal
T Á J É K O Z T A T Ó. A 1108INT számú nyomtatvány a http://www.nav.gov.hu webcímen a Letöltések Nyomtatványkitöltő programok fülön érhető el.
T Á J É K O Z T A T Ó A 1108INT számú nyomtatvány a http://www.nav.gov.hu webcímen a Letöltések Nyomtatványkitöltő programok fülön érhető el. A Nyomtatványkitöltő programok fület választva a megjelenő
EEA, Eionet and Country visits. Bernt Röndell - SES
EEA, Eionet and Country visits Bernt Röndell - SES Európai Környezetvédelmi Ügynökség Küldetésünk Annak elősegítése, hogy az EU és a tagállamok a szükséges információk alapján hozhassák meg a környezet
KELET-ÁZSIAI DUPLANÁDAS HANGSZEREK ÉS A HICHIRIKI HASZNÁLATA A 20. SZÁZADI ÉS A KORTÁRS ZENÉBEN
Liszt Ferenc Zeneművészeti Egyetem 28. számú művészet- és művelődéstörténeti tudományok besorolású doktori iskola KELET-ÁZSIAI DUPLANÁDAS HANGSZEREK ÉS A HICHIRIKI HASZNÁLATA A 20. SZÁZADI ÉS A KORTÁRS
Longman Exams Dictionary egynyelvű angol szótár nyelvvizsgára készülőknek
Longman Exams Dictionary egynyelvű angol szótár nyelvvizsgára készülőknek Egynyelvű angol nagyszótár haladó nyelvtanulóknak és nyelvvizsgázóknak 212,000 szócikkel A szótárban minden definíció egyszerű
30. évfolyam 2015. 4. sz. AETAS TÖRTÉNETTUDOMÁNYI FOLYÓIRAT. A kiadványt szerkesztette: PELYACH ISTVÁN
30. évfolyam 2015. 4. sz. AETAS TÖRTÉNETTUDOMÁNYI FOLYÓIRAT A kiadványt szerkesztette: PELYACH ISTVÁN Tartalom Tanulmányok TAKÁCS TIBOR A Weidemann-ügy, 1961. Sport, hatalom és állambiztonság a korai Kádár-korszakban...
Lopocsi Istvánné MINTA DOLGOZATOK FELTÉTELES MONDATOK. (1 st, 2 nd, 3 rd CONDITIONAL) + ANSWER KEY PRESENT PERFECT + ANSWER KEY
Lopocsi Istvánné MINTA DOLGOZATOK FELTÉTELES MONDATOK (1 st, 2 nd, 3 rd CONDITIONAL) + ANSWER KEY PRESENT PERFECT + ANSWER KEY FELTÉTELES MONDATOK 1 st, 2 nd, 3 rd CONDITIONAL I. A) Egészítsd ki a mondatokat!
Report on the main results of the surveillance under article 11 for annex II, IV and V species (Annex B)
0.1 Member State HU 0.2.1 Species code 2633 0.2.2 Species name Mustela eversmanii 0.2.3 Alternative species scientific name 0.2.4 Common name molnárgörény 1. National Level 1.1 Maps 1.1.1 Distribution
ACO burkolható fedlapok. ACO műszaki katalógus ACO Burkolható fedlapok UNIFACE PAVING SOLID
ACO burkolható fedlapok ACO burkolható fedlapok ACO műszaki katalógus ACO Burkolható fedlapok UNIFACE PAVING SOLID ACO gully Tartalom Általános információk 3 page ACO Uniface ACO UNIFACE burkolható fedlap
FÖLDRAJZ ANGOL NYELVEN GEOGRAPHY
Földrajz angol nyelven középszint 0623 ÉRETTSÉGI VIZSGA 2007. május 15. FÖLDRAJZ ANGOL NYELVEN GEOGRAPHY KÖZÉPSZINTŰ ÍRÁSBELI ÉRETTSÉGI VIZSGA INTERMEDIATE LEVEL WRITTEN EXAM JAVÍTÁSI-ÉRTÉKELÉSI ÚTMUTATÓ
VI. Nemzetközi Ügyészi Szeminárium
VI. Nemzetközi Ügyészi Szeminárium A konferencia címe: Az ügyész és a bíró képzése és továbbképzése felkészítés az etikai kihívásokra. Hazai és nemzetközi tapasztalatok Időpontja: 2014. november 17. A
Felhívás. érted is amit olvasol? (Apostolok Cselekedetei 8:30)
Felhívás Valamennyi Tiszáninneni református általános iskola és a miskolci egyházi iskolák 7-8. osztályosai részére meghirdetett Biblia-értő angol nyelvi versenyen való részvételre. érted is amit olvasol?
discosnp demo - Peterlongo Pierre 1 DISCOSNP++: Live demo
discosnp demo - Peterlongo Pierre 1 DISCOSNP++: Live demo Download and install discosnp demo - Peterlongo Pierre 3 Download web page: github.com/gatb/discosnp Chose latest release (2.2.10 today) discosnp