A molekuláris genetikai vizsgálatok jelentősége veleszületett immunhiány betegségekben

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "A molekuláris genetikai vizsgálatok jelentősége veleszületett immunhiány betegségekben"


1 293 Maródi László A molekuláris genetikai vizsgálatok jelentősége veleszületett immunhiány betegségekben Az első veleszületett immunhiány betegséget, az X-kromoszómához kötött agammaglobulinaemiát 1952-ben Ogden Bruton amerikai katonaorvos ismerte fel, aki recidiváló, súlyos fertőzésben szenvedő fiúgyermekben a gammaglobulinok teljes hiányát észlelte a fehérje elektroforézis képen. Az első agammaglobulinaemiás beteg esetének leírását több évtizedes kutatómunka követte, amely több mint 200 primer immunhiány-betegség felismeréséhez vezetett. Az elmúlt 15 évben a molekuláris genetikai diagnosztika fejlődésének köszönhetően több mint 150 primer immunhiány-betegség genetikai hátterét sikerült tisztázni. Az esetek döntő többségében a molekuláris genetikai vizsgálatok segítségével pontos diagnózis állítható fel, és új terápiás módszerként megjelent a génterápia is. A genotípus-fenotípus vizsgálatok és az állatkísérletes modellek révén az immunhiány-betegségek többségében tisztázható a betegség patomechanizmusa, és az érintett génekről átíródó fehérjék funkciója. A nagyléptékű fejlődés ellenére azonban mind a mai napig nem ismert, hogyan vezet, pl. a BTK vagy a WASP gén mutációja X-kromoszómához kötött agammaglobulinaemia illetve Wiskott-Aldrich szindróma kialakulásához. A veleszületett immunhiánybetegségek diagnosztikájában és kezelésében elért eredmények a molekuláris medicina fejlődésének látványos bizonyítékai. Immundeficienciák Immundefektusnak vagy immundeficienciának, immunhiányos állapotnak az immunrendszer csökkent, extrém esetben hiányzó működését nevezzük. A defektusok lehetnek primerek, amikor az immunitáshiány az immunrendszer öröklött rendellenességének következménye, amely különböző fertőzések, allergia, autoimmun és daganatos betegségek kialakulására hajlamosít. Immunhiányos állapotra utalhat a krónikus étvágytalanság, az emésztési és felszívódási zavar, az idült hasmenés, a gyakori hőemelkedés és láz, a szomatikus retardáció, a vérzékenység és a súlyos oltási reakció. Legjellemzőbb a visszatérő, súlyos lefolyású, terápiára rosszul reagáló, változó lokalizációjú, gyakran maradványtünetekkel gyógyuló fertőzések kialakulása. Különös figyelmet érdemelnek az opportu-

2 294 MARÓDI LÁSZLÓ nista (ritkán előforduló kórokozók által okozott) recidiváló infekciók, az antibiotikum kezelés mellett is szokatlanul elhúzódó lefolyás, vagy az infekciók szövődményeinek szokatlan súlyossága. Az érintett családokban gyakran észlelhető a fertőzésekre való fogékonyság halmozott előfordulása, immundefektus, autoimmun betegség, allergiás hajlam, malignus megbetegedés vagy korai gyermekhalál. Gyakorlati szempontból a veleszületett immunhiány-betegségek a következő csoportokba sorolhatók: 1. az első viszonylag nagy esetszámú csoportba az antitest deficienciák tartoznak, amelyek recidív alsó és felső légúti fertőzések kialakulására hajlamosítanak; 2. a T-sejt illetve a kombinált immundeficienciákra a szomatikus fejlődés elmaradása, visszatérő hasmenések és opportunista fertőzések jellemzők; 3. a fagocita sejt defektusokra a gennykeltő baktériumok és gombák által okozott nyálkahártya- és invazív fertőzések típusosak. Immundefektusok Primer immundefektusok* Primer immundeficiencia B-sejt-defektus (64,7%) Másodlagos immundeficiencia Szerzett immundeficiencia Átmeneti immundeficiencia * European Society for Immundeficiency Regiszta adatai alapján T-sejt vagy kombinált immundeficiencia (20,2%) Phagocytasejt-defektus (8,7%) Komplementdefektus (3,6%) Egyéb (2,8%) Molekuláris genetikai vizsgálatok primer immundefektusokban A primer immunhiány-betegségek klinikailag heterogén kórképek. Az immundeficienciák egy része a típusos klinikai tünetek és a jellegzetes kórokozó spektrum alapján egyértelműen felismerhető. Az esetek nagyobb százalékában azonban a humorális és a celluláris immundeficienciák, valamint a komplement defektusok tünettanában átfedések mutatkoznak. Mindezek miatt a pontos diagnózis megállapításához a részletes anamnézis, a fertőzések etiológiájának, lefolyásának, típusának, lokalizációjának gondos elemzése, az ismételten elvégzett fizikális vizsgálat, a rutin laboratóriumi vizsgálatok, és az in vivo és in vitro immunológiai tesztek sokszor nem elegendőek; az egyértelmű diagnózishoz genetikai vizsgálatra is szükség van.

3 A MOLEKULÁRIS GENETIKAI VIZSGÁLATOK JELENTŐSÉGE IMMUNHIÁNY BETEGSÉGEKBEN 295 Napjainkban az immundeficienciák molekuláris genetikai kutatásában robbanásszerű fejlődés észlelhető. Egy évtizede még alig néhány immundeficiencia gén volt ismert, napjainkban azonban egyre több immundeficiencia esetén tisztázható a háttérben álló génhiba. Az elmúlt évben 14 különböző, primer immunhiány-betegség genetikai hátterét sikerült tisztázni. A jelenleg ismert, több mint 150 immundeficiencia-gén felismerése hozzájárult a veleszületett és az adaptív immunrendszer fejlődésének és szabályozásának jobb megértéséhez is. Az immunhiányos állapotok korai felismerésében bár egy-egy betegség esetében alacsony incidenciájú megbetegedésről van szó a genetikai szűrővizsgálatoknak óriási jelentősége van. A korai, biztos diagnózis lehetővé teszi a fertőzések kialakulásának megelőzését és korai adekvát immunterápiáját, a genetikai tanácsadást, a hordozóállapot kiszűrését, a prenatalis diagnózist. A PID-ben szenvedő betegek esetén a gén szintű diagnosztika a következők miatt nem nélkülözhető: 1. A molekuláris genetikai vizsgálatok megerősítik a feltételezett diagnózist, ami különösen akkor fontos, ha a laboratóriumi leletek és a klinikai kép a megszokottól eltérő. 2. A genetikai vizsgálatok segítségével fény derülhet az immunreguláció addig még ismeretlen részleteire, és tisztázható az immunhiányos betegség patomechanizmusa. 3. A PID által érintett családokban a terhesség alatti genetikai vizsgálatoknak óriási jelentősége van a családtervezésben. A leggyakoribb primer immundefektus, a szelektív IgA hiány előfordulási gyakorisága 1:500. De legalább ilyen arányban az immunhiányos betegségek nem kerülnek felismerésre, vagy téves diagnózis születik. A becsült gyakoriság tehát 1:250-ra tehető. Ezen számadatok is megerősítik, hogy az ilyen betegekre különösen nagy figyelmet kell fordítanunk. Laboratóriumunkban 2003-ig döntően a humorális és a celluláris immunválasz felmérésére alkalmas funkcionális, immunkémiai és biokémiai módszereket alkalmaztunk. A korszerű diagnosztikai feltételek biztosítása szükségessé tették molekuláris genetikai vizsgálómódszerek beállítását is. Évekkel korábban megfogalmazódott az a szakmai igény, hogy Magyarországon legalább egy helyen létre kell hozni immundeficiencia molekuláris genetikai központot. A várakozást követően, 2003-ban tanszékünkön létrejött Molekuláris Genetikai Laboratórium tehát országos igényt elégít ki. A ritka, öröklődő primer immundeficienciában szenvedő betegek és családtagjaik számára laboratóriumunkban a prenatalis genetikai diagnosztika is hozzáférhető, így lehetőségünk van arra is, hogy a családtervezésnél felmerülő fontos kérdésekre választ adjunk. Az esetek egy részében a genomikus DNS vizsgálata elegendő, hiszen ugyanaz a fenotípus nem egyszer különböző géndefektusok következménye lehet. Ugyanaz a génmutáció sokszor egy családon belül is teljesen eltérő fenotípusos

4 296 MARÓDI LÁSZLÓ megjelenést eredményezi. Ezen genotípus-fenotípus megfigyelések további kutatásokra ösztönöznek, elsősorban a környezeti és más genetikai faktorok pontos szerepének tisztázására, és a gének szerkezete és funkciója közötti összefüggések pontosabb megismerésére. Összefoglalás és konklúzió Az elmúlt évtizedben a molekuláris genetika területén robbanásszerű fejlődésnek lehettünk szemtanúi, amely számos korábban misztikusnak vélt immunhiánybetegség patomechanizmusának megértéséhez vezetett. A közelmúltban több primer immundeficiencia molekuláris genetikai alapjait sikerült tisztázni, így fény derült a rövid végtagú törpeség, a leukocyta adhéziós protein deficiencia és a fokozott radioszenzitivitással társuló súlyos kombinált immundefektus hátterére. Bár a klinikai szintű manifesztációkat nem minden esetben tudjuk egy jól meghatározott molekuláris defektushoz kötni, a klinikai immunológiai megfigyelések és az immunológiai alapkutatások molekuláris szintű eredményeinek folyamatos összevetése mindkét oldal számára gyümölcsöző lehet. A primer immundeficienciák hasznos modellként szolgálhatnak a jövő kutatásaiban az autoimmun vagy az allergiás immunpatomechanizmusú, multifaktoriális betegségek tanulmányozására is. Ha a tünetek hátterében öröklődő betegség lehetősége is felmerül, a családi anamnézis mellett, a családfakészítésnek is az első diagnosztikus lépések között kell szerepelnie (1. ábra). Bár a legtöbb öröklött immundeficiencia genetikai szintű leírására csak a közelmúltban került sor, a családfák és a családtagok anamnézisének pontos elemzése az esetek többségében segít feltérképezni a korábbi generációk érintett családtagjait, akiknek a klinikai tünetei, kórlefolyása a betegével megegyező. A precíz adatgyűjtés, és a távoli rokonok felkutatása időigényes feladat és rendszerint több családlátogatást igényel. A családtagok korábbi zárójelentéseinek, orvosi dokumentációjának áttekintése nélkülözhetetlen a betegségi oknyomozásban. Az immunológiai alapkutatások és a genetikai szűrővizsgálati módszerek és műszerek fejlődése, az immunrendszer számos betegségének molekuláris szintű megértéséhez vezetett. Az immunbiológia területén egyre bővülő lehetőséget teremtett új terápiás eljárások bevezetésére, nemcsak az immundeficienciák, hanem különböző autoimmun-, gyulladásos-, illetve transzplantációhoz kapcsolódó betegségekben is. Az immundeficienciák molekuláris kutatása területén tapasztalható hatalmas fejlődés ellenére maradtak kihívások. Ezek egyike a mutáns gén korrekciója génmódosított őssejt terápiával. A primer immunhiány betegségekben, a génterápiás próbálkozások kezdeti eredményei biztatónak tűnnek, és remény van arra, hogy a génterápia hamarosan az első vonalbeli terápiás eljárások között szerepeljen.

5 A MOLEKULÁRIS GENETIKAI VIZSGÁLATOK JELENTŐSÉGE IMMUNHIÁNY BETEGSÉGEKBEN 297 Appendix X-kromoszómához kötött lymphoproliferatív betegség: Családfa és esetismertetés A kilenc éves fiúgyermeket (B1) nyolc hónapos korában kezelték először kórházban tüdőgyulladás és vérszegénység miatt. Kilenc éves koráig más betegsége nem volt; ekkor torokgyulladás, máj- és lépmegnagyobbodás, nyirokcsomó duzzanat, légzési elégtelenség, sárgaság miatt igényelt kórházi felvételt. Tízórás ápolás után gyorsan progrediáló májelégtelenség, shock, agyi ödéma és beékelődés következtében exitált. Szérumában az anti-ebv (Epstein-Barr vírus) IgM titer emelkedett volt. A szövettani vizsgálatok a májban, a lépben és a tüdőben diffúz, atípusos lymphocytás és plazmasejtes infiltrációt igazoltak. A beteg unokaöccsének (B2) kórházi felvétele nyolc hónapos korában, kéthetes hurutos panaszok, láz, torokgyulladás, máj- és lépmegnagyobbodás, kiütések és generalizált nyirokcsomó duzzanat miatt vált szükségessé. Gyors progressziót mutató májelégtelenség és légzési elégtelenség miatt gépi lélegeztetést igényelt, de az intenzív kezelés ellenére a felvételét követő 4. napon exitált. A szövettani vizsgálatok a májban, a csontvelőben és a központi idegrendszer területén diffúz, T- és plazmasejtes infiltrációt igazoltak. A lymphocyta marker vizsgálatok a nyirokcsomókban és a májban a CD8 + T lymphocyták dominanciáját és intakt B- sejtes területeket mutattak. A súlyos klinikai kép és a szövettani vizsgálatok eredménye alapján a SH2D1A gén mutációjának lehetősége merült fel. A betegek családtagjainak perifériás véréből genomikus DNS-t izoláltunk és az SH2D1A génmutáció vizsgálatát végeztük el. Először a B2 beteg édesanyját (II.1) és anyai nagymamáját (I.1) vizsgáltuk, akik az 1. exon, c.47g>a mutációjára nézve heterozigótának bizonyultak. Ugyanezt a mutációt a B2 beteg nyirokcsomó szövettani blokkjából izolált genomikus DNS-ben is igazoltuk. Bár a B1 beteg mutáció analízis vizsgálatára nem volt lehetőségünk, a klinikai kép, az X-kromoszómához kötött öröklődés és a szövettani eltérések alapján feltételeztük, hogy ő is az unokaöccsében igazolt mutációt hordozta. A család kivizsgálása közben a B2 beteg nagynénje (II.2) várandós lett és a magzati nem meghatározás fiú magzatot (III.3) igazolt. Az édesanya és a magzat a mutációra nézve vad típusúnak bizonyult. A SAP protein p.g16d aminosav cseréhez vezető c.47g>a mutációja XLP betegek között korábban még nem volt ismert, ezért a mutáns fehérje patogenetikai szerepének igazolására további vizsgálatokat végeztünk, amelyek igazolták, hogy az általunk talált mutáció a betegség genetikai oka volt.

6 298 MARÓDI LÁSZLÓ a) I. II. B1 III. B2 b) I.1 II.1 II.2 III.1 III.3 K c) p.g16d 1 MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTE 61 TGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIRED 121 PDVCLKAP 1. ábra X-kromoszómához kötött lymphoproliferatív betegségben szenvedő beteg családfája és a család molekuláris genetikai vizsgálatának eredményei. a) Szürke négyzetek, fiú betegek fatális infekciós mononucleosissal; áthúzás, meghalt betegek; szaggatott négyzet, fiúmagzat; B, beteg. b) A genomiális DNS szekvenálás eredményeit jelző elektroferogrammokon a SAP gén 1. exonján a B2 (III.1) beteg esetén c.47g>a mutációt látunk és a vad típusú szekvenciát a kontrollnál (K); a mutáció helyét aláhúzással jelöltük. Az elektroferogrammok az anyai nagymama (I.1) és az édesanya (II.1) esetén heterozigóta állapotot, az édesanya testvérében (II.2) és a fiúmagzatban (III.3) vad típust mutatnak. c) A SAP protein aminosav szekvenciája (fekete-kék váltakozó színek, exonok; piros betű: átfedő aminosav). A mutáció helyét nyíllal jelöltük. * * A szerző köszönetet mond munkatársainak (Erdős Melindának, Alapi Krisztinának, Török Olgának, Balogh Istvánnak, Tóth Beátának, Csorba Gabriellának, Csomor Juditnak és Sümegi Jánosnak), akik a tanulmány összeállításában segítségére voltak.

Molekuláris genetikai vizsgáló. módszerek az immundefektusok. diagnosztikájában

Molekuláris genetikai vizsgáló. módszerek az immundefektusok. diagnosztikájában Molekuláris genetikai vizsgáló módszerek az immundefektusok diagnosztikájában Primer immundefektusok A primer immundeficiencia ritka, veleszületett, monogénes öröklődésű immunhiányos állapot. Családi halmozódást


17.2. ábra Az immunválasz kialakulása és lezajlása patogén hatására

17.2. ábra Az immunválasz kialakulása és lezajlása patogén hatására 11. 2016. nov 30. 17.2. ábra Az immunválasz kialakulása és lezajlása patogén hatására 17.3. ábra A sejtközötti térben és a sejten belül élő és szaporodó kórokozók ellen kialakuló védekezési mechanizmusok


Prenatalis diagnosztika lehetőségei mikor, hogyan, miért? Dr. Almássy Zsuzsanna Heim Pál Kórház, Budapest Toxikológia és Anyagcsere Osztály

Prenatalis diagnosztika lehetőségei mikor, hogyan, miért? Dr. Almássy Zsuzsanna Heim Pál Kórház, Budapest Toxikológia és Anyagcsere Osztály Prenatalis diagnosztika lehetőségei mikor, hogyan, miért? Dr. Almássy Zsuzsanna Heim Pál Kórház, Budapest Toxikológia és Anyagcsere Osztály Definíció A prenatális diagnosztika a klinikai genetika azon



GYERMEK-TÜDŐGYÓGYÁSZAT GYERMEK-TÜDŐGYÓGYÁSZAT I. 1. Légutak és a tüdő fejlődése 2. Légzőrendszer élettani működése 3. Újszülöttkori légzészavarok 4. Bronchopulmonalis dysplasia 5. A gége veleszületett és szerzett rendellenességei


PrenaTest Újgenerációs szekvenálást és z-score

PrenaTest Újgenerációs szekvenálást és z-score PrenaTest Újgenerációs szekvenálást és z-score számítást alkalmazó, nem-invazív prenatális molekuláris genetikai teszt a magzati 21-es triszómia észlelésére, anyai vérből végzett DNS izolálást követően


II. Klinikai Immunológiai Interdiszciplináris Fórum (KIIF)

II. Klinikai Immunológiai Interdiszciplináris Fórum (KIIF) II. Klinikai Immunológiai Interdiszciplináris Fórum (KIIF) 2011.11.10 2011.11.12. Hotel Divinus, Debrecen (Debrecen, Nagyerdei krt. 1.) Főszervező: A Magyar Allergológiai és Klinikai Immunológiai Társaság


Maródi László. A J Project

Maródi László. A J Project Maródi László A J Project A Debreceni Egyetem Orvos- és Egészségtudományi Centrum (DEOEC) Infektológiai és Gyermekimmunológiai Tanszék (IGyIT) egyik feladata a veleszületett immunhiányos betegek kivizsgálása


MAGYOT évi Tudományos Szimpóziuma Május 5-6, Budapest

MAGYOT évi Tudományos Szimpóziuma Május 5-6, Budapest MAGYOT 2017. évi Tudományos Szimpóziuma Május 5-6, Budapest A petefészekrákok kezelésében nem régen került bevezetésre egy újabb fenntartó kezelés BRCA mutációt hordozó (szomatikus vagy germinális) magas


Colorectalis carcinomában szenvedő betegek postoperatív öt éves követése

Colorectalis carcinomában szenvedő betegek postoperatív öt éves követése Colorectalis carcinomában szenvedő betegek postoperatív öt éves követése Kegyes Lászlóné 1, Némethné Lesó Zita 1, Varga Sándor Attiláné 1, Barna T. Katalin 1, Rombauer Edit 2 Dunaújvárosi Prodia Központi





Minden leendő szülő számára a legfontosabb, hogy születendő gyermeke egészséges legyen. A súlyosan beteg gyermek komoly terheket ró a családra.

Minden leendő szülő számára a legfontosabb, hogy születendő gyermeke egészséges legyen. A súlyosan beteg gyermek komoly terheket ró a családra. Egészséges magzat, biztonságos jövő Minden leendő szülő számára a legfontosabb, hogy születendő gyermeke egészséges legyen. A súlyosan beteg gyermek komoly terheket ró a családra. A veleszületett fejlődési


1. ESET DIAGNÓZIS: LYMPHADENITIS MESENTERIALIS. 16 éves nő: görcsös hasi fájdalom, hányinger, hányás, vizes hasmenés, collaptiform rosszullét

1. ESET DIAGNÓZIS: LYMPHADENITIS MESENTERIALIS. 16 éves nő: görcsös hasi fájdalom, hányinger, hányás, vizes hasmenés, collaptiform rosszullét 1. ESET 16 éves nő: görcsös hasi fájdalom, hányinger, hányás, vizes hasmenés, collaptiform rosszullét Sebészeti osztály hasi UH: bélfal ödéma, ascites konzervatív kezelés DIAGNÓZIS: LYMPHADENITIS MESENTERIALIS


Citopeniák. Vérszegénységek Neutropéniák Trombocitopeniák

Citopeniák. Vérszegénységek Neutropéniák Trombocitopeniák Citopeniák Vérszegénységek Neutropéniák Trombocitopeniák Anémia okai Fokozott pusztulás-vvt élettartam csökkenés (


Leukocytosis. dr. Erdélyi Dániel SE II. sz. Gyermekgyógyászati Klinika

Leukocytosis. dr. Erdélyi Dániel SE II. sz. Gyermekgyógyászati Klinika Leukocytosis dr. Erdélyi Dániel SE II. sz. Gyermekgyógyászati Klinika www.studyblue.com http://ctle.hccs.edu/biologylabs/ap2/02blood/blood_quiz/index.html Össz fehérvérsejtszám FVS (G/L) 30 15 10 5 normál


Terhesgondozás, ultrahangvizsgálat Dr. Tekse István. www.szulesz-nogyogyaszt.hu

Terhesgondozás, ultrahangvizsgálat Dr. Tekse István. www.szulesz-nogyogyaszt.hu Terhesgondozás, ultrahangvizsgálat Dr. Tekse István www.szulesz-nogyogyaszt.hu 1. Fogamzás előtti ( praeconceptionalis ) tanácsadás, gondozás 2. Kismamák gondozása a szülésig 1. A kismama és fejlődő magzatának


Katasztrófális antifoszfolipid szindróma

Katasztrófális antifoszfolipid szindróma Katasztrófális antifoszfolipid szindróma Gadó Klára Semmelweis Egyetem, I.sz. Belgyógyászati Klinika Antifoszfolipid szindróma Artériás és vénás thrombosis Habituális vetélés apl antitest jelenléte Mi


TÜDŐGYÓGYÁSZATI KLINIKA 4012 Db., Nagyerdei krt. 98. Tel/fax: (52) 255-222

TÜDŐGYÓGYÁSZATI KLINIKA 4012 Db., Nagyerdei krt. 98. Tel/fax: (52) 255-222 4012 Db., Nagyerdei krt. 98. Tel/fax: (52) 255-222 Klinikaigazgató: Klinikai főorvos: Szakorvos: Szakorvos jelölt: Központi gyakornok: Tanulmányi felelős: Dr. Szilasi Mária egyetemi docens Dr. Fodor Andrea


Milyen tünetek esetén kell immunhiányos állapotra gondolni?

Milyen tünetek esetén kell immunhiányos állapotra gondolni? Milyen tünetek esetén kell immunhiányos állapotra gondolni? Dr. Griger Zoltán DEKK ÁOK, Belgyógyászati Intézet, Klinikai Immunológiai Tanszék VI. Autoimmun betegklub, Debrecen 2014. október 11. Az immunhiányos


A genetikai lelet értelmezése monogénes betegségekben

A genetikai lelet értelmezése monogénes betegségekben A genetikai lelet értelmezése monogénes betegségekben Tory Kálmán Semmelweis Egyetem, I. sz. Gyermekklinika A ~20 ezer fehérje-kódoló gén a 23 pár kromoszómán A kromoszómán található bázisok száma: 250M


Genomikai Medicina és Ritka Betegségek Intézete Semmelweis Egyetem

Genomikai Medicina és Ritka Betegségek Intézete Semmelweis Egyetem Tisztelt Hölgyem, Tisztelt Uram! Örömmel jelentjük be Önöknek, hogy a Genomikai Medicina és Ritka Betegségek Intézetének egyik új projektje azon betegségek genetikai hátterének feltérképezésére irányul,


Súlyos infekciók differenciálása a rendelőben. Dr. Fekete Ferenc Heim Pál Gyermekkórház Madarász utcai Gyermekkórháza

Súlyos infekciók differenciálása a rendelőben. Dr. Fekete Ferenc Heim Pál Gyermekkórház Madarász utcai Gyermekkórháza Súlyos infekciók differenciálása a rendelőben Dr. Fekete Ferenc Heim Pál Gyermekkórház Madarász utcai Gyermekkórháza Miért probléma a lázas gyermek a rendelőben? nem beteg - súlyos beteg otthon ellátható


GLUTÉN-SZŰRÉS Vízöntő Gyógyszertár 2015.10.19.

GLUTÉN-SZŰRÉS Vízöntő Gyógyszertár 2015.10.19. LISZTÉRZÉKENYSÉG (COELIAKIA) SZŰRÉS (GLUTÉN-SZŰRÉS) VÍZÖNTŐ GYÓGYSZERTÁR MI A LISZTÉRZÉKENYSÉG? A lisztérzékenység a kalászos gabonák fogyasztásával provokált autoimmun betegség, mely a bélrendszer és


4. A humorális immunválasz október 12.

4. A humorális immunválasz október 12. 4. A humorális immunválasz 2016. október 12. A klónszelekciós elmélet sarokpontjai: Monospecifictás: 1 sejt 1-féle specificitású receptor Az antigén receptorhoz kötődése aktiválja a limfocitát A keletkező


Klinikai Immunológiai Interdiszciplináris Fórum II. (KIIF)

Klinikai Immunológiai Interdiszciplináris Fórum II. (KIIF) Klinikai Immunológiai Interdiszciplináris Fórum II. (KIIF) 2011.11.10 2011.11.12. Hotel Divinus, Debrecen Főszervező: Prof. Dr. Zeher Margit A Magyar Allergológiai és Klinikai Immunológiai Társaság és


Humán genom variációk single nucleotide polymorphism (SNP)

Humán genom variációk single nucleotide polymorphism (SNP) Humán genom variációk single nucleotide polymorphism (SNP) A genom ~ 97 %-a két különböző egyedben teljesen azonos ~ 1% különbség: SNP miatt ~2% különbség: kópiaszámbeli eltérés, deléciók miatt 11-12 millió


A génterápia genetikai anyag bejuttatatása diszfunkcionálisan működő sejtekbe abból a célból, hogy a hibát kijavítsuk.

A génterápia genetikai anyag bejuttatatása diszfunkcionálisan működő sejtekbe abból a célból, hogy a hibát kijavítsuk. A génterápia genetikai anyag bejuttatatása diszfunkcionálisan működő sejtekbe abból a célból, hogy a hibát kijavítsuk. A genetikai betegségek mellett, génterápia alkalmazható szerzett betegségek, mint


Mit tud a genetika. Génterápiás lehetőségek MPS-ben. Dr. Varga Norbert

Mit tud a genetika. Génterápiás lehetőségek MPS-ben. Dr. Varga Norbert Mit tud a genetika Génterápiás lehetőségek MPS-ben Dr. Varga Norbert Oki terápia Terápiás lehetőségek MPS-ben A kiváltó okot gyógyítja meg ERT Enzimpótló kezelés Őssejt transzplantáció Genetikai beavatkozások


Hasi tumorok gyermekkorban

Hasi tumorok gyermekkorban Hasi tumorok gyermekkorban Dr. Bartyik Katalin SZTE ÁOK Gyermekgyógyászati Klinika és Gyermekegészségügyi Központ, Szeged A gyermekkori tumorok a halálozási oki tényezői közül a 2. helyen állnak a balesetek,


OPPONENSI VÉLEMÉNY. Dr. Lakatos Péter László köztestületi azonosító: 15893 az MTA Doktora cím elnyerése érdekében benyújtott,

OPPONENSI VÉLEMÉNY. Dr. Lakatos Péter László köztestületi azonosító: 15893 az MTA Doktora cím elnyerése érdekében benyújtott, OPPONENSI VÉLEMÉNY Dr. Lakatos Péter László köztestületi azonosító: 15893 az MTA Doktora cím elnyerése érdekében benyújtott, GENETIKAI, SZEROLÓGIAI ÉS KLINIKAI TÉNYEZŐK SZEREPE A GYULLADÁSOS BÉLBETEGSÉGEK


Immunológia I. 2. előadás. Kacskovics Imre (imre.kacskovics@ttk.elte.hu)

Immunológia I. 2. előadás. Kacskovics Imre (imre.kacskovics@ttk.elte.hu) Immunológia I. 2. előadás Kacskovics Imre (imre.kacskovics@ttk.elte.hu) Az immunválasz kialakulása A veleszületett és az adaptív immunválasz összefonódása A veleszületett immunválasz mechanizmusai A veleszületett



HUMAN IMMUNDEFICIENCIA VÍRUS (HIV) ÉS AIDS HUMAN IMMUNDEFICIENCIA VÍRUS (HIV) ÉS AIDS Dr. Mohamed Mahdi MD. MPH. Department of Infectology and Pediatric Immunology University of Debrecen (MHSC) 2012 Diagnózis HIV antitest teszt: A HIV ellen termel


A legújabb adatok összefoglalása az antibiotikum rezisztenciáról az Európai Unióban

A legújabb adatok összefoglalása az antibiotikum rezisztenciáról az Európai Unióban A legújabb adatok összefoglalása az antibiotikum rezisztenciáról az Európai Unióban Legfontosabb tények az antibiotikum rezisztenciáról A mikroorganizmusok antibiotikumokkal szemben kialakuló rezisztenciája


A diagnosztika alapja ma. Az autizmus spektrum zavarok diagnosztikája - alapvetések. Kiindulópont: a XXI. század autizmus-tudása

A diagnosztika alapja ma. Az autizmus spektrum zavarok diagnosztikája - alapvetések. Kiindulópont: a XXI. század autizmus-tudása http://www.pyroenergen.com Az autizmus spektrum zavarok diagnosztikája - alapvetések Dr. Stefanik Krisztina ELTE BGGYK krisztina.stefanik@barczi.elte.hu Kiindulópont: a XXI. század autizmus-tudása Genetika


Allergia immunológiája 2012.

Allergia immunológiája 2012. Allergia immunológiája 2012. AZ IMMUNVÁLASZ SZEREPLŐI BIOLÓGIAI MEGKÖZELÍTÉS Az immunrendszer A fő ellenfelek /ellenségek/ Limfociták, makrofágok antitestek, stb külső és belső élősködők (fertőzés, daganat)


A DE KK Belgyógyászati Klinika Intenzív Osztályán és Terápiás Aferezis Részlegén évi közel 400 db plazmaferezis kezelést végzünk.

A DE KK Belgyógyászati Klinika Intenzív Osztályán és Terápiás Aferezis Részlegén évi közel 400 db plazmaferezis kezelést végzünk. A DE KK Belgyógyászati Klinika Intenzív Osztályán és Terápiás Aferezis Részlegén évi közel 400 db plazmaferezis kezelést végzünk. Az eseteink túlnyomó részét neuro-, immunológiai eredetű kórképek adják.


Esetbemutatás. Dr. Iván Mária Uzsoki Kórház 2013.11.07.

Esetbemutatás. Dr. Iván Mária Uzsoki Kórház 2013.11.07. Esetbemutatás Dr. Iván Mária Uzsoki Kórház 2013.11.07. Esetbemutatás I. 26 éves férfi 6 héttel korábban bal oldali herében elváltozást észlelt,majd 3 héttel később haemoptoe miatt kereste fel orvosát antibiotikumos


A normál human immunglobulin kezelés gyakorlati szempontjai. DE KK BELGYÓGYÁSZATI KLINIKA KLINIKAI IMMUNOLÓGIA TANSZÉK Szabóné Törő Anna

A normál human immunglobulin kezelés gyakorlati szempontjai. DE KK BELGYÓGYÁSZATI KLINIKA KLINIKAI IMMUNOLÓGIA TANSZÉK Szabóné Törő Anna A normál human immunglobulin kezelés gyakorlati szempontjai DE KK BELGYÓGYÁSZATI KLINIKA KLINIKAI IMMUNOLÓGIA TANSZÉK Szabóné Törő Anna Immunhiányos betegségek Az immunhiányos betegségeket az immunrendszer


A DOWN-KÓR SZŰRÉSE. Down-kór szűrés az egészséges babákért és a boldog kismamákért. Mi az a Down szindróma? A Down szindróma tünetei:

A DOWN-KÓR SZŰRÉSE. Down-kór szűrés az egészséges babákért és a boldog kismamákért. Mi az a Down szindróma? A Down szindróma tünetei: A DOWN-KÓR SZŰRÉSE Kedves Kismama! Gratulálunk születendő gyermekéhez! Ön és családja bizonyára örömmel várják az újszülött érkezését, azonban a legtöbb kismamához hasonlóan Önben is felmerül, hogy a szülés



ÁPRILIS 27. IMMUNOLÓGIA NYÍLT NAP (D 2011. 2011. ÁPRILIS 27. 27. Média megjelenések 2011. április 26-tól (DEBRECEN EBRECEN) Nyomtatott média Egészségcentrum, 2011. nyár (következő szám) Elektronikus média DTV, Napszemle,


Elérte hazánkat az influenzajárvány

Elérte hazánkat az influenzajárvány Az Országos Epidemiológiai Központ tájékoztatója az influenza figyelőszolgálat adatairól Magyarország 2015. 3. hét Elérte hazánkat az influenzajárvány A figyelőszolgálatban résztvevő orvosok jelentései


Egyetemi doktori (PhD) értekezés tézisei A WISKOTT-ALDRICH SZINDRÓMA MOLEKULÁRIS PATOLÓGIÁJA. Dr. Gulácsy Vera



Embriószelekció PGD-vel genetikai terheltség esetén. Kónya Márton Istenhegyi Géndiagnosztika

Embriószelekció PGD-vel genetikai terheltség esetén. Kónya Márton Istenhegyi Géndiagnosztika Embriószelekció PGD-vel genetikai terheltség esetén Kónya Márton Istenhegyi Géndiagnosztika A praeimplantatiós genetikai diagnosztika (PGD) a praenatalis diagnosztika legkorábbi formája, a beágyazódás


BUKTATÓK A PULMONOLÓGIÁBAN. Kovács Lajos SE. I. sz. Gyermekklinika, Budapest

BUKTATÓK A PULMONOLÓGIÁBAN. Kovács Lajos SE. I. sz. Gyermekklinika, Budapest BUKTATÓK A PULMONOLÓGIÁBAN Kovács Lajos SE. I. sz. Gyermekklinika, Budapest KÓRLEFOLYÁS I. Perinatális anamnézis 36 hétre s.c. 3100 g, zavartalan adaptáció I. Klinikai felvétel 2 hó - átvétel városi kórházból





A házi gyermekorvosi praxisokban lezajlott gyorsteszt-felhasználás kérdőíves eredményei (II. Cél 9. feladat) Dr. Mészner Zsófia

A házi gyermekorvosi praxisokban lezajlott gyorsteszt-felhasználás kérdőíves eredményei (II. Cél 9. feladat) Dr. Mészner Zsófia A házi gyermekorvosi praxisokban lezajlott gyorsteszt-felhasználás kérdőíves eredményei (II. Cél 9. feladat) Dr. Mészner Zsófia A vizsgálat jelentősége, előzményei A vizsgálatban összesen 35 házi gyermekorvos


Tájékoztató a Down szűrésről Első trimeszteri KOMBINÁLT TESZT

Tájékoztató a Down szűrésről Első trimeszteri KOMBINÁLT TESZT Tájékoztató a Down szűrésről Első trimeszteri KOMBINÁLT TESZT A terhességek kb. 1%-ában az újszülött teljesen egészséges szülőktől súlyos szellemi vagy testi fogyatékkal születik. A veleszületett értelmi


Opponensi Vélemény Dr. Nagy Bálint A valósidejű PCR alkalmazása a klinikai genetikai gyakorlatban ' című értekezéséről

Opponensi Vélemény Dr. Nagy Bálint A valósidejű PCR alkalmazása a klinikai genetikai gyakorlatban ' című értekezéséről Opponensi Vélemény Dr. Nagy Bálint A valósidejű PCR alkalmazása a klinikai genetikai gyakorlatban ' című értekezéséről Dr. Nagy Bálint az MTA doktora fokozat megszerzéséhez a fenti címen nyújtott be a


A magzat növekedésbeli eltérései. A várandós nő tüdő, gastrointestinalis, máj és neurológiai kórképei

A magzat növekedésbeli eltérései. A várandós nő tüdő, gastrointestinalis, máj és neurológiai kórképei A magzat növekedésbeli eltérései. A várandós nő tüdő, gastrointestinalis, máj és neurológiai kórképei Prof. Dr. Rigó János egyetemi tanár, igazgató Semmelweis Egyetem Általános Orvostudományi Kar I. Sz.


Mindennapi pajzsmirigy diagnosztika: antitestek, hormonszintek

Mindennapi pajzsmirigy diagnosztika: antitestek, hormonszintek Mindennapi pajzsmirigy diagnosztika: antitestek, hormonszintek Nagy V. Endre Endokrinológia Tanszék Debreceni Egyetem Orvos- és Egészségtudományi Centrum Belgyógyászati Intézet, I. Belklinika A pajzsmirigybetegségek


Intenzíven terjed az influenza

Intenzíven terjed az influenza Az Országos Epidemiológiai Központ tájékoztatója az influenza figyelőszolgálat adatairól Magyarország 2015. 4. hét Intenzíven terjed az influenza A 4. naptári héten tovább nőtt az influenzás panaszok miatt


Őssejttranszplantált gyermekek intenzív ellátása

Őssejttranszplantált gyermekek intenzív ellátása Őssejttranszplantált gyermekek intenzív ellátása Dr. Faggyas Attila Szent László Kórház, GYITO Őssejttranszplantáció (SCT) Az őssejttranszplantáció egy rohamosan fejlődő terápiás lehetőség különböző malignus


A tananyag tanulási egységei I. Általános elméleti onkológia I/1. Jelátviteli utak szerepe a daganatok kialakulásában I/2.

A tananyag tanulási egységei I. Általános elméleti onkológia I/1. Jelátviteli utak szerepe a daganatok kialakulásában I/2. A tananyag tanulási egységei I. Általános elméleti onkológia I/1. Jelátviteli utak szerepe a daganatok kialakulásában I/2. Vírusok szerepe a daganatok kialakulásában I/3. A környezet hatása a daganatok


Reumás láz és sztreptokokkusz-fertőzés utáni reaktív artritisz

Reumás láz és sztreptokokkusz-fertőzés utáni reaktív artritisz www.printo.it/pediatric-rheumatology/hu/intro Reumás láz és sztreptokokkusz-fertőzés utáni reaktív artritisz Verzió 2016 1. MI A REUMÁS LÁZ 1.1 Mi ez? A reumás láz nevű betegséget a sztreptokokkusz baktérium


Miskolci Egyetem Egészségügyi Kar Klinikai Radiológiai Tanszék által a 2010/2011-es tanévre meghirdetésre leadott szakdolgozati és TDK témák

Miskolci Egyetem Egészségügyi Kar Klinikai Radiológiai Tanszék által a 2010/2011-es tanévre meghirdetésre leadott szakdolgozati és TDK témák Miskolci Egyetem Egészségügyi Kar Klinikai Radiológiai Tanszék által a 2010/2011-es tanévre meghirdetésre leadott szakdolgozati és TK témák V Védőnő szakirány GY Gyógytornász szakirány Képalkotó iagnosztikai


Post-varicella angiopathia (PVA): klinikai és radiológiai jellemzők összefoglalása hét eset alapján

Post-varicella angiopathia (PVA): klinikai és radiológiai jellemzők összefoglalása hét eset alapján Post-varicella angiopathia (PVA): klinikai és radiológiai jellemzők összefoglalása hét eset alapján Kovács Éva 1,Várallyay György 2, Harkányi Zoltán 1, Rosdy Beáta 3, Móser Judit 3, Kollár Katalin 3, Barsi


Az Országos Epidemiológiai Központ tájékoztatója az influenza figyelőszolgálat adatairól Magyarország 2015. 7. hét

Az Országos Epidemiológiai Központ tájékoztatója az influenza figyelőszolgálat adatairól Magyarország 2015. 7. hét Az Országos Epidemiológiai Központ tájékoztatója az influenza figyelőszolgálat adatairól Magyarország 2015. 7. hét Országosan nem változott az influenzaaktivitás A figyelőszolgálatban résztvevő orvosok


A keringı tumor markerek klinikai alkalmazásának aktuális kérdései és irányelvei

A keringı tumor markerek klinikai alkalmazásának aktuális kérdései és irányelvei A keringı tumor markerek klinikai alkalmazásának aktuális kérdései és irányelvei A TM vizsgálatok alapkérdései A vizsgálatok célja, információértéke? Az alkalmazás területei? Hogyan válasszuk ki az alkalmazott


Új utak az antipszichotikus gyógyszerek fejlesztésében

Új utak az antipszichotikus gyógyszerek fejlesztésében Új utak az antipszichotikus gyógyszerek fejlesztésében SCHIZO-08 projekt Dr. Zahuczky Gábor, PhD, ügyvezető igazgató UD-GenoMed Kft. Debrecen, 2010. november 22. A múlt orvostudománya Mindenkinek ugyanaz


Trombotikus mikroangiopátiák diagnosztikus megfontolása

Trombotikus mikroangiopátiák diagnosztikus megfontolása Trombotikus mikroangiopátiák diagnosztikus megfontolása Prohászka Zoltán III. Sz. Belgyógyászati Klinika, Semmelweis Egyetem, Budapest prohoz@kut.sote.hu I. Terápiás Aferezis Konferencia, 2012. nov. 10.



CSALÁDTERVEZ TEKINTETTEL A PSZICHIÁTRIAI BETEGSÉGEKRE GEKRE. Dr. Erős s Erika CSALÁDTERVEZ DTERVEZÉS KÜLÖNÖS TEKINTETTEL A PSZICHIÁTRIAI BETEGSÉGEKRE GEKRE Dr. Erős s Erika A családtervez dtervezés s törtt rténete Magyarországon gon Veleszületett letett rendellenességek (CA) Jelenleg


Májátültetés és veleszületett anyagcsere betegségek. Dezsőfi Antal

Májátültetés és veleszületett anyagcsere betegségek. Dezsőfi Antal Májátültetés és veleszületett anyagcsere betegségek Dezsőfi Antal Öröklődő anyagcsere betegségek Az öröklődő anyagcsere betegségek döntő többsége a ritka betegségek közé tartozik. Ritka betegség, prevalencia


Az egész országot érinti az influenzajárvány Kiugróan magas volt az orvoshoz forduló betegek száma

Az egész országot érinti az influenzajárvány Kiugróan magas volt az orvoshoz forduló betegek száma Az Országos Epidemiológiai Központ tájékoztatója az influenza figyelőszolgálat adatairól Magyarország 2015. 5. hét Az egész országot érinti az influenzajárvány Kiugróan magas volt az orvoshoz forduló betegek





Az ország valamennyi területét érintő influenza-járvány bontakozott ki

Az ország valamennyi területét érintő influenza-járvány bontakozott ki Az Országos Epidemiológiai Központ Tájékoztatója az influenza surveillance adatairól Magyarország 2011. 4. Az ország valamennyi területét érintő influenza-járvány bontakozott ki A figyelőszolgálatra kijelölt


Megkezdődött hazánkban az influenzajárvány

Megkezdődött hazánkban az influenzajárvány Az Országos Epidemiológiai Központ tájékoztatója az influenza figyelőszolgálat adatairól Magyarország 2017. 01. hét Megkezdődött hazánkban az influenzajárvány A figyelőszolgálatban résztvevő orvosok jelentései


Dr. Béres Emese - Szemánné Vincze Erzsébet ÁNTSZ BAZ Megyei Intézete Egészségfejlesztési Osztály 2008. január 18.

Dr. Béres Emese - Szemánné Vincze Erzsébet ÁNTSZ BAZ Megyei Intézete Egészségfejlesztési Osztály 2008. január 18. HIV/AIDS Dr. Béres Emese - Szemánné Vincze Erzsébet ÁNTSZ BAZ Megyei Intézete Egészségfejlesztési Osztály 2008. január 18. Hogyan vált a piros szalag az AIDS elleni küzdelem jelképévé? 1991. Patrick O


Microcytaer anaemiák

Microcytaer anaemiák Microcytaer anaemiák Herszényi László MTA doktora Semmelweis Egyetem II. sz. Belgyógyászati Klinika 2015. február 19. I. Fokozott vvt-pusztulás a. Haemolysis II. Csökkent vvt-képzés a. Hgb-szintézis zavara


Laktózfelszívódási zavar egy gyakori probléma gyakorlati vonatkozásai

Laktózfelszívódási zavar egy gyakori probléma gyakorlati vonatkozásai Laktózfelszívódási zavar egy gyakori probléma gyakorlati vonatkozásai Karoliny Anna dr., B.Kovács Judit dr. Gasztroenterológiai és Nephrológiai Osztály, Heim Pál Gyermekkórház, Budapest (Igazgató: Nagy


Tüdőszűrés CT-vel, ha hatékony szűrővizsgálatot szeretnél! Online bejelentkezés CT vizsgálatra. Kattintson ide!

Tüdőszűrés CT-vel, ha hatékony szűrővizsgálatot szeretnél! Online bejelentkezés CT vizsgálatra. Kattintson ide! Tüdőszűrés CT-vel, ha hatékony szűrővizsgálatot szeretnél! Nap mint nap, emberek millió szenvednek valamilyen tüdőbetegség következtében, ráadásul a halálokok között is vezető szerepet betöltő COPD előfordulása


A pszichomotoros fejlődés zavarainak felismerése és ellátása

A pszichomotoros fejlődés zavarainak felismerése és ellátása A pszichomotoros fejlődés zavarainak felismerése és ellátása Dr. Gallai Mária gyermekpszichiáter Fejlődési zavar Fejlődési zavar gyanúja: megkésett eltérő disszociált fejlődés Fejlődési részterületek:


Az omnipotens kutatónak, Dr. Apáti Ágotának ajánlva, egy hálás ex-őssejtje

Az omnipotens kutatónak, Dr. Apáti Ágotának ajánlva, egy hálás ex-őssejtje 1 Az omnipotens kutatónak, Dr. Apáti Ágotának ajánlva, egy hálás ex-őssejtje Írta és rajzolta: Hargitai Zsófia Ágota Munkában részt vett: Dr. Sarkadi Balázs, Dr. Apáti Ágota A szerkesztésben való segítségért


A csodálatos Immunrendszer Lányi Árpád, DE, Immunológiai Intézet

A csodálatos Immunrendszer Lányi Árpád, DE, Immunológiai Intézet A csodálatos Immunrendszer Lányi Árpád, DE, Immunológiai Intézet Mi a feladata az Immunrendszernek? 1. Védelem a kórokozók ellen 2. Immuntolerancia fenntartása Mik is azok a kórokozók? Kórokozók alatt


Komplex pathológia 36 14 5fgy 55 8 30 Sz 22. Gyógyszer. kémia 45 30 5fgy 60 30 5fgy 34. O. mikrobiológia 50 30 Sz 49

Komplex pathológia 36 14 5fgy 55 8 30 Sz 22. Gyógyszer. kémia 45 30 5fgy 60 30 5fgy 34. O. mikrobiológia 50 30 Sz 49 Tantárgy 1. félév 2. félév Oldalszám E. Sz. Gy. V. E. Sz. Gy. V. Gyógyszertechnológia 30 120 5fgy 30 120 5fgy 4 K K Orvosbiológia III. 39 13 Sz 20 Komplex pathológia 36 14 5fgy 55 8 30 Sz 22 Gyógyszer.


Dr. Lakatos Péter. doktori értekezésének bírálata

Dr. Lakatos Péter. doktori értekezésének bírálata Dr. Lakatos Péter Genetikai, szerológiai és klinikai tényezők szerepe a gyulladásos bélbetegségek patogenezisében, jelentőségük a kórlefolyás és a terápiára adott válasz előrejelzésében című doktori értekezésének



A LABORBAN ELÉRHETŐ GYORSTESZTEK ÉRTELMEZÉSE A LABORBAN ELÉRHETŐ GYORSTESZTEK ÉRTELMEZÉSE Dr. Kiss Virág 2016.11.20 A LABORBAN ELÉRHETŐ GYORSTESZTEK: 1. Clostridium difficile gyorsteszt 2. RSV gyorsteszt 3. Influenza gyorsteszt 4. H.pylori Ag gyorsteszt



A CISZTÁS VESE ULTRAHANGMORFOLÓGIÁJA A KÓROKI GÉN FÜGGVÉNYÉBEN Várkonyi Ildikó, Balogh Eszter, Kis Éva, Nyitrai Anna, Kerti Andrea, JávorszkyEszter, Kalmár Tibor, Balogh István, Tory Kálmán Semmelweis Egyetem, I. sz. Gyermekklinika MTA SE Lendület Nephrogenetikai





Új könnyűlánc diagnosztika. Dr. Németh Julianna Országos Gyógyintézeti Központ Immundiagnosztikai Osztály MLDT-MIT Továbbképzés 2006

Új könnyűlánc diagnosztika. Dr. Németh Julianna Országos Gyógyintézeti Központ Immundiagnosztikai Osztály MLDT-MIT Továbbképzés 2006 Új könnyűlánc diagnosztika Dr. Németh Julianna Országos Gyógyintézeti Központ Immundiagnosztikai Osztály MLDT-MIT Továbbképzés 2006 1845 Bence Jones Protein vizelet fehérje 1922 BJP I-II típus 1956 BJP


Az Országos Epidemiológiai Központ tájékoztatója az influenza figyelőszolgálat adatairól Magyarország hét. Terjed az influenza

Az Országos Epidemiológiai Központ tájékoztatója az influenza figyelőszolgálat adatairól Magyarország hét. Terjed az influenza Az Országos Epidemiológiai Központ tájékoztatója az influenza figyelőszolgálat adatairól Magyarország 2017. 02. hét Terjed az influenza A 2. naptári héten tovább nőtt az influenzás panaszok miatt orvoshoz


A védőoltásokról. Infekciókontroll képzés szakdolgozóknak. HBMKHNSzSz Dr. Kohut Zsuzsa Járványügyi osztályvezető

A védőoltásokról. Infekciókontroll képzés szakdolgozóknak. HBMKHNSzSz Dr. Kohut Zsuzsa Járványügyi osztályvezető A védőoltásokról Infekciókontroll képzés szakdolgozóknak HBMKHNSzSz Dr. Kohut Zsuzsa Járványügyi osztályvezető 2012.10.24-25. Céljaink a vakcináció során: egyéni védelem biztosítása, az átoltottság fenntartása,


Mevalonát-Kináz-Hiány (MKD) (vagy hiper-igd szindróma)

Mevalonát-Kináz-Hiány (MKD) (vagy hiper-igd szindróma) www.printo.it/pediatric-rheumatology/hu/intro Mevalonát-Kináz-Hiány (MKD) (vagy hiper-igd szindróma) Verzió 2016 1. MI AZ MKD 1.1 Mi ez? A mevalonát-kináz-hiány genetikai betegség. A szervezet veleszületett


Diagnosztikai irányelvek Paget-kórban

Diagnosztikai irányelvek Paget-kórban Diagnosztikai irányelvek Paget-kórban Dr. Donáth Judit Országos Reumatológiai és Fizioterápiás Intézet, Budapest HALADÁS A REUMATOLÓGIA, IMMUNOLÓGIA ÉS OSTEOLÓGIA TERÜLETÉN 2012-2014 2015. ÁPRILIS 17.


Immunológia alapjai. 16. előadás. Komplement rendszer

Immunológia alapjai. 16. előadás. Komplement rendszer Immunológia alapjai 16. előadás Komplement rendszer A gyulladás molekuláris mediátorai: Plazma enzim mediátorok: - Kinin rendszer - Véralvadási rendszer Lipid mediátorok Kemoattraktánsok: - Chemokinek:


Rovarméreg (méh, darázs) - allergia

Rovarméreg (méh, darázs) - allergia Rovarméreg (méh, darázs) - allergia Herjavecz Irén Országos Korányi TBC és Pulmonológiai Intézet Epidemiológia I. Prevalencia: - nagy helyi reakció: felnőtt 10-15 % - szisztémás reakció: gyerek 0.4-0.8


A Debreceni Egyetem Gasztroenterológiai Tanszéke az Országos Immonológiai Koordináló Intézet és a MGT Immunológiai Munkacsoportja közös rendezvénye

A Debreceni Egyetem Gasztroenterológiai Tanszéke az Országos Immonológiai Koordináló Intézet és a MGT Immunológiai Munkacsoportja közös rendezvénye A i Egyetem Gasztroenterológiai Tanszéke az Országos Immonológiai Koordináló Intézet és a MGT Immunológiai Munkacsoportja közös rendezvénye III. i Gasztro-Immun Konferencia DEOEC, Auguszta Központ előadóterme


Mi lenne ha az MPS is része lenne az újszülöttkori tömegszűrésnek?

Mi lenne ha az MPS is része lenne az újszülöttkori tömegszűrésnek? Mi lenne ha az MPS is része lenne az újszülöttkori tömegszűrésnek? Dr. Jávorszky Eszter, Kánnai Piroska Dr. Szőnyi László Semmelweis Egyetem, I. Gyermekklinika, Budapest Anyagcsere szűrőközpont 2 Ritka


Tovább nőtt az orvoshoz forduló betegek száma. Az influenza B vírus felelős a megbetegedések többségéért.

Tovább nőtt az orvoshoz forduló betegek száma. Az influenza B vírus felelős a megbetegedések többségéért. Az Országos Epidemiológiai Központ tájékoztatója az influenza figyelőszolgálat adatairól Magyarország 2016. 6. hét Tovább nőtt az orvoshoz forduló betegek száma. Az influenza B vírus felelős a megbetegedések


Kutatási beszámoló ( )

Kutatási beszámoló ( ) Kutatási beszámoló (2008-2012) A thrombocyták aktivációja alapvető jelentőségű a thrombotikus betegségek kialakulása szempontjából. A pályázat során ezen aktivációs folyamatok mechanizmusait vizsgáltuk.


A harkányi gyógyvízzel végzett vizsgálataink eredményei psoriasisban között. Dr. Hortobágyi Judit

A harkányi gyógyvízzel végzett vizsgálataink eredményei psoriasisban között. Dr. Hortobágyi Judit A harkányi gyógyvízzel végzett vizsgálataink eredményei psoriasisban 2007-2011 között Dr. Hortobágyi Judit Pikkelysömörre gyakorolt hatása 2007-től 2009-ig 1. Lokális hatása 2. Szisztémás hatása 3. Állatkísérlet


Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Azonosító szám: TÁMOP-4.1.2-08/1/A-2009-0011 Az orvosi


CD8 pozitív primér bőr T-sejtes limfómák 14 eset kapcsán

CD8 pozitív primér bőr T-sejtes limfómák 14 eset kapcsán CD8 pozitív primér bőr T-sejtes limfómák 14 eset kapcsán Szepesi Ágota 1, Csomor Judit 1, Marschalkó Márta 2 Erős Nóra 2, Kárpáti Sarolta 2, Matolcsy András 1 Semmelweis Egyetem I. Patológiai és Kísérlet


Kryoglobulinaemia kezelése. Domján Gyula. Semmelweis Egyetem I. Belklinika. III. Terápiás Aferezis Konferencia, 2014. Debrecen

Kryoglobulinaemia kezelése. Domján Gyula. Semmelweis Egyetem I. Belklinika. III. Terápiás Aferezis Konferencia, 2014. Debrecen Kryoglobulinaemia kezelése Domján Gyula Semmelweis Egyetem I. Belklinika Mi a kryoglobulin? Hidegben kicsapódó immunglobulin Melegben visszaoldódik (37 C-on) Klasszifikáció 3 csoport az Ig komponens




Opponensi vélemény Lakos András Kullancs által terjesztett fertőzések; Lyme. Borreliosis, kullancsencephalitis, TIBOLA című MTA doktori értekezéséről.

Opponensi vélemény Lakos András Kullancs által terjesztett fertőzések; Lyme. Borreliosis, kullancsencephalitis, TIBOLA című MTA doktori értekezéséről. Opponensi vélemény Lakos András Kullancs által terjesztett fertőzések; Lyme Borreliosis, kullancsencephalitis, TIBOLA című MTA doktori értekezéséről. Az összességében 162 oldal terjedelmű, 99 ábrát, 7


Az Egészségügyi Minisztérium szakmai protokollja. Hyper IgM szindróma. Készítette: Klinikai Immunológiai és Allergológiai Szakmai Kollégium

Az Egészségügyi Minisztérium szakmai protokollja. Hyper IgM szindróma. Készítette: Klinikai Immunológiai és Allergológiai Szakmai Kollégium Az Egészségügyi Minisztérium szakmai protokollja Hyper IgM szindróma Készítette: Klinikai Immunológiai és Allergológiai Szakmai Kollégium BNO: D80.5 Betegségcsoport: Immunhiány megnövekedett immunglobulin


Billenőasztal teszt szerepe az ismeretlen eredetű syncope diagnosztikájában. Dr. Pántlik Róbert Dr. Balogh Gábor Dr.

Billenőasztal teszt szerepe az ismeretlen eredetű syncope diagnosztikájában. Dr. Pántlik Róbert Dr. Balogh Gábor Dr. Billenőasztal teszt szerepe az ismeretlen eredetű syncope diagnosztikájában Dr. Pántlik Róbert Dr. Balogh Gábor Dr. Domokos Gabriella Syncope: hirtelen jelentkező, eszméletvesztés, amely során a beteg


Az egész országban terjed az influenza Kiugróan magas volt az orvoshoz forduló betegek száma

Az egész országban terjed az influenza Kiugróan magas volt az orvoshoz forduló betegek száma Az Országos Epidemiológiai Központ tájékoztatója az influenza figyelőszolgálat adatairól Magyarország 2017. 4. hét Az egész országban terjed az influenza Kiugróan magas volt az orvoshoz forduló betegek



JAVÍTÁSI-ÉRTÉKELÉSI ÚTMUTATÓ Emberi Erőforrások Minisztériuma Korlátozott terjesztésű! Érvényességi idő: az írásbeli vizsgatevékenység befejezésének időpontjáig A minősítő neve: Rauh Edit A minősítő beosztása: mb. főigazgató-helyettes


Intenzíven terjed az influenza

Intenzíven terjed az influenza Az Országos Epidemiológiai Központ tájékoztatója az influenza figyelőszolgálat adatairól Magyarország 2017. 3. hét Intenzíven terjed az influenza A figyelőszolgálatban résztvevő orvosok jelentései alapján


NALP-12-Höz Társult Visszatérő Láz

NALP-12-Höz Társult Visszatérő Láz www.printo.it/pediatric-rheumatology/hu/intro NALP-12-Höz Társult Visszatérő Láz Verzió 2016 1. MI A NALP-12-HÖZ TÁRSULT VISSZATÉRŐ LÁZ 1.1 Mi ez? A NALP-12-höz társult visszatérő láz egy genetikai betegség.
