Neurodegeneratív betegségek kémiai és

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "Neurodegeneratív betegségek kémiai és"


1 Neurodegeneratív betegségek kémiai és biokémiai háttere Penke Botond, az MTA lev. tagja SZTE Orvosi Vegytani Intézet és MTA Fehérjekémiai Kutatócsoport, Szeged 1. Bevezetés A neurodegeneratív betegségek nagy része fehérjeaggregátumok képződésével kezdődik. Az aggregátumok részben a sejteken kívül helyezkednek el (ilyenek pl. az Alzheimer-plakkok), részben viszont a sejten belül zárványokat alkotnak (pl. a-synuclein a Lewy-testekben, hiperfoszforilezett tau-fehérje neurofibrilláris kötegekben). A legismertebb neurodegeneratív betegségeket és a jellemző fehérje aggregátumokat az 1. táblázat foglalja össze. Betegség Fehérjeaggregátum 1. Alzheimer-kór ß-amiloid (plakkok) tau (neurofibrilláris kötegek) 2. Parkinson-kór a-synuclein / ubiquitin 3. Lewy-testes demencia a-synuclein 4. FTDP-17 tau (Pick-testek) 5. Huntington-kór poli-glutamin / ubiquitin 6. Prion-betegség (Creutzfeld-Jacob kór) prion protein 7. Pick-betegség tau (Pick-testek) 8. Amiotróf lateral sclerosis ubiquitin 1. Táblázat A neurodegeneratív betegségek közös mechanizmusa: fehérjeaggregátumok képződése Egy és ugyanaz a fehérje aggregátum többféle betegségben is megjelenhet. A tauopathiák nagy családja az Alzheimer kóron kívül a Pick-betegséget valamint a frontotemporális demenciát és parkinsonizmust (FTDP-17) is magába foglalja, az a-synuclein fibrillumok egyaránt megjelennek a Parkinson-kórban és a Lewy-testes demenciában. Sokszor nem könnyű a neurodegeneratív 1 of :18

2 betegségeket egymástól elkülöníteni, éppen a közös fehérje-aggregátumok miatt. Nagyon jellemző viszont az idegsejtek károsodásának, pusztulásának a helye, így a legtöbb neurodegeneratív betegség régió sőt sejtspecifikus, legalábbis a betegség korai szakaszában. A kórképek közös mechanizmusára utal az a tény, hogy a felsorolt fehérjék valamennyi esetben konformációváltozást szenvednek (a-hélix > ß-szalag átalakulás) és ß-szerkezetű polipeptid láncokat tartalmazó szálakká, fibrillumokká alakulnak át (Mager 2002). A fibrillumok, sőt a kisebb, diffúzibilis aggregátumok is enzimrezisztensek és neurotoxikus hatásúak. A szakirodalom megegyezik abban, hogy a felsorolt neurodegenerációs betegségek végső oka bizonyos fehérjék nem megfelelő feltekeredése, gombolyodása (misfolding), a hibás fehérje térszerkezetek kialakulása. 2. A neurodegeneratív betegségek genetikai háttere Nem minden esetben tisztázott a neurodegeneratív betegségek genetikai háttere. A 2. és 3. táblázat röviden összefoglalja a legfontosabb betegségek öröklődését és az eddig ismert fontosabb mutáns géneket, genetikai faktorokat. Betegség Öröklődés, genetikai háttér 1. Alzheimer kór Sporadikus/Autoszom. domináns 2. Parkinson kór Sporadikus/Autoszom. recesszív 3. Lewy-testes demencia Sporadikus/Autoszom. recesszív 4. FTDP-17 Autoszom. domináns 5. Huntington kór Autoszom. domináns 6. Prion betegség (részben öröklött) 7. Pick betegség Sporadikus 8. Amiotróf lateral sclerosis Sporadikus/Autoszom. domináns 2. Táblázat: A neurodegeneratív betegségek genetikai háttere 1. Betegség Mutáns Gének 1. Alzheimer kór App, ps-1, ps-2, apoe e4, tau, Gsk-3ß, ChAT, MTHFR 2 of :18

3 3. Táblázat: A neurodegeneratív betegségek genetikai háttere 2. A tisztán öröklött génhibán alapuló neurodegenerációs kórkép viszonylag ritka, ilyen pl. a Huntigton-kór, amelynél egy poliglutamin-peptidlánc (egy CAG triplett ismétlődése miatt fellépő rendellenesség) aggregációja váltja ki az idegsejtek halálát. Ismerünk egy sorozat pontmutációt az a-synuclein génben, amelyek kiváltják a familiáris Parkinson-kórt, illetve a Lewy-testes demenciát. A neuronok mikrotubuláris rendszeréhez kapcsolódó tau-fehérjék génjének pontmutációi abnormális hiperfoszforilációt idéznek elő, emiatt a mikrotubuláris rendszer széthull, s ez nagymértékben hozzájárul a sejt halálához. Az igen intenzív kutatómunka ellenére még sok esetben nem tisztázott a neurodegeneratív betegségek genetikai háttere. Az Alzheimer-kór a leggyakoribb demenciás kórkép, a memóriavesztéses betegségeknek több mint 50%-áért felelős. A korai jelentkezésű (a életév között fellépő) familiáris Alzheimerdemencia (AD) előfordulása 5% alatt van. Az öröklődő betegségért néhány fehérje (pl. amiloid prekurzor protein, presenilin-1 és 2, tau-fehérje) mutációi a felelősek, ezek a mutációk jól ismertek, de igen ritkák. A mutációk az 1, 12, 14, 19 és 21. kromoszómában lépnek fel (4. táblázat). Az Alzheimer-kór genetikai alapjáról Cacabelos írt részletes összefoglalót (1999). Kromoszóma Gén Jelentőség Korkezdet 1 presenilin-2 (PS2) 1q Korai familiáris AD, autoszom. domináns a 2 -makroglobulin késői AD >75 LRP1 14 presenilin- 1(PS1) 14q 24.3, c-fos, 14q korai familiáris AD autoszom.domináns >40 19 APO-E e4 késői familiáris AD >55 19q amiloid prekurzor protein 21q korai familiáris AD, autoszom. domináns >50 4. Táblázat: Az Alzheimer-kór genetikája: familiáris formák A viszonylag ritka mutációk mellett az Alzheimer-kór gyakori és komoly rizikófaktora az apo-e fehérje polimorfizmusa (Tariska, 2000). Ez a fehérje 299 aminosavból áll, főleg a lipidek transzportjáért és anyagcseréjéért felelős. 3 különböző allélje van (e2, e3 és e4), amelyek csak 1-1 pontmutációban különböznek egymástól, így egy vagy két aminosav különbséget találunk a polipeptid láncban (5. táblázat). Az e2 allélnek megfelelő fehérje (Cys 112, Cys 158) inkább 3 of :18

4 védő hatású, viszont az e4 allélok (Arg 112, Arg 158) jelenléte 17-szeresére növeli az Alzheimer-kór fellépésének gyakoriságát. Az eddigi vizsgálatok szerint az AD-esetek 15-20%-áért az apo-e e4 allél jelenléte a felelős hely 158. hely APOE allél Triplet Aminosav Triplet Aminosav e2 TGC Cys TGC Cys e3 TGC Cys CGC Arg e4 CGC Arg CGC Arg 5. Táblázat: Az apo-e gén polimorfizmusa mint az Alzheimer-kór kiváltó oka Ha valamennyi ma ismert genetikai faktort összeadunk, azt találjuk, hogy az Alzheimer demenciák 20-25%-át genetikai tényezők váltják ki. A késői kezdésű (65. életév után jelentkező) AD-k legnagyobb részénél nem ismerjük a kiváló okokat. A betegség többtényezős, multifaktoriális eredetűnek látszik. A neurotoxikus b-amiloidok szintéziséért, ill. lebontásáért felelős proteázok egyensúlyának zavara, a szabad gyökök megkötéséért felelős enzimek alulműködése, az idegsejtekben folyó ATP-termelés csökkenése, a vér-agy gát permeábilitás megnövekedése egyaránt hozzájárulhatnak a betegség kialakulásához. Magyarországon az Alzheimer-kór különösen gyakran társul vaszkuláris eredetű demenciával; az agyi erek szklerózisa az Alzheimer-kór egyik rizikófaktora. Bizonyos vaszkuláris faktorok változása (pl. magas vérnyomás, az agyi kapillárisok állapota, stb) fontos kóroki tényező lehet. A legújabb kutatások kiderítették, hogy az Alzheimer-kór kialakulása igen hosszú folyamat (15-20 év), emiatt igen valószínű, hogy a középkorú populáció ( év) kezeletlen magas vérnyomásos betegeinél nagymértékben megemelkedik az AD kockázata. Komoly kockázati tényező az életkor előrehaladása, az elszenvedett koponyatraumák és a tartós oxigénhiány. 3. A leggyakoribb neurodegenerációs betegség, az Alzheimer-kór morfopatológiája, biokémiája és kialakulásának mechanizmusa Az Alzheimer-demenciát Alois Alzheimer már 1907-ben leírta és a következő jellemzőit sorolta fel: az agyszövet nagyfokú atrófiája; amiloid plakkok kialakulása bizonyos agyterületeken, ill. neurofibrilláris kötegek megjelenése. A betegség elsősorban a szinapszisok és a kolinerg neuronok pusztulásával jár (Selkoe 1991). Feltűnő a neuronok mitokondriumainak sérülése, elfajulása. Ez komoly ATP-hiányt okoz, többen ezt tartják az idegsejt pusztulás végső okának. Az igazi okokat azonban jóval korábbi lépéseknél kell keresni. Nagyon sokan vizsgálták a (csak mikroszkóppal látható) amiloid plakkok szerkezetét és összetételét. A betegség előrehaladásával a plakkok is változnak: a kezdetben diffúz plakk több lépésben szenilis plakká alakul, közepén keményítőszerűen festődő maggal (innen jön az amiloid név). A mag kissé szivacsos állományú és főleg b-amiloid peptideket, tau-fehérjét, lipofuscint és más anyagokat tartalmaz. Bizonyos festékek (pl. Kongóvörös, tioflavin) specifikusan kötődnek a b-amiloidokhoz, ennek az a magyarázata, hogy a plakkokban a polipeptidek ún. b-redőzött réteg vagy b-szalag szerkezetet vesznek fel. Ezek egymáshoz kapcsolódnak, aggregálódnak és hosszú fibrillumokat alakítanak ki. Az amiloid aggregátumok neurotoxikus hatásúak: a plakk közelében húzódó, a plakk magjával érintkező axonok degenerációját indítják el. (A sejttest sokkal kevésbé érzékeny a b-amiloid aggregátumokra). A betegség előrehaladásával, súlyosodásával szinte egyenes arányban nő az elhalt idegsejtekből 4 of :18

5 képződő neurofibrilláris kötegek mennyisége, ezeket főleg a már említett abnormálisan foszforilezett (túl sok foszfátészter-csoportot tartalmazó) tau-fehérjék alkotják. Az amiloid plakkok száma nem áll mindig arányban a betegség súlyosságával. Az Alzheimer-kór az öregkor betegsége, de ritka esetben fiatalabb korban is jelentkezik. Évtizedes vita után el kell fogadnunk, hogy a betegséget a b-amiloid peptidek túltermelődése, aggregációja váltja ki, ez az indító lépés. (Ez nem áll ellentétben azzal a ténnyel, hogy bizonyos tau-fehérje mutációk b-amiloid képződés nélkül is neurodegenerációhoz vezetnek, a tau-fehérjék hiperfoszforilezése révén. Ezt a betegséget a plakkok hiánya miatt nem tekinthetjük Alzheimer-kórnak). A fiatalabb korban, a életév között jelentkező Alzheimer-kórt főleg az amiloid prekurzor protein (APP) és a presenilinek mutációi idézik elő (4. táblázat): ezek hatására az APP-ből nagy mennyiségű, igen könnyen aggregálódó neurotoxikus peptid képződik. Az APP egy sejtadhéziós fehérje, a szinaptikus membránokban van jelen nagy koncentrációban, pontos biológiai szerepét nem ismerjük. Különböző molekuláris formái vannak: a neuronokban a 695 aminosavas, a glia sejtekben a 751 ill. 770 aminosavas forma fordul elő (Tanzi, 1988). A központi idegrendszert ért traumák hatására az APP nagy mennyiségben szabadul fel. Állandóan ismétlődő agyi traumák ill. hipoxia hatására sok APP termelődik, ez nagyfokú b-amiloid képződést okoz. Ezzel magyarázzák a boxolók dementia pugilisticaját, de a gyakori hipoxiás állapotba kerülő sportolók (hegymászók ill. búvárok) korai demenciáját is. Az idegsejtek elhalásának pontos mechanizmusát még nem sikerült teljesen igazolni Alzheimer-kór esetén. Sejtszinten, molekuláris szinten a következő lépésekben képzeljük el a betegség kialakulását az amiloid-kaszkád hipotézis alapján (Hardy, 1992). 1. Kisebb-nagyobb agyi traumák, hipoxia, esetleg genetikai faktorok APP túltermelődéshez vezetnek, a prekurzorból a normálisnál nagyobb mennyiségű b-amiloid peptid képződik. Idősebb korban ezt elősegíti a lebontó proteázok csökkent működése is. 2. A sejtek felszínén, az extracelluláris térben a b-amiloid peptidek neurotoxikus aggregátumokat képeznek (Lambert, 1998). Ezek különböző nagyságúak, a kisméretű, diffúzibilis aggregátumoktól a hosszú szálakig sokféle forma előfordulhat, de valamennyi forma toxikus. (Maguk a monomer b-amiloidok nem toxikusak.) 3. A b-amiloid aggregátumok megkötődnek az idegsejtek membránfehérjéin. Valószínű, hogy a b-amiloid aggregátumnak klasszikus értelemben nincs receptora, hanem többféle fehérjén meg tud kötődni. (Van olyan vélemény, hogy a b-amiloid aggregátum számára minden membránfehérje kötőhely, de ezt a kísérletek nem igazolják). A fehérjék egy része G-proteinnel kapcsolt receptor. 4. A b-amiloid-membránfehérje kötődés hatására Ca 2+ ionok áramlanak be a sejtbe. Igazolt, hogy az amiloid peptidek megkötődnek az NMDA-receptoron, az integrin-receptorok bizonyos típusain, az APP-n, a RAGE-receptoron, stb. Mivel az amiloid aggregátum enzimrezisztens és tartósan ott marad a membránon, a Ca 2+ -beáramlás állandósul. 5. A Ca 2+ -jel aktiválja a protein kinázokat (pl. Cdk5, GSK3 b) és megkezdődik a mikrotubuláris-rendszert alkotó tau-fehérjék abnormális helyen történő foszforilezése (hiperfoszforileződés). Eltolódik a foszforilázfoszfatáz enzimegyensúly, az abnormális tau-fehérjék nem képesek a mikrotubulusok szervezésére, a szerkezet összeomlik. A hiperfoszforilezett tau-fehérjék lassan neurofibrilláris kötegekké aggregálódnak. 5 of :18

6 6. A megemelkedett Ca 2+ -szint egyedül is elegendő a mitokondriumok károsításához. A kettős membrán felszakad, a sejtlégzés és az ATP képződés leáll, nagy mennyiségű szabad gyök képződik. A mitokondiumból kiszabaduló faktorok (apoptózis indukáló faktor, citokróm-c) beindítják a neuron elhalását. 7. Az axonok is központi szerepet játszanak a neurodegenerációban. A mikrotubuláris rendszer összeomlásával megszűnik az axonális transzport. A neuron lassan elveszíti dendritjeit és axonját, legömbölyödik (dezarborizáció, vezikularizáció) és lassan elhal. 4. Az Alzheimer-kór kezelése, megelőzések lehetőségei Az elhalt neuronokat már nem lehet visszahozni, viszont a patomechanizmus ismeretében ma már nem reménytelen a betegség kezelése és a racionális gyógyszertervezés. A kolinerg rendszer részleges kiesését, az acetilkolin-szint csökkenését kolinészteráz-gátlókkal próbálják kivédeni, ez természetesen csak tüneti kezelést jelent. Újabb kezelési lehetőség a Memantine (dimetil-amantadin) alkalmazása. Ez a gyógyszer bekötődik az NMDA-receptor ioncsatornájába és megakadályozza a Ca 2+ -beáramlást. A szakirodalom igen jó eredményekről számol be: ha az idegsejtek még nem haltak el, csak fojtogatja őket az amiloid aggregátum, a Ca 2+ -beáramlás megakadályozásával ezek a sejtek felélednek, visszanyerik működőképességüket és Memantine hatására a betegek állapota javul. A szakirodalom részletesen beszámol a reaktív szabad gyököket eltakarító anyagok (C-vitamin, E-vitamin, flavonoidok) kedvező hatásáról is. Ezek mellett a szteroid-hormonok szerepével, hatásmechanizmusával is sokan foglalkoznak. Az Alzheimer-kutatás legújabb iránya abból indul ki, hogy a ß-amiloid peptidek központi szerepet töltenek be a betegség kialakulásában, ezek keletkezését, aggregációját ill. sejtmembránhoz való kapcsolódását kell megakadályozni. A ß-amiloid peptidek képződésének gátlása A prekurzor fehérje lebontásában 3 enzim játszik kulcsszerepet: az a-, b- és g-szekretáz. Ha az a-szekretáz hasít, az APP-ből vízoldható, nem toxikus peptidek sokasága képződik. Mindig van lehetőség viszont az alternatív hasításra: a b-szekretáz, majd g-szekretáz működése olyan, aminosavból álló peptideket hasít ki az APP-ből, amelyek igen könnyen aggregálódnak s emiatt neurotoxikusak (b-amiloidok). A b-amiloid monomerek kis mennyiségben mindig képződnek és neuromodulátor hatásúak: csökkentik a kolinerg-receptorok ingerelhetőségét. Az alternatív hasítás csak akkor veszélyes, ha nagy mennyiségű b-amiloidot termel és ez aggregálódik. Megfelelő enzimgátlókkal a b-amiloid képzés csökkenthető és (elvileg) a kór előrehaladása megakadályozható. A b-szekretáz egy aszpartil-proteáz (Vassar, 1999), Röntgen-diffrakciós szerkezete ismert. Számos laboratóriumban (így nálunk is) folyik a specifikus b-szekretáz inhibitorok számítógépes tervezése és szintézise. Úgy tűnik, a b-szekretáz gátlása nem okoz különös mellékhatásokat kísérleti állatokon. A g-szekretáz szintén aszpartil-proteáz, egy bonyolult membránfehérje-komplex. Az az érdekessége, hogy a polipeptidláncot éppen a membrán belsejében középen hasítja, az APP-transzmembrán régiójában. A g-szekretáz Röntgen-diffrakciós szerkezete nem ismert, ennek ellenére számos inhibitorát ismerjük a szakirodalomból. A sejtmembrán lipid összetétele nagymértékben befolyásolja a b- és g-szekretázok aktivitását. Nagy mennyiségű koleszterin jelenléte a membránban növeli a b- és g-szekretáz aktivitását, így a koleszterin bioszintézist gátló gyógyszerek (Lovastatin, Mevastatin, stb.) jó hatással lehetnek 6 of :18

7 Alzheimer-kórban. Ugyanakkor a többszörösen telítetlen w-3 zsírsavak (dokoza-hexaénsav, C22:6, DHA és eikozapentaénsav, C20:5, EPA) jelenléte a membránban csökkenti a b- és g-szekretáz aktivitást és a keletkező b-amiloidok mennyiségét. Intenzív kutatómunka folyik olyan diéta kidolgozására, amelyik többszörösen telítetlen zsírsavak bevitelével akadályozza meg az Alzheimer-kór kialakulását, illetve lassítja le a betegség előrehaladását. A b-amiloidok aggregációja és toxicitása A b-amiloidok aggregációja az Alzheimer-kór fontos rizikófaktora. Megvizsgáltuk, hogyan függ össze az amiloid peptidek szerkezete, aggregációs képessége és neurotoxicitása. Az aggregációt FT-IR spektroszkópiával követtük nyomon, a neurotoxicitást differenciált SH-SY5Y neuroblasztóma tenyészeten MTT-teszttel mértük. (A teszt a sejtek életképességét, redukciós potenciálját méri, egy tetrazolfesték formazánná történő redukciós átalakulásával). Megmértük a különböző lánchosszúságú b-amiloid peptidek, valamint a csupán D-aminosavat tartalmazó peptidek, illetve a fordított (reverz) aminosav-sorrendű analógok aggregációs készségét és toxicitását. Az eredményeket az 1. és a 2. ábra mutatja. Szekvencia Aggregáció Toxicitás 1. Ab Ab Ab Ab csupa D-Ab reverz Ab (42-1) 7. reverz Ab (35-25) 1. ábra: Amiloid peptidek aggregációja és toxicitása. 7 of :18

8 2. ábra: Ab-peptidek toxicitása MTT-teszten Az Ab-peptidek toxicitása jó korrelációban van az aggregációjukkal. Néhány kis Ab-fragmens is toxikus (25-35, 31-35). A csupán D-aminosavakból felépülő Ab 1-40 is toxikus, mivel gyorsan aggregálódik. Ezzel szemben a fordított sorrendű Ab 42-1 nem képez aggregátumokat és alacsony toxicitást mutat. Toxikus amiloid-aggregátumok képződésének megakadályozása A b-amiloid polipeptid láncához különböző típusú vegyületek kapcsolódhatnak ionos kötéssel ill. másodlagos kötésekkel. Az ilyen vegyületek megakadályozzák a peptidlánc aggregációját és elvileg alkalmasak lehetnek az Alzheimer-kór kezelésére. Ezeket az anyagokat összefoglaló néven b-szerkezetrombolóknak (b-sheet-breaker) nevezzük. Legismertebb ezek közül az azofesték jellegű Kongóvörös. Tjernberg (1996), majd később Soto (1996) kutatócsoportja ismerte fel, hogy a b-amiloid 16-20, ill pentapeptid részlete megakadályozza az aggregációt. Számos módosított b-szerkezetromboló peptidet állítottak elő, ezek közül a legismertebb a Leu-Pro-Phe-Phe-Asp pentapeptid. Kutatócsoportunkban számítógépes molekulatervezéssel, a b-amiloid peptidlánc felszínére történő illesztéssel (dokkolás, AUTODOCK-program) kerestünk olyan peptideket, amelyek viszonylag erős kötéssel illeszkednek az amiloidhoz és megakadályozzák az aggregációt (3. ábra). Ezeket szintetikusan is előállítottuk, majd in vivo és in vitro tesztekben megvizsgáltuk a szintetikus peptidek neuroprotektív hatását. A következő vegyületek bizonyultak legjobbnak: Leu-Pro-Tyr-Phe-Asp Arg-Val-Val-Ile-Ala Ezek a vegyületek önmagukban is potenciális gyógyszerek. A vér-agy gáton áthaladó, enzimrezisztens analógok és peptidomimetikumok tervezése és szintézise szintén megkezdődött. A dokkolás egyik lehetőségét a 3. ábra mutatja be. 3. ábra: A Lys-Leu-Val-Phe-Ale-amid dokkolása az Aß 1-42 peptidre Az aggregált amiloid és a membránfehérjék közötti kötődést gátló neuroprotektív anyagok: funkcionális antagonisták Még évekkel ezelőtt azt találtuk, hogy a b-amiloid egy rövid fragmense, az Ile-Ile-Gly-Leu tetrapeptid-amid és származékai megakadályozzák a b-amiloid peptidek neurotoxikus 8 of :18

9 hatásának kifejlődését (Laskay, 1997). Mivel ezek a peptidek nem b-szerkezetrombolók, feltételeztük, oly módon hatnak, hogy megakadályozzák az aggregátumok kötődését a membránfehérjéken, így a Ca 2+ -ionok beáramlását és az azt követő apoptózishoz vezető biokémiai folyamatokat. A vizsgálatok igazolták ezt az elképzelést, így erre a vegyületcsoportra egy új nevet kellett bevezetnünk: ezek az ún. ASBIM (Amyloid Surface Binding Molecule) vegyületek. In vitro és in vivo tesztekben a következő peptidek bizonyultak legjobbnak: propionil-ile-ile-gly-leu-amid Arg-Ile-Ile-Gly-Leu-amid Phe-Arg-His-Asp-Ser-amid Ezek a vegyületek a b-amiloidok funkcionális antagonistáinak tekinthetők. Valamennyi peptid tartalmaz b-amiloid szekvencia részletet. Az utolsó két vegyület ún. RGD analóg, tehát az integrin-fehérjékhez kötődve is kifejtheti hatását. Ezek a vegyületek vezérvegyületként szolgálnak olyan enzimrezisztens, a vér-agy gáton áthaladó peptidomimetikumok tervezéséhez és szintéziséhez, amelyek az Alzheimer-kór igazi gyógyszerei lehetnek. Összefoglalva: az Alzheimer-kór patomechanizmusának ismeretében új utak nyíltak a gyógyszertervezés előtt: enzimgátlók, b-szerkezetrombolók és a membránfehérje aggregált amiloid kölcsönhatást gátló vegyületek lehetnek a jövő potenciális gyógyszerei. Valószínű, hogy a fehérjeaggregátumok keletkezését és toxicitását megakadályozó vegyületek alkalmazásának alapelve kiterjeszthető a többi neurodegeneratív betegség megelőzésére is. Irodalom Cacabelos, R.: Association of genetic risk factors in Alzheimer s disease. In: Iqbal, K. (ed) Alzheimer s Disease and Related Disorders Wiley, Chichester. (1999) 93. p. Hardy, J. A, Higgins, G.A.: Alzheimer s disease: the amyloid cascade hypothesis. Science 256 (1992) 184. p. Lambert, M. P., Finch, C. E., Krafft, G. A., Klein, W. L.: Diffusible, nonfibrillar ligand derived from Aß 1-42 are potent central nervous system neurotoxins. Proc. Nat. Acad. Sci. USA 95 (1998) p. Laskay, G., Zarándi, M., Varga, J., Jost, K., Fónagy, A., Torday, C., Latzkovits, L., Penke, B.: A putative tetrapeptide antagonist prevents ß-amyloid induced long-term elevation of [Ca 2+ ] i. Biochem. Biophys. Res. Commun. 235 (1997) 479. p. Mager, P.P., Penke, B., Walter, R., Harkány, T. and Härtig, W.: Pathological Peptide Folding in Alzheimer s Disease and Other Conformational Disorders. Current Medicinal Chemistry 9 (2002) p. Selkoe D. J.: The molecular pathology of Alzheimer s disease. Neuron 6 (1991) 487. p. Soto, C., Kindy, M. S., Baumann, M., Frangione, B.: Inhibition of Alzheimer s amyloidosis by peptides that prevent ß-sheet conformation. Biochem. Biophys. Res. Comm. 226 (1996) 672. p. Tanzi R. E., McClatchey A. I., Lamperti E. D., Villa-Komaroff L., Gusella J. F., Neve R. L.: Protease inhibitor domain encoded by an amyloid protein precursor mrna associated with Alzheimer s disease. Nature 331 (1988) 528. p. Tariska, P.: Alzheimer kór. Golden Book, Budapest (2000) 9 of :18

10 Tjernberg, L. O., Naslund, J., Lindquist, F., Johansson, J., Karlstrom, A. L., Thyberg, J., Terenius, L., Nordstedt, C.: Arrest of ß-amyloid fibril formation by a pentapeptide ligand. J. Biol. Chem. 271 (1996) p. Vassar, R.: ß-secretase cleavage of Alzheimer s amyloid precursor protein by the transmembrane aspartic protease BACE. Science 285 (1999) 735. p. < 10 of :18

Az agy betegségeinek molekuláris biológiája. 1. Prion betegség 2. Trinukleotid ripít betegségek 3. ALS 4. Parkinson kór 5.

Az agy betegségeinek molekuláris biológiája. 1. Prion betegség 2. Trinukleotid ripít betegségek 3. ALS 4. Parkinson kór 5. Az agy betegségeinek molekuláris biológiája 1. Prion betegség 2. Trinukleotid ripít betegségek 3. ALS 4. Parkinson kór 5. Alzheimer kór 28 Prion betegség A prion betegség fertőző formáját nem egy genetikai


Új szignalizációs utak a prodromális fázisban. Oláh Zita

Új szignalizációs utak a prodromális fázisban. Oláh Zita Új szignalizációs utak a prodromális fázisban Oláh Zita 2015.10.07 Prodromális fázis Prodromalis fázis: De mi történik?? Beta-amiloid: OK vagy OKOZAT? Beta-amiloid hogyan okozhat neurodegenerációt? Tau


Primer demenciák, Parkinson-kór és Parkinson plusz szindrómák diagnosztikus és terápiás kérdései

Primer demenciák, Parkinson-kór és Parkinson plusz szindrómák diagnosztikus és terápiás kérdései Primer demenciák, Parkinson-kór és Parkinson plusz szindrómák diagnosztikus és terápiás kérdései Prof. Komoly Sámuel MTA doktora PTE Neurológiai Klinika igazgatója Demenciákról általában Progresszív memóriazavar


Az agy betegségeinek molekuláris biológiája

Az agy betegségeinek molekuláris biológiája 1 2. Az Agy Betegségei Az agy betegségeinek molekuláris biológiája 5. Prion betegség DIA 1, 2 A prion betegség emberben és állatokban is előfordul. (A) Emberi prion betegségek: Creutzfeld-Jakob betegség


Részletes kutatási jelentés. 1/ A szintetikus Aβ-aggregátumok jellemzése

Részletes kutatási jelentés. 1/ A szintetikus Aβ-aggregátumok jellemzése Részletes kutatási jelentés A 4 éves projekt a következő célkitűzésekkel indult: 1, Szintetikus, neurotoxikus Aβ-peptid aggregátumok előállítása és sokoldalú fizikokémiai jellemzése. 2, Az Aβ oligomerekkel,


A Hsp27 neuroprotektív szerepének tanulmányozása transzgenikus egerekben

A Hsp27 neuroprotektív szerepének tanulmányozása transzgenikus egerekben A DOKTORI ÉRTEKEZÉS TÉZISEI A Hsp27 neuroprotektív szerepének tanulmányozása transzgenikus egerekben TÓTH ERZSÉBET MELINDA Témavezető: Dr. Sántha Miklós MTA Szegedi Biológiai Kutatóközpont Biokémiai Intézet


Molekuláris biológia, genetika, orvostudomány

Molekuláris biológia, genetika, orvostudomány Molekuláris biológia, genetika, orvostudomány Penke Botond SZTE KUTATÓEGYETEMI KIVÁLÓSÁGI KÖZPONT TÁMOP 4.2.1.B Konv. 3. Alprogram 2012. Február 16. 3. Molekuláris biológia, genetika, orvostudomány Alprogram



AMIT A DEMENCIÁRÓL TUDNI ÉRDEMES AMIT A DEMENCIÁRÓL TUDNI ÉRDEMES Összeállította: Reményi Viktória Mi a demencia? A latin eredetű demencia kifejezés szó szerint "ész, értelem nélküli állapotot" jelent, a szellemi képesség olyan mértékű


Farmakológus szakasszisztens Farmakológus szakasszisztens 2/34

Farmakológus szakasszisztens Farmakológus szakasszisztens 2/34 -06 Farmakológus szakasszisztens feladatok A 0/007 (II. 7.) SzMM rendelettel módosított /006 (II. 7.) OM rendelet Országos Képzési Jegyzékről és az Országos Képzési Jegyzékbe történő felvétel és törlés


11. Dr. House. Biokémiai és sejtbiológiai módszerek alkalmazása az orvoslásban

11. Dr. House. Biokémiai és sejtbiológiai módszerek alkalmazása az orvoslásban 11. Dr. House. Biokémiai és sejtbiológiai módszerek alkalmazása az orvoslásban HIV fertőzés kimutatása (fiktív) esettanulmány 35 éves nő, HIV fertőzöttség gyanúja. Két partner az elmúlt időszakban. Fertőzött-e


TDK lehetőségek az MTA TTK Enzimológiai Intézetben

TDK lehetőségek az MTA TTK Enzimológiai Intézetben TDK lehetőségek az MTA TTK Enzimológiai Intézetben Vértessy G. Beáta egyetemi tanár TDK mind 1-3 helyezettek OTDK Pro Scientia különdíj 1 második díj Diákjaink Eredményei Zsűri különdíj 2 első díj OTDK


Egy idegsejt működése

Egy idegsejt működése 2a. Nyugalmi potenciál Egy idegsejt működése A nyugalmi potenciál (feszültség) egy nem stimulált ingerelhető sejt (neuron, izom, vagy szívizom sejt) membrán potenciálját jelenti. A membránpotenciál a plazmamembrán


Gyógyszerészeti neurobiológia. Idegélettan

Gyógyszerészeti neurobiológia. Idegélettan Az idegrendszert felépítő sejtek szerepe Gyógyszerészeti neurobiológia. Idegélettan Neuronok, gliasejtek és a kémiai szinapszisok működési sajátságai Neuronok Információkezelés Felvétel Továbbítás Feldolgozás


Az anti-apoptózis mechanizmus vizsgálata agyi ischaemia/hypoxia modellekben

Az anti-apoptózis mechanizmus vizsgálata agyi ischaemia/hypoxia modellekben OTKA T-037887 zárójelentés Az anti-apoptózis mechanizmus vizsgálata agyi ischaemia/hypoxia modellekben Az ischaemias stroke-ot követően az elzáródott ér ellátási területének centrumában percek, órák alatt



TRANSZPORTFOLYAMATOK A SEJTEKBEN 16 A sejtek felépítése és mûködése TRANSZPORTFOLYAMATOK A SEJTEKBEN 1. Sejtmembrán elektronmikroszkópos felvétele mitokondrium (energiatermelõ és lebontó folyamatok) citoplazma (fehérjeszintézis, anyag


A zsírszövet mellett az agyvelő lipidekben leggazdagabb szervünk. Pontosabban az agy igen gazdag hosszú szénláncú politelítetlen zsírsavakban

A zsírszövet mellett az agyvelő lipidekben leggazdagabb szervünk. Pontosabban az agy igen gazdag hosszú szénláncú politelítetlen zsírsavakban BEVEZETÉS ÉS A KUTATÁS CÉLJA A zsírszövet mellett az agyvelő lipidekben leggazdagabb szervünk. Pontosabban az agy igen gazdag hosszú szénláncú politelítetlen zsírsavakban (LCPUFA), mint az arachidonsav


Lipidek anyagcseréje és az ateroszklerózis (érelmeszesedés)

Lipidek anyagcseréje és az ateroszklerózis (érelmeszesedés) Lipidek anyagcseréje és az ateroszklerózis (érelmeszesedés) Rácz Olivér Miskolci Egyetem Egészségügyi Kar 22.9.2009 ateromisk.ppt 1 Az érelmeszesedés csak a XIX. évszázad második felétől orvosi probléma


A génterápia genetikai anyag bejuttatatása diszfunkcionálisan működő sejtekbe abból a célból, hogy a hibát kijavítsuk.

A génterápia genetikai anyag bejuttatatása diszfunkcionálisan működő sejtekbe abból a célból, hogy a hibát kijavítsuk. A génterápia genetikai anyag bejuttatatása diszfunkcionálisan működő sejtekbe abból a célból, hogy a hibát kijavítsuk. A genetikai betegségek mellett, génterápia alkalmazható szerzett betegségek, mint


Hiperlipidémia okozta neurodegeneratív és vér-agy gát-elváltozások ApoB-100 transzgenikus egerekben

Hiperlipidémia okozta neurodegeneratív és vér-agy gát-elváltozások ApoB-100 transzgenikus egerekben Hiperlipidémia okozta neurodegeneratív és vér-agy gát-elváltozások ApoB-100 transzgenikus egerekben Lénárt Nikolett Doktori (Ph. D.) értekezés tézisei Témavezető: Dr. Sántha Miklós tudományos főmunkatárs


A sejtmembrán szabályozó szerepe fiziológiás körülmények között és kóros állapotokban

A sejtmembrán szabályozó szerepe fiziológiás körülmények között és kóros állapotokban A sejtmembrán szabályozó szerepe fiziológiás körülmények között és kóros állapotokban 17. Központi idegrendszeri neuronok ingerületi folyamatai és szinaptikus összeköttetései 18. A kalciumháztartás zavaraira


A citoszol szolubilis fehérjéi. A citoplazma matrix (citoszol) Caspase /Kaszpáz/ 1. Enzimek. - Organellumok nélküli citoplazma

A citoszol szolubilis fehérjéi. A citoplazma matrix (citoszol) Caspase /Kaszpáz/ 1. Enzimek. - Organellumok nélküli citoplazma A citoplazma matrix (citoszol) A citoszol szolubilis fehérjéi 1. Enzimek - Organellumok nélküli citoplazma -A sejt fejlődéstani szempontból legősibb része (a sejthártyával együtt) Glikolízis teljes enzimrendszere


Dózis-válasz görbe A dózis válasz kapcsolat ábrázolása a legáltalánosabb módja annak, hogy bemutassunk eredményeket a tudományban vagy a klinikai

Dózis-válasz görbe A dózis válasz kapcsolat ábrázolása a legáltalánosabb módja annak, hogy bemutassunk eredményeket a tudományban vagy a klinikai Dózis-válasz görbe A dózis válasz kapcsolat ábrázolása a legáltalánosabb módja annak, hogy bemutassunk eredményeket a tudományban vagy a klinikai gyakorlatban. Például egy kísérletben növekvő mennyiségű


MEDICINÁLIS ALAPISMERETEK AZ ÉLŐ SZERVEZETEK KÉMIAI ÉPÍTŐKÖVEI A LIPIDEK 1. kulcsszó cím: A lipidek szerepe az emberi szervezetben

MEDICINÁLIS ALAPISMERETEK AZ ÉLŐ SZERVEZETEK KÉMIAI ÉPÍTŐKÖVEI A LIPIDEK 1. kulcsszó cím: A lipidek szerepe az emberi szervezetben Modul cím: MEDICINÁLIS ALAPISMERETEK AZ ÉLŐ SZERVEZETEK KÉMIAI ÉPÍTŐKÖVEI A LIPIDEK 1. kulcsszó cím: A lipidek szerepe az emberi szervezetben Tartalék energiaforrás, membránstruktúra alkotása, mechanikai


A flavonoidok az emberi szervezet számára elengedhetetlenül szükségesek, akárcsak a vitaminok, vagy az ásványi anyagok.

A flavonoidok az emberi szervezet számára elengedhetetlenül szükségesek, akárcsak a vitaminok, vagy az ásványi anyagok. Amit a FLAVIN 7 -ről és a flavonoidokról még tudni kell... A FLAVIN 7 gyümölcsök flavonoid és más növényi antioxidánsok koncentrátuma, amely speciális molekulaszeparációs eljárással hét féle gyümölcsből


Pákáski Magdolna. SZTE, ÁOK, Pszichiátriai Klinika

Pákáski Magdolna. SZTE, ÁOK, Pszichiátriai Klinika Pákáski Magdolna SZTE, ÁOK, Pszichiátriai Klinika 5%, autoszomális domináns öröklésmenet Korai kezdetű AK (early onset Alzheimer s disease = EOAD: 65 év alatt Gén Kromoszóma Mutációk száma Amyloid prekurzor


Evolúcióelmélet és az evolúció mechanizmusai

Evolúcióelmélet és az evolúció mechanizmusai Evolúcióelmélet és az evolúció mechanizmusai Az élet Darwini szemlélete Melyek az evolúció bizonyítékai a világban? EVOLÚCIÓ: VÁLTOZATOSSÁG Mutáció Horizontális géntranszfer Genetikai rekombináció Rekombináció



A NEURODEGENERATÍV BETEGSÉGEK GYÓGYSZERTANA. Tábi Tamás Gyógyszerhatástani Intézet Semmelweis Egyetem OKTATÁSI SEGÉDANYAG A NEURODEGENERATÍV BETEGSÉGEK GYÓGYSZERTANA Tábi Tamás Gyógyszerhatástani Intézet Semmelweis Egyetem NEURODEGENERATÍV BETEGSÉGEK JELLEMZŐK: Neuron pusztulás a KIR-ben. Egy speciális populáció károsodása



NAPJAINK KOORDINÁCIÓS KÉMIÁJA II * MAGYAR TUDOMÁYOS AKADÉMIA K É M I A I T U D O M Á Y O K O S Z T Á L Y A E L Ö K APJAIK KOORDIÁCIÓS KÉMIÁJA II * Tisztelt Kolléga! A Koordinációs Kémiai Munkabizottság idei első ülésére 2016. május 31-n


Kutatási beszámoló ( )

Kutatási beszámoló ( ) Kutatási beszámoló (2008-2012) A thrombocyták aktivációja alapvető jelentőségű a thrombotikus betegségek kialakulása szempontjából. A pályázat során ezen aktivációs folyamatok mechanizmusait vizsgáltuk.


A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin.

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin. Myoglobin Fehérje-szerkezetek! MGLSDGEWQLVLNVWGKVEADIPGGQEVLIRLFK GPETLEKFDKFKLKSEDEMKASE DLKKGATVLTALGGILKKKGEAEIKPLAQSA TKKIPVKYLEFISECIIQVLQSK PGDFGADAQGAMNKALELFRKDMASNYKELGFQG Fuxreiter Mónika! Debreceni


Új terápiás lehetőségek (receptorok) a kardiológiában

Új terápiás lehetőségek (receptorok) a kardiológiában Új terápiás lehetőségek (receptorok) a kardiológiában Édes István Kardiológiai Intézet, Debreceni Egyetem Kardiomiociták Ca 2+ anyagcseréje és új terápiás receptorok 2. 1. 3. 6. 6. 7. 4. 5. 8. 9. Ca


Dementiák biomarkerei. Oláh Zita 2015. November 11.

Dementiák biomarkerei. Oláh Zita 2015. November 11. Dementiák biomarkerei Oláh Zita 2015. November 11. Mi a biomarker? A biomarkerek biológiai paraméterek, amelyek normális és kóros folyamatokat, beavatkozásokra adott válaszokat jeleznek, továbbá objektív


MAGYAR TUDOMÁNY ÜNNEPE. Penke Botond, Szegedi Tudományegyetem, Orvosi Vegytani Intézet. 2012. november 8.

MAGYAR TUDOMÁNY ÜNNEPE. Penke Botond, Szegedi Tudományegyetem, Orvosi Vegytani Intézet. 2012. november 8. NAGY STABILITÁSÚ TOXIKUS FEHÉRJESZERKEZETEK A NEURODEGENERATÍV BETEGSÉGEKBEN: PRIONOK ÉS AMILOIDOK MAGYAR TUDOMÁNY ÜNNEPE Penke Botond, Szegedi Tudományegyetem, Orvosi Vegytani Intézet 2012. november 8.


K68464 OTKA pályázat szakmai zárójelentés

K68464 OTKA pályázat szakmai zárójelentés K68464 OTKA pályázat szakmai zárójelentés A fehérjeaggregáció és amiloidképződés szerkezeti alapjai; a különféle morfológiájú aggregátumok kialakulásának körülményei és in vivo hatásuk vizsgálata Vezető


Receptorok és szignalizációs mechanizmusok

Receptorok és szignalizációs mechanizmusok Molekuláris sejtbiológia: Receptorok és szignalizációs mechanizmusok Dr. habil Kőhidai László Semmelweis Egyetem Genetikai, Sejt- és Immunbiológiai Intézet Sejtek szignalizációs kapcsolatai Sejtek szignalizációs


FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest,

FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest, FEHÉRJÉK A MÁGNESEKBEN Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium Alkímia Ma, Budapest, 2013.02.28. I. FEHÉRJÉK: L-α aminosavakból felépülő lineáris polimerek α H 2 N CH COOH amino


A humán tripszinogén 4 expressziója és eloszlási mintázata az emberi agyban

A humán tripszinogén 4 expressziója és eloszlási mintázata az emberi agyban A humán tripszinogén 4 expressziója és eloszlási mintázata az emberi agyban Doktori (PhD) értekezés Siklódi Erika Rozália Biológia Doktori Iskola Iskolavezető: Prof. Erdei Anna, tanszékvezető egyetemi


Sejt - kölcsönhatások az idegrendszerben

Sejt - kölcsönhatások az idegrendszerben Sejt - kölcsönhatások az idegrendszerben dendrit Sejttest Axon sejtmag Axon domb Schwann sejt Ranvier mielinhüvely csomó (befűződés) terminális Sejt - kölcsönhatások az idegrendszerben Szinapszis típusok


1. Előadás Membránok felépítése, mebrán raftok

1. Előadás Membránok felépítése, mebrán raftok 1. Előadás Membránok felépítése, mebrán raftok Plazmamembrán Membrán funkciói: sejt integritásának fenntartása állandó hő, energia, és információcsere biztosítása homeosztázis biztosítása Klasszikus folyadékmozaik


Mitől döglik a légy? Dr. Juhász Gábor tudományos főmunkatárs ELTE Anatómiai, Sejt- és Fejlődésbiológiai Tanszék

Mitől döglik a légy? Dr. Juhász Gábor tudományos főmunkatárs ELTE Anatómiai, Sejt- és Fejlődésbiológiai Tanszék Mitől döglik a légy? Dr. Juhász Gábor tudományos főmunkatárs ELTE Anatómiai, Sejt- és Fejlődésbiológiai Tanszék Mendel-i öröklődés szabályai (1866) 1. Dominancia törvénye, amely


Magisztrális gyógyszerkészítés a Wilson kór terápiájában. Dr. Birinyi Péter Mikszáth Gyógyszertár 1088 Budapest, Mikszáth Kálmán tér 4.

Magisztrális gyógyszerkészítés a Wilson kór terápiájában. Dr. Birinyi Péter Mikszáth Gyógyszertár 1088 Budapest, Mikszáth Kálmán tér 4. Magisztrális gyógyszerkészítés a Wilson kór terápiájában Dr. Birinyi Péter Mikszáth Gyógyszertár 1088 Budapest, Mikszáth Kálmán tér 4. A Wilson kór mérföldkövei 1912. Wilson: Progressive lenticular degeneration:


11. Dr. House. Biokémiai és sejtbiológiai módszerek alkalmazása az orvoslásban

11. Dr. House. Biokémiai és sejtbiológiai módszerek alkalmazása az orvoslásban 11. Dr. House. Biokémiai és sejtbiológiai módszerek alkalmazása az orvoslásban HIV fertőzés kimutatása - (fiktív) esettanulmány 35 éves nő, HIV fertőzöttség gyanúja. Két partner az elmúlt időszakban. Fertőzött-e


~ 1 ~ Ezek alapján a következő célokat valósítottuk meg a Ph.D. munkám során:

~ 1 ~ Ezek alapján a következő célokat valósítottuk meg a Ph.D. munkám során: ~ 1 ~ Bevezetés és célkitűzések A sejtekben egy adott időpillanatban expresszált fehérjék összessége a proteom. A kvantitatív proteomika célja a proteom, egy adott kezelés vagy stimulus hatására bekövetkező



BIOMOLEKULÁK KÉMIÁJA. Novák-Nyitrai-Hazai BIOMOLEKULÁK KÉMIÁJA Novák-Nyitrai-Hazai A tankönyv elsısorban szerves kémiai szempontok alapján tárgyalja az élı szervezetek felépítésében és mőködésében kulcsfontosságú szerves vegyületeket. A tárgyalás-


Fehérjeszerkezet, és tekeredés. Futó Kinga

Fehérjeszerkezet, és tekeredés. Futó Kinga Fehérjeszerkezet, és tekeredés Futó Kinga Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983 H 211861 N


Új terápiás lehetőségek helyzete. Dr. Varga Norbert Heim Pál Gyermekkórház Toxikológia és Anyagcsere Osztály

Új terápiás lehetőségek helyzete. Dr. Varga Norbert Heim Pál Gyermekkórház Toxikológia és Anyagcsere Osztály Új terápiás lehetőségek helyzete Dr. Varga Norbert Heim Pál Gyermekkórház Toxikológia és Anyagcsere Osztály Mucopolysaccharidosisok MPS I (Hurler-Scheie) Jelenleg elérhető oki terápiák Enzimpótló kezelés





Alzheimer-kór diagnosztikájára alkalmas β-amiloid epitóp peptidet tartalmazó konjugátumok szintézise

Alzheimer-kór diagnosztikájára alkalmas β-amiloid epitóp peptidet tartalmazó konjugátumok szintézise TUDMÁNYS DIÁKKÖRI DLGZAT PETHŐ LILLA Alzheimer-kór diagnosztikájára alkalmas β-amiloid epitóp peptidet tartalmazó konjugátumok szintézise Témavezető: Dr. Mező Gábor tudományos tanácsadó ELTE Kémiai Intézet,


NÖVÉNYGENETIKA. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP /1/A

NÖVÉNYGENETIKA. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP /1/A NÖVÉNYGENETIKA Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 A NÖVÉNYI TÁPANYAG TRANSZPORTEREK az előadás áttekintése A tápionok útja a növényben Növényi tápionok passzív és


Immunológia alapjai előadás MHC. szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás.

Immunológia alapjai előadás MHC. szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás. Immunológia alapjai 5-6. előadás MHC szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás. Antigén felismerés Az ellenanyagok és a B sejt receptorok natív formában


9. előadás Sejtek közötti kommunikáció

9. előadás Sejtek közötti kommunikáció 9. előadás Sejtek közötti kommunikáció Intracelluláris kommunikáció: Elmozdulás aktin szálak mentén miozin segítségével: A mikrofilamentum rögzített, A miozin mozgékony, vándorol az aktinmikrofilamentum


Hátterükben egyetlen gén áll, melynek általában számottevő a viselkedésre gyakorolt hatása, öröklési mintázata jellegzetes.

Hátterükben egyetlen gén áll, melynek általában számottevő a viselkedésre gyakorolt hatása, öröklési mintázata jellegzetes. Múlt órán: Lehetséges tesztfeladatok: Kitől származik a variáció-szelekció paradigma, mely szerint az egyéni, javarészt öröklött különbségek között a társadalmi harc válogat? Fromm-Reichmann Mill Gallton


Két kevéssé ismert humán ABCG fehérje expressziója és funkcionális vizsgálata: ABCG1 és ABCG4 jellemzése

Két kevéssé ismert humán ABCG fehérje expressziója és funkcionális vizsgálata: ABCG1 és ABCG4 jellemzése Két kevéssé ismert humán ABCG fehérje expressziója és funkcionális vizsgálata: ABCG1 és ABCG4 jellemzése Doktori tézisek Dr. Cserepes Judit Semmelweis Egyetem Molekuláris Orvostudományok Doktori Iskola


A metabolikus szindróma genetikai háttere. Kappelmayer János, Balogh István (

A metabolikus szindróma genetikai háttere. Kappelmayer János, Balogh István ( A metabolikus szindróma genetikai háttere Kappelmayer János, Balogh István ( Definíció WHO, 1999 EGIR, 1999 ATP III, 2001 Ha három vagy több komponens jelen van a betegben: Vérnyomás: > 135/85


2006 1. Nemszinaptikus receptorok és szubmikronos Ca2+ válaszok: A két-foton lézermikroszkópia felhasználása a farmakológiai vizsgálatokra.

2006 1. Nemszinaptikus receptorok és szubmikronos Ca2+ válaszok: A két-foton lézermikroszkópia felhasználása a farmakológiai vizsgálatokra. 2006 1. Nemszinaptikus receptorok és szubmikronos Ca 2+ válaszok: A két-foton lézermikroszkópia felhasználása a farmakológiai vizsgálatokra. A kutatócsoportunkban Közép Európában elsőként bevezetett két-foton


Mit tud a genetika. Génterápiás lehetőségek MPS-ben. Dr. Varga Norbert

Mit tud a genetika. Génterápiás lehetőségek MPS-ben. Dr. Varga Norbert Mit tud a genetika Génterápiás lehetőségek MPS-ben Dr. Varga Norbert Oki terápia Terápiás lehetőségek MPS-ben A kiváltó okot gyógyítja meg ERT Enzimpótló kezelés Őssejt transzplantáció Genetikai beavatkozások


12. évfolyam esti, levelező

12. évfolyam esti, levelező 12. évfolyam esti, levelező I. ÖKOLÓGIA EGYED FELETTI SZERVEZŐDÉSI SZINTEK 1. A populációk jellemzése, növekedése 2. A populációk környezete, tűrőképesség 3. Az élettelen környezeti tényezők: fény hőmérséklet,


Krill olaj, a leghatásosabb omega-3 forrás. Előadó: Dr Deák Sándor belgyógyász Szarvas

Krill olaj, a leghatásosabb omega-3 forrás. Előadó: Dr Deák Sándor belgyógyász Szarvas Krill olaj, a leghatásosabb omega-3 forrás Előadó: Dr Deák Sándor belgyógyász Szarvas MI IS A KRILL? A Krill egy apró, garnéla szerű rák. Ezek alkotják a föld legnagyobb biomassza állományát, a becsült


Agyi kisér betegségek

Agyi kisér betegségek Agyi kisér betegségek Dr. Farkas Eszter 2016. december 1. Agyi kisérbetegségek Rosenberg et al., Lancet Neurology,, 2009 Vaszkuláris demencia Vaszkuláris kognitív rendellenesség Multi-infarktus demencia





Biológiai membránok és membrántranszport

Biológiai membránok és membrántranszport Biológiai membránok és membrántranszport Biológiai membránok A citoplazma membrán funkciói: térrészek elválasztása (egész sejt, organellumok) transzport jelátvitel Milyen a membrán szerkezete? lipidek


Hús és hústermék, mint funkcionális élelmiszer

Hús és hústermék, mint funkcionális élelmiszer Hús és hústermék, mint funkcionális élelmiszer Szilvássy Z., Jávor A., Czeglédi L., Csiki Z., Csernus B. Debreceni Egyetem Funkcionális élelmiszer Első használat: 1984, Japán speciális összetevő feldúsítása


Membránpotenciál. Nyugalmi membránpotenciál. Akciós potenciál

Membránpotenciál. Nyugalmi membránpotenciál. Akciós potenciál Membránpotenciál Vig Andrea 2014.10.29. Nyugalmi membránpotenciál Akciós potenciál


Biológiai módszerek alkalmazása környezeti hatások okozta terhelések kimutatására

Biológiai módszerek alkalmazása környezeti hatások okozta terhelések kimutatására Szalma Katalin Biológiai módszerek alkalmazása környezeti hatások okozta terhelések kimutatására Témavezető: Dr. Turai István, OSSKI Budapest, 2010. október 4. Az ionizáló sugárzás sejt kölcsönhatása Antone


Szerkesztette: Vizkievicz András

Szerkesztette: Vizkievicz András Fehérjék A fehérjék - proteinek - az élő szervezetek számára a legfontosabb vegyületek. Az élet bármilyen megnyilvánulási formája fehérjékkel kapcsolatos. A sejtek szárazanyagának minimum 50 %-át adják.


Gyógyszeres kezelések

Gyógyszeres kezelések Gyógyszeres kezelések Az osteogenesis imperfecta gyógyszeres kezelésében számos szert kipróbáltak az elmúlt évtizedekben, de átütő eredménnyel egyik se szolgált. A fluorid kezelés alkalmazása osteogenesis


1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói

1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói 1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói Plazmamembrán Membrán funkciói: sejt integritásának fenntartása állandó hő, energia, és információcsere biztosítása homeosztázis


Fehérjeszerkezet, fehérjetekeredés

Fehérjeszerkezet, fehérjetekeredés Fehérjeszerkezet, fehérjetekeredés A fehérjeszerkezet szintjei A fehérjetekeredés elmélete: Anfinsen kísérlet Levinthal paradoxon A feltekeredés tölcsér elmélet 2014.11.05. Aminosavak és fehérjeszerkezet


Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Azonosító szám: TÁMOP-4.1.2-08/1/A-2009-0011 Az orvosi


Szénhidrátok monoszacharidok formájában szívódnak fel a vékonybélből.

Szénhidrátok monoszacharidok formájában szívódnak fel a vékonybélből. Vércukorszint szabályozása: Szénhidrátok monoszacharidok formájában szívódnak fel a vékonybélből. Szövetekben monoszacharid átalakítás enzimjei: Szénhidrát anyagcserében máj központi szerepű. Szénhidrát


Élettan. előadás tárgykód: bf1c1b10 ELTE TTK, fizika BSc félév: 2015/2016., I. időpont: csütörtök, 8:15 9:45

Élettan. előadás tárgykód: bf1c1b10 ELTE TTK, fizika BSc félév: 2015/2016., I. időpont: csütörtök, 8:15 9:45 Élettan előadás tárgykód: bf1c1b10 ELTE TTK, fizika BSc félév: 2015/2016., I. időpont: csütörtök, 8:15 9:45 oktató: Dr. Tóth Attila, adjunktus ELTE TTK Biológiai Intézet, Élettani és Neurobiológiai tanszék


Mire költi a szervezet energiáját?

Mire költi a szervezet energiáját? Glükóz lebontás Lebontó folyamatok A szénhidrátok és zsírok lebontása során széndioxid és víz keletkezése közben energia keletkezik (a széndioxidot kilélegezzük, a vizet pedig szervezetünkben felhasználjuk).


3. Kombinált, amelynek van helikális és kubikális szakasza, pl. a bakteriofágok és egyes rákkeltő RNS vírusok.

3. Kombinált, amelynek van helikális és kubikális szakasza, pl. a bakteriofágok és egyes rákkeltő RNS vírusok. Vírusok Szerkesztette: Vizkievicz András A XIX. sz. végén Dmitrij Ivanovszkij orosz biológus a dohány mozaikosodásának kórokozóját próbálta kimutatni. A mozaikosodás a levél foltokban jelentkező sárgulása.


A tananyag felépítése: A BIOLÓGIA ALAPJAI. I. Prokarióták és eukarióták. Az eukarióta sejt. Pécs Miklós: A biológia alapjai

A tananyag felépítése: A BIOLÓGIA ALAPJAI. I. Prokarióták és eukarióták. Az eukarióta sejt. Pécs Miklós: A biológia alapjai A BIOLÓGIA ALAPJAI A tananyag felépítése: Környezetmérnök és műszaki menedzser hallgatók számára Előadó: 2 + 0 + 0 óra, félévközi számonkérés 3 ZH: október 3, november 5, december 5 dr. Pécs Miklós egyetemi


Dr. Semsei Imre. Demencia okozta társadalmi kihívások - demenciával együtt élő társadalom

Dr. Semsei Imre. Demencia okozta társadalmi kihívások - demenciával együtt élő társadalom Dr. Semsei Imre Demencia okozta társadalmi kihívások - demenciával együtt élő társadalom Szakmai felvezetés, a módszertani ajánlásosok szakmai indokoltsága Demográfia átmenet kihívásai, EU-s irányelvek


Norvég Finanszírozási Mechanizmus által támogatott projekt HU-0115/NA/2008-3/ÖP-9 ÚJ TERÁPIÁS CÉLPONTOK AZONOSÍTÁSA GENOMIKAI MÓDSZEREKKEL



Újabb terápiás lehetőségek a Huntington kór állatmodelljében

Újabb terápiás lehetőségek a Huntington kór állatmodelljében Zárójelentés az Újabb terápiás lehetőségek a Huntington kór állatmodelljében című, F 4336 számú pályázathoz Dr. Klivényi Péter Szegedi Tudományegyetem Neurológiai Klinika 27 Előzmények: A Huntington kór


A PET szerepe a gyógyszerfejlesztésben. Berecz Roland DE KK Pszichiátriai Tanszék

A PET szerepe a gyógyszerfejlesztésben. Berecz Roland DE KK Pszichiátriai Tanszék A PET szerepe a gyógyszerfejlesztésben Berecz Roland DE KK Pszichiátriai Tanszék Gyógyszerfejlesztés Felfedezés gyógyszertár : 10-15 év Kb. 1 millárd USD/gyógyszer (beleszámolva a sikertelen fejlesztéseket)


Sejtek - őssejtek dióhéjban. 2014. február. Sarkadi Balázs, MTA-TTK Molekuláris Farmakológiai Intézet - SE Kutatócsoport, Budapest

Sejtek - őssejtek dióhéjban. 2014. február. Sarkadi Balázs, MTA-TTK Molekuláris Farmakológiai Intézet - SE Kutatócsoport, Budapest Sejtek - őssejtek dióhéjban 2014. február Sarkadi Balázs, MTA-TTK Molekuláris Farmakológiai Intézet - SE Kutatócsoport, Budapest A legtöbb sejtünk osztódik, differenciálódik, elpusztul... vérsejtek Vannak


Tudománytörténeti visszatekintés

Tudománytörténeti visszatekintés GENETIKA I. AZ ÖRÖKLŐDÉS TÖRVÉNYSZERŰSÉGEI Minek köszönhető a biológiai sokféleség? Hogyan történik a tulajdonságok átörökítése? Tudománytörténeti visszatekintés 1. Keveredés alapú öröklődés: (1761-1766,


ZSÍRSAVAK OXIDÁCIÓJA. FRANZ KNOOP német biokémikus írta le először a mechanizmusát. R C ~S KoA. a, R-COOH + ATP + KoA R C ~S KoA + AMP + PP i

ZSÍRSAVAK OXIDÁCIÓJA. FRANZ KNOOP német biokémikus írta le először a mechanizmusát. R C ~S KoA. a, R-COOH + ATP + KoA R C ~S KoA + AMP + PP i máj, vese, szív, vázizom ZSÍRSAVAK XIDÁCIÓJA FRANZ KNP német biokémikus írta le először a mechanizmusát 1 lépés: a zsírsavak aktivációja ( a sejt citoplazmájában, rövid zsírsavak < C12 nem aktiválódnak)


Natív antigének felismerése. B sejt receptorok, immunglobulinok

Natív antigének felismerése. B sejt receptorok, immunglobulinok Natív antigének felismerése B sejt receptorok, immunglobulinok B és T sejt receptorok A B és T sejt receptorok is az immunglobulin fehérje család tagjai A TCR nem ismeri fel az antigéneket, kizárólag az


A felépítő és lebontó folyamatok. Biológiai alapismeretek

A felépítő és lebontó folyamatok. Biológiai alapismeretek A felépítő és lebontó folyamatok Biológiai alapismeretek Anyagforgalom: Lebontó Felépítő Lebontó folyamatok csoportosítása: Biológiai oxidáció Erjedés Lebontó folyamatok összehasonlítása Szénhidrátok


Példák a független öröklődésre

Példák a független öröklődésre GENETIKAI PROBLÉMÁK Példák a független öröklődésre Az amelogenesis imperfecta egy, a fogzománc gyengeségével és elszíneződésével járó öröklődő betegség, a 4-es kromoszómán lévő enam gén recesszív mutációja


La Fontaine: A tücsök és a hangya. Ez a (tan)mese azoknak szól, akik az első demón elégtelent kaptak

La Fontaine: A tücsök és a hangya. Ez a (tan)mese azoknak szól, akik az első demón elégtelent kaptak Ez a (tan)mese azoknak szól, akik az első demón elégtelent kaptak La Fontaine: A tücsök és a hangya Mit csinált a Tücsök nyáron? Csak muzsikált hét határon. Aztán jött a tél a nyárra, s fölkopott a koma


Az aminoxidázok és a NADPH-oxidáz szerepe az ér- és neuronkárosodások kialakulásában (patomechanizmus és gyógyszeres befolyásolás)

Az aminoxidázok és a NADPH-oxidáz szerepe az ér- és neuronkárosodások kialakulásában (patomechanizmus és gyógyszeres befolyásolás) Az aminoxidázok és a NADPH-oxidáz szerepe az ér- és neuronkárosodások kialakulásában (patomechanizmus és gyógyszeres befolyásolás) Az aminoxidázok két nagy csoportjának, a monoamin-oxidáznak (MAO), valamint


A preventív vakcináció lényege :

A preventív vakcináció lényege : Vakcináció Célja: antigénspecifkus immunválasz kiváltása a szervezetben A vakcina egy olyan készítmény, amely fokozza az immunitást egy adott betegséggel szemben (aktiválja az immunrendszert). A preventív


IONCSATORNÁK. I. Szelektivitás és kapuzás. III. Szabályozás enzimek és alegységek által. IV. Akciós potenciál és szinaptikus átvitel

IONCSATORNÁK. I. Szelektivitás és kapuzás. III. Szabályozás enzimek és alegységek által. IV. Akciós potenciál és szinaptikus átvitel IONCSATORNÁK I. Szelektivitás és kapuzás II. Struktúra és funkció III. Szabályozás enzimek és alegységek által IV. Akciós potenciál és szinaptikus átvitel V. Ioncsatornák és betegségek VI. Ioncsatornák


A sejtek közöti kommunikáció formái. BsC II. Sejtélettani alapok Dr. Fodor János

A sejtek közöti kommunikáció formái. BsC II. Sejtélettani alapok Dr. Fodor János A sejtek közöti kommunikáció formái BsC II. Sejtélettani alapok Dr. Fodor János 2010. 03.19. I. Kommunikáció, avagy a sejtek informálják egymást Kémiai jelátvitel formái Az üzenetek kémiai úton történő






MEDICINÁLIS ALAPISMERETEK BIOKÉMIA A BIOLÓGIAI MEMBRÁNOK 1. kulcsszó cím: MEMBRÁNOK Modul cím: MEDICINÁLIS ALAPISMERETEK BIOKÉMIA A BIOLÓGIAI MEMBRÁNOK 1. kulcsszó cím: MEMBRÁNOK A membránok minden sejtnek lényeges alkotórészei. Egyrészt magát a sejtet határolják - ez a sejtmembrán vagy


A β-amyloid progresszió hatása a mitokondriális proteomra és oxidatív metabolizmusra - a szinaptikus mitokondriumok kitüntetett szerepe

A β-amyloid progresszió hatása a mitokondriális proteomra és oxidatív metabolizmusra - a szinaptikus mitokondriumok kitüntetett szerepe A β-amyloid progresszió hatása a mitokondriális proteomra és oxidatív metabolizmusra - a szinaptikus mitokondriumok kitüntetett szerepe Doktori (Ph.D.) értekezés Völgyi Katalin Eötvös Loránd Tudományegyetem,


A vérképző rendszerben ionizáló sugárzás által okozott mutációk kialakulásának numerikus modellezése

A vérképző rendszerben ionizáló sugárzás által okozott mutációk kialakulásának numerikus modellezése A vérképző rendszerben ionizáló sugárzás által okozott mutációk kialakulásának numerikus modellezése Madas Balázs Gergely XXXIX. Sugárvédelmi Továbbképző Tanfolyam Hajdúszoboszló, Hunguest Hotel Béke 2014.


3. A w jelű folyamat kémiailag kondenzáció. 4. Ebben az átalakulásban hasonló kémiai reakció zajlik le, mint a zsírok emésztésekor a vékonybélben.

3. A w jelű folyamat kémiailag kondenzáció. 4. Ebben az átalakulásban hasonló kémiai reakció zajlik le, mint a zsírok emésztésekor a vékonybélben. FEHÉRJÉK 1. Fehérjék bioszintézisére csak az autotróf szervezetek képesek. Széndioxidból, vízből és más szervetlen anyagokból csak autotróf élőlények képesek szerves vegyületeket előállítani. Az alábbi





A MASP-1 dózis-függő módon vazorelaxációt. okoz egér aortában

A MASP-1 dózis-függő módon vazorelaxációt. okoz egér aortában Analog input Analog input 157.34272 167.83224 178.32175 188.81127 Relaxáció (prekontrakció %) Channel 8 Channel 8 Analog input Volts Volts Channel 12 A dózis-függő módon vazorelaxációt Vehikulum 15.80


térrészek elválasztása transzport jelátvitel Milyen a membrán szerkezete? Milyen a membrán szerkezete? lipid kettısréteg, hidrofil/hidrofób részek

térrészek elválasztása transzport jelátvitel Milyen a membrán szerkezete? Milyen a membrán szerkezete? lipid kettısréteg, hidrofil/hidrofób részek Biológiai membránok A citoplazma membrán funkciói: Biológiai membránok és membrántranszport térrészek elválasztása (egész sejt, organellumok) transzport jelátvitel Milyen a membrán szerkezete? lipidek



1. SEJT-, ÉS SZÖVETTAN. I. A sejt 1. SEJT-, ÉS SZÖVETTAN SZAKMAI INFORMÁCIÓTARTALOM I. A sejt A sejt cellula az élő szervezet alapvető szerkezeti és működési egysége, amely képes az önálló anyag cserefolyamatokra és a szaporodásra. Alapvetően


4. A humorális immunválasz október 12.

4. A humorális immunválasz október 12. 4. A humorális immunválasz 2016. október 12. A klónszelekciós elmélet sarokpontjai: Monospecifictás: 1 sejt 1-féle specificitású receptor Az antigén receptorhoz kötődése aktiválja a limfocitát A keletkező
